Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

TTG is translated to M #58

Open
philipperuiz opened this issue Jul 17, 2024 · 1 comment
Open

TTG is translated to M #58

philipperuiz opened this issue Jul 17, 2024 · 1 comment
Labels
bug Something isn't working

Comments

@philipperuiz
Copy link

Hi, as Prodigal v2.6.3, we observe with pyrodigal a difference in translation result for some start codon (TTG).

nuc sequence (Lactobacillus)
TTGGGCATACCGGCTGAATACGTCTTATTCGACAGCTGTTTCTCTTCACCTAAAATGTTCTGGCAGCTGAAACAATTAGGGTTAGACAGCGTAGGCATGCTTAAGCGGACCAAGAAAGCTTATTATCGTTACCGTGGCCGACTTTATGATGTCAAAGGCCTGTACGAGCGCTTAGCTGCTTCCAAAATGCGTCAAAAAGAAGACTATCCCTATAGCAGCGTGGTCGAACCTGAATATCAGGGACATGTTTTCCAAATTAGATTAGTCTATGTCACTAAGCGCGGCGGTAAAGGAAAATATTTGGTACTGGTAACCACGCAATACAAGCTGCGATCAAAGTATTGCACGTCTTCTATGACAAGTGGAACAGAGCTTATAATCATGTCATAA

Prodigal / pyrodigal output
MGIPAEYVLFDSCFSSPKMFWQLKQLGLDSVGMLKRTKKAYYRYRGRLYDVKGLYERLAASKMRQKEDYPYSSVVEPEYQGHVFQIRLVYVTKRGGKGKYLVLVTTQYKLRSKYCTSSMTSGTELIIMS*

Expected sequence (Expasy 5'3' Frame 1)
LGIPAEYVLFDSCFSSPKMFWQLKQLGLDSVGMLKRTKKAYYRYRGRLYDVKGLYERLAASKMRQKEDYPYSSVVEPEYQGHVFQIRLVYVTKRGGGKYLVLVTTQYKLRSKYCTSSMTSGTELIIMS*

Maybe it is due to the use of wrong genetic code in this case ?

@philipperuiz philipperuiz changed the title GTG is translated to M TTG is translated to M Jul 17, 2024
@althonos
Copy link
Owner

althonos commented Jul 17, 2024

This looks like it has been fixed in later versions, v3.4.1 doesn't seem to have that problem.
(at least when I'm testing with just the given sequence).

@althonos althonos added the bug Something isn't working label Jul 17, 2024
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment
Labels
bug Something isn't working
Projects
None yet
Development

No branches or pull requests

2 participants