diff --git a/go.mod b/go.mod index 0e97879bc..c03b03865 100644 --- a/go.mod +++ b/go.mod @@ -3,10 +3,10 @@ module github.com/simplesurance/baur/v3 go 1.21 require ( - github.com/containerd/containerd v1.6.18 // indirect + github.com/containerd/containerd v1.6.26 // indirect github.com/docker/docker v24.0.7+incompatible // indirect github.com/fatih/color v1.16.0 - github.com/fsouza/go-dockerclient v1.10.0 + github.com/fsouza/go-dockerclient v1.10.1 github.com/gogo/protobuf v1.3.2 // indirect github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da github.com/google/uuid v1.5.0 @@ -18,10 +18,10 @@ require ( github.com/simplesurance/baur v0.20.0 github.com/spf13/cobra v1.8.0 github.com/stretchr/testify v1.8.4 - golang.org/x/crypto v0.6.0 // indirect + golang.org/x/crypto v0.14.0 // indirect golang.org/x/mod v0.14.0 // indirect - golang.org/x/sys v0.14.0 // indirect - golang.org/x/text v0.7.0 // indirect + golang.org/x/sys v0.15.0 // indirect + golang.org/x/text v0.13.0 // indirect golang.org/x/tools v0.16.1 gopkg.in/yaml.v3 v3.0.1 // indirect ) @@ -65,7 +65,7 @@ require ( github.com/jackc/pgtype v1.14.0 // indirect github.com/jackc/puddle v1.3.0 // indirect github.com/jmespath/go-jmespath v0.4.0 // indirect - github.com/klauspost/compress v1.11.13 // indirect + github.com/klauspost/compress v1.15.9 // indirect github.com/kr/text v0.2.0 // indirect github.com/mattn/go-colorable v0.1.13 // indirect github.com/mattn/go-isatty v0.0.20 // indirect @@ -74,12 +74,12 @@ require ( github.com/morikuni/aec v1.0.0 // indirect github.com/niemeyer/pretty v0.0.0-20200227124842-a10e7caefd8e // indirect github.com/opencontainers/go-digest v1.0.0 // indirect - github.com/opencontainers/image-spec v1.1.0-rc2 // indirect + github.com/opencontainers/image-spec v1.1.0-rc2.0.20221005185240-3a7f492d3f1b // indirect github.com/opencontainers/runc v1.1.5 // indirect github.com/pkg/errors v0.9.1 // indirect github.com/pmezard/go-difflib v1.0.0 // indirect github.com/rs/xid v1.2.1 // indirect - github.com/sirupsen/logrus v1.9.0 // indirect + github.com/sirupsen/logrus v1.9.3 // indirect github.com/spf13/pflag v1.0.5 // indirect gopkg.in/check.v1 v1.0.0-20200227125254-8fa46927fb4f // indirect ) diff --git a/go.sum b/go.sum index cb11f01b4..e11ec1093 100644 --- a/go.sum +++ b/go.sum @@ -12,8 +12,8 @@ github.com/Microsoft/go-winio v0.6.1 h1:9/kr64B9VUZrLm5YYwbGtUJnMgqWVOdUAXu6Migc github.com/Microsoft/go-winio v0.6.1/go.mod h1:LRdKpFKfdobln8UmuiYcKPot9D2v6svN5+sAH+4kjUM= github.com/Microsoft/hcsshim v0.8.7-0.20191101173118-65519b62243c/go.mod h1:7xhjOwRV2+0HXGmM0jxaEu+ZiXJFoVZOTfL/dmqbrD8= github.com/Microsoft/hcsshim v0.8.7/go.mod h1:OHd7sQqRFrYd3RmSgbgji+ctCwkbq2wbEYNSzOYtcBQ= -github.com/Microsoft/hcsshim v0.9.6 h1:VwnDOgLeoi2du6dAznfmspNqTiwczvjv4K7NxuY9jsY= -github.com/Microsoft/hcsshim v0.9.6/go.mod h1:7pLA8lDk46WKDWlVsENo92gC0XFa8rbKfyFRBqxEbCc= +github.com/Microsoft/hcsshim v0.9.10 h1:TxXGNmcbQxBKVWvjvTocNb6jrPyeHlk5EiDhhgHgggs= +github.com/Microsoft/hcsshim v0.9.10/go.mod h1:7pLA8lDk46WKDWlVsENo92gC0XFa8rbKfyFRBqxEbCc= github.com/aws/aws-sdk-go v1.28.9/go.mod h1:KmX6BPdI08NWTb3/sm4ZGu5ShLoqVDhKgpiN924inxo= github.com/aws/aws-sdk-go-v2 v1.24.0 h1:890+mqQ+hTpNuw0gGP6/4akolQkSToDJgHfQE7AwGuk= github.com/aws/aws-sdk-go-v2 v1.24.0/go.mod h1:LNh45Br1YAkEKaAqvmE1m8FUx6a5b/V0oAKV7of29b4= @@ -68,8 +68,8 @@ github.com/containerd/console v1.0.3/go.mod h1:7LqA/THxQ86k76b8c/EMSiaJ3h1eZkMkX github.com/containerd/containerd v1.3.0-beta.2.0.20190828155532-0293cbd26c69/go.mod h1:bC6axHOhabU15QhwfG7w5PipXdVtMXFTttgp+kVtyUA= github.com/containerd/containerd v1.3.0/go.mod h1:bC6axHOhabU15QhwfG7w5PipXdVtMXFTttgp+kVtyUA= github.com/containerd/containerd v1.3.2/go.mod h1:bC6axHOhabU15QhwfG7w5PipXdVtMXFTttgp+kVtyUA= -github.com/containerd/containerd v1.6.18 h1:qZbsLvmyu+Vlty0/Ex5xc0z2YtKpIsb5n45mAMI+2Ns= -github.com/containerd/containerd v1.6.18/go.mod h1:1RdCUu95+gc2v9t3IL+zIlpClSmew7/0YS8O5eQZrOw= +github.com/containerd/containerd v1.6.26 h1:VVfrE6ZpyisvB1fzoY8Vkiq4sy+i5oF4uk7zu03RaHs= +github.com/containerd/containerd v1.6.26/go.mod h1:I4TRdsdoo5MlKob5khDJS2EPT1l1oMNaE2MBm6FrwxM= github.com/containerd/continuity v0.0.0-20190426062206-aaeac12a7ffc/go.mod h1:GL3xCUCBDV3CZiTSEKksMWbLE66hEyuu9qyDOOqM47Y= github.com/containerd/continuity v0.0.0-20200107194136-26c1120b8d41/go.mod h1:Dq467ZllaHgAtVp4p1xUQWBrFXR9s/wyoTpG8zOJGkY= github.com/containerd/fifo v0.0.0-20190226154929-a9fb20d87448/go.mod h1:ODA38xgv3Kuk8dQz2ZQXpnv/UZZUHUCL7pnLehbXgQI= @@ -107,8 +107,8 @@ github.com/fatih/color v1.16.0/go.mod h1:fL2Sau1YI5c0pdGEVCbKQbLXB6edEj1ZgiY4Nij github.com/frankban/quicktest v1.11.3/go.mod h1:wRf/ReqHper53s+kmmSZizM8NamnL3IM0I9ntUbOk+k= github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMoQvtojpjFo= github.com/fsouza/go-dockerclient v1.6.0/go.mod h1:YWwtNPuL4XTX1SKJQk86cWPmmqwx+4np9qfPbb+znGc= -github.com/fsouza/go-dockerclient v1.10.0 h1:ppSBsbR60I1DFbV4Ag7LlHlHakHFRNLk9XakATW1yVQ= -github.com/fsouza/go-dockerclient v1.10.0/go.mod h1:+iNzAW78AzClIBTZ6WFjkaMvOgz68GyCJ236b1opLTs= +github.com/fsouza/go-dockerclient v1.10.1 h1:bSU5Wu2ARdub+iv9VtoDsN8yBUI0vgflmshbeQLKhvc= +github.com/fsouza/go-dockerclient v1.10.1/go.mod h1:dyzGriw6v3pK4O4O1u/X+vXxDDsrnLLkCqYkcLsDq2k= github.com/go-kit/log v0.1.0/go.mod h1:zbhenjAZHb184qTLMA9ZjW7ThYL0H2mk7Q6pNt4vbaY= github.com/go-logfmt/logfmt v0.5.0/go.mod h1:wCYkCAKZfumFQihp8CzCvQ3paCTfi41vtzG1KdI/P7A= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= @@ -135,8 +135,8 @@ github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMyw github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.5.4/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= -github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= -github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= +github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= +github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI= github.com/google/uuid v1.5.0 h1:1p67kYwdtXjb0gL0BPiP1Av9wiZPo5A8z2cWkTZ+eyU= github.com/google/uuid v1.5.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= @@ -207,8 +207,8 @@ github.com/kisielk/errcheck v1.1.0/go.mod h1:EZBBE59ingxPouuu3KfxchcWSUPOHkagtvW github.com/kisielk/errcheck v1.2.0/go.mod h1:/BMXB+zMLi60iA8Vv6Ksmxu/1UDYcXs4uQLJ+jE2L00= github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI2bnpBCr8= github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= -github.com/klauspost/compress v1.11.13 h1:eSvu8Tmq6j2psUJqJrLcWH6K3w5Dwc+qipbaA6eVEN4= -github.com/klauspost/compress v1.11.13/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs= +github.com/klauspost/compress v1.15.9 h1:wKRjX6JRtDdrE9qwa4b/Cip7ACOshUI4smpCQanqjSY= +github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHUDtV4Yw2GlzU= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/konsorten/go-windows-terminal-sequences v1.0.2/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= @@ -255,8 +255,8 @@ github.com/opencontainers/go-digest v1.0.0-rc1/go.mod h1:cMLVZDEM3+U2I4VmLI6N8jQ github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8Oi/yOhh5U= github.com/opencontainers/go-digest v1.0.0/go.mod h1:0JzlMkj0TRzQZfJkVvzbP0HBR3IKzErnv2BNG4W4MAM= github.com/opencontainers/image-spec v1.0.1/go.mod h1:BtxoFyWECRxE4U/7sNtV5W15zMzWCbyJoFRP3s7yZA0= -github.com/opencontainers/image-spec v1.1.0-rc2 h1:2zx/Stx4Wc5pIPDvIxHXvXtQFW/7XWJGmnM7r3wg034= -github.com/opencontainers/image-spec v1.1.0-rc2/go.mod h1:3OVijpioIKYWTqjiG0zfF6wvoJ4fAXGbjdZuI2NgsRQ= +github.com/opencontainers/image-spec v1.1.0-rc2.0.20221005185240-3a7f492d3f1b h1:YWuSjZCQAPM8UUBLkYUk1e+rZcvWHJmFb6i6rM44Xs8= +github.com/opencontainers/image-spec v1.1.0-rc2.0.20221005185240-3a7f492d3f1b/go.mod h1:3OVijpioIKYWTqjiG0zfF6wvoJ4fAXGbjdZuI2NgsRQ= github.com/opencontainers/runc v0.0.0-20190115041553-12f6a991201f/go.mod h1:qT5XzbpPznkRYVz/mWwUaVBUv2rmF59PVA73FjuZG0U= github.com/opencontainers/runc v0.1.1/go.mod h1:qT5XzbpPznkRYVz/mWwUaVBUv2rmF59PVA73FjuZG0U= github.com/opencontainers/runc v1.1.5 h1:L44KXEpKmfWDcS02aeGm8QNTFXTo2D+8MYGDIJ/GDEs= @@ -297,8 +297,8 @@ github.com/sirupsen/logrus v1.0.4-0.20170822132746-89742aefa4b2/go.mod h1:pMByvH github.com/sirupsen/logrus v1.4.1/go.mod h1:ni0Sbl8bgC9z8RoU9G6nDWqqs/fq4eDPysMBDgk/93Q= github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE= github.com/sirupsen/logrus v1.8.1/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0= -github.com/sirupsen/logrus v1.9.0 h1:trlNQbNUG3OdDrDil03MCb1H2o9nJ1x4/5LYw7byDE0= -github.com/sirupsen/logrus v1.9.0/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= +github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= +github.com/sirupsen/logrus v1.9.3/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= github.com/spf13/cobra v0.0.2-0.20171109065643-2da4a54c5cee/go.mod h1:1l0Ry5zgKvJasoi3XT1TypsSe7PqH0Sj9dhYf7v3XqQ= github.com/spf13/cobra v0.0.3/go.mod h1:1l0Ry5zgKvJasoi3XT1TypsSe7PqH0Sj9dhYf7v3XqQ= github.com/spf13/cobra v1.8.0 h1:7aJaZx1B85qltLMc546zn58BxxfZdR/W22ej9CFoEf0= @@ -359,8 +359,9 @@ golang.org/x/crypto v0.0.0-20201203163018-be400aefbc4c/go.mod h1:jdWPYTVW3xRLrWP golang.org/x/crypto v0.0.0-20210616213533-5ff15b29337e/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20210711020723-a769d52b0f97/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= -golang.org/x/crypto v0.6.0 h1:qfktjS5LUO+fFKeJXZ+ikTRijMmljikvG68fpMMruSc= golang.org/x/crypto v0.6.0/go.mod h1:OFC/31mSvZgRz0V1QTNCzfAI1aIRzbiufJtkMIlEp58= +golang.org/x/crypto v0.14.0 h1:wBqGXzWJW6m1XrIKlAH0Hs1JJ7+9KBwnIO8v66Q9cHc= +golang.org/x/crypto v0.14.0/go.mod h1:MVFd36DqK4CsrnJYDkBA3VC4m2GkXAM0PvzMCn4JQf4= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= @@ -433,22 +434,23 @@ golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.14.0 h1:Vz7Qs629MkJkGyHxUlRHizWJRG2j8fbQKjELVSNhy7Q= -golang.org/x/sys v0.14.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/sys v0.15.0 h1:h48lPFYpsTvQJZF4EKyI4aLHaev3CxivZmv7yZig9pc= +golang.org/x/sys v0.15.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k= -golang.org/x/term v0.13.0 h1:bb+I9cTfFazGW51MZqBVmZy7+JEJMouUHTUSKVQLBek= -golang.org/x/term v0.13.0/go.mod h1:LTmsnFJwVN6bCy1rVCoS+qHT1HhALEFxKncY3WNNh4U= +golang.org/x/term v0.15.0 h1:y/Oo/a/q3IXu26lQgl04j/gjuBDOBlx7X6Om1j2CPW4= +golang.org/x/term v0.15.0/go.mod h1:BDl952bC7+uMoWR75FIrCDx79TPU9oHkTZ9yRbYOrX0= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.4/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= -golang.org/x/text v0.7.0 h1:4BRB4x83lYWy72KwLD/qYDuTu7q9PjSagHvijDw7cLo= golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= +golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/tools v0.0.0-20180221164845-07fd8470d635/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20181030221726-6c7e314b6563/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= @@ -508,8 +510,8 @@ gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gotest.tools v2.2.0+incompatible h1:VsBPFP1AI068pPrMxtb/S8Zkgf9xEmTLJjfM+P5UIEo= gotest.tools v2.2.0+incompatible/go.mod h1:DsYFclhRJ6vuDpmuTbkuFWG+y2sxOXAzmJt81HFBacw= -gotest.tools/v3 v3.0.3 h1:4AuOwCGf4lLR9u3YOe2awrHygurzhO/HeQ6laiA6Sx0= -gotest.tools/v3 v3.0.3/go.mod h1:Z7Lb0S5l+klDB31fvDQX8ss/FlKDxtlFlw3Oa8Ymbl8= +gotest.tools/v3 v3.5.0 h1:Ljk6PdHdOhAb5aDMWXjDLMMhph+BpztA4v1QdqEW2eY= +gotest.tools/v3 v3.5.0/go.mod h1:isy3WKz7GK6uNw/sbHzfKBLvlvXwUyV06n6brMxxopU= honnef.co/go/tools v0.0.0-20190102054323-c2f93a96b099/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4= honnef.co/go/tools v0.0.0-20190523083050-ea95bdfd59fc/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4= honnef.co/go/tools v0.0.1-2019.2.3/go.mod h1:a3bituU0lyd329TUQxRnasdCoJDkEUEAqEt0JzvZhAg= diff --git a/vendor/github.com/klauspost/compress/.gitattributes b/vendor/github.com/klauspost/compress/.gitattributes new file mode 100644 index 000000000..402433593 --- /dev/null +++ b/vendor/github.com/klauspost/compress/.gitattributes @@ -0,0 +1,2 @@ +* -text +*.bin -text -diff diff --git a/vendor/github.com/klauspost/compress/.gitignore b/vendor/github.com/klauspost/compress/.gitignore new file mode 100644 index 000000000..d31b37815 --- /dev/null +++ b/vendor/github.com/klauspost/compress/.gitignore @@ -0,0 +1,32 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof +/s2/cmd/_s2sx/sfx-exe + +# Linux perf files +perf.data +perf.data.old + +# gdb history +.gdb_history diff --git a/vendor/github.com/klauspost/compress/.goreleaser.yml b/vendor/github.com/klauspost/compress/.goreleaser.yml new file mode 100644 index 000000000..0af08e65e --- /dev/null +++ b/vendor/github.com/klauspost/compress/.goreleaser.yml @@ -0,0 +1,141 @@ +# This is an example goreleaser.yaml file with some sane defaults. +# Make sure to check the documentation at http://goreleaser.com +before: + hooks: + - ./gen.sh + - go install mvdan.cc/garble@latest + +builds: + - + id: "s2c" + binary: s2c + main: ./s2/cmd/s2c/main.go + flags: + - -trimpath + env: + - CGO_ENABLED=0 + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm + - arm64 + - ppc64 + - ppc64le + - mips64 + - mips64le + goarm: + - 7 + gobinary: garble + - + id: "s2d" + binary: s2d + main: ./s2/cmd/s2d/main.go + flags: + - -trimpath + env: + - CGO_ENABLED=0 + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm + - arm64 + - ppc64 + - ppc64le + - mips64 + - mips64le + goarm: + - 7 + gobinary: garble + - + id: "s2sx" + binary: s2sx + main: ./s2/cmd/_s2sx/main.go + flags: + - -modfile=s2sx.mod + - -trimpath + env: + - CGO_ENABLED=0 + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm + - arm64 + - ppc64 + - ppc64le + - mips64 + - mips64le + goarm: + - 7 + gobinary: garble + +archives: + - + id: s2-binaries + name_template: "s2-{{ .Os }}_{{ .Arch }}_{{ .Version }}" + replacements: + aix: AIX + darwin: OSX + linux: Linux + windows: Windows + 386: i386 + amd64: x86_64 + freebsd: FreeBSD + netbsd: NetBSD + format_overrides: + - goos: windows + format: zip + files: + - unpack/* + - s2/LICENSE + - s2/README.md +checksum: + name_template: 'checksums.txt' +snapshot: + name_template: "{{ .Tag }}-next" +changelog: + sort: asc + filters: + exclude: + - '^doc:' + - '^docs:' + - '^test:' + - '^tests:' + - '^Update\sREADME.md' + +nfpms: + - + file_name_template: "s2_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}" + vendor: Klaus Post + homepage: https://github.com/klauspost/compress + maintainer: Klaus Post + description: S2 Compression Tool + license: BSD 3-Clause + formats: + - deb + - rpm + replacements: + darwin: Darwin + linux: Linux + freebsd: FreeBSD + amd64: x86_64 diff --git a/vendor/github.com/klauspost/compress/LICENSE b/vendor/github.com/klauspost/compress/LICENSE index 1eb75ef68..87d557477 100644 --- a/vendor/github.com/klauspost/compress/LICENSE +++ b/vendor/github.com/klauspost/compress/LICENSE @@ -26,3 +26,279 @@ DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +------------------ + +Files: gzhttp/* + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright 2016-2017 The New York Times Company + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. + +------------------ + +Files: s2/cmd/internal/readahead/* + +The MIT License (MIT) + +Copyright (c) 2015 Klaus Post + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + +--------------------- +Files: snappy/* +Files: internal/snapref/* + +Copyright (c) 2011 The Snappy-Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +----------------- + +Files: s2/cmd/internal/filepathx/* + +Copyright 2016 The filepathx Authors + +Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. diff --git a/vendor/github.com/klauspost/compress/README.md b/vendor/github.com/klauspost/compress/README.md new file mode 100644 index 000000000..ad5c63a82 --- /dev/null +++ b/vendor/github.com/klauspost/compress/README.md @@ -0,0 +1,560 @@ +# compress + +This package provides various compression algorithms. + +* [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression and decompression in pure Go. +* [S2](https://github.com/klauspost/compress/tree/master/s2#s2-compression) is a high performance replacement for Snappy. +* Optimized [deflate](https://godoc.org/github.com/klauspost/compress/flate) packages which can be used as a dropin replacement for [gzip](https://godoc.org/github.com/klauspost/compress/gzip), [zip](https://godoc.org/github.com/klauspost/compress/zip) and [zlib](https://godoc.org/github.com/klauspost/compress/zlib). +* [snappy](https://github.com/klauspost/compress/tree/master/snappy) is a drop-in replacement for `github.com/golang/snappy` offering better compression and concurrent streams. +* [huff0](https://github.com/klauspost/compress/tree/master/huff0) and [FSE](https://github.com/klauspost/compress/tree/master/fse) implementations for raw entropy encoding. +* [gzhttp](https://github.com/klauspost/compress/tree/master/gzhttp) Provides client and server wrappers for handling gzipped requests efficiently. +* [pgzip](https://github.com/klauspost/pgzip) is a separate package that provides a very fast parallel gzip implementation. +* [fuzz package](https://github.com/klauspost/compress-fuzz) for fuzz testing all compressors/decompressors here. + +[![Go Reference](https://pkg.go.dev/badge/klauspost/compress.svg)](https://pkg.go.dev/github.com/klauspost/compress?tab=subdirectories) +[![Go](https://github.com/klauspost/compress/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/compress/actions/workflows/go.yml) +[![Sourcegraph Badge](https://sourcegraph.com/github.com/klauspost/compress/-/badge.svg)](https://sourcegraph.com/github.com/klauspost/compress?badge) + +# changelog + +* July 13, 2022 (v1.15.8) + + * gzip: fix stack exhaustion bug in Reader.Read https://github.com/klauspost/compress/pull/641 + * s2: Add Index header trim/restore https://github.com/klauspost/compress/pull/638 + * zstd: Optimize seqdeq amd64 asm by @greatroar in https://github.com/klauspost/compress/pull/636 + * zstd: Improve decoder memcopy https://github.com/klauspost/compress/pull/637 + * huff0: Pass a single bitReader pointer to asm by @greatroar in https://github.com/klauspost/compress/pull/634 + * zstd: Branchless getBits for amd64 w/o BMI2 by @greatroar in https://github.com/klauspost/compress/pull/640 + * gzhttp: Remove header before writing https://github.com/klauspost/compress/pull/639 + +* June 29, 2022 (v1.15.7) + + * s2: Fix absolute forward seeks https://github.com/klauspost/compress/pull/633 + * zip: Merge upstream https://github.com/klauspost/compress/pull/631 + * zip: Re-add zip64 fix https://github.com/klauspost/compress/pull/624 + * zstd: translate fseDecoder.buildDtable into asm by @WojciechMula in https://github.com/klauspost/compress/pull/598 + * flate: Faster histograms https://github.com/klauspost/compress/pull/620 + * deflate: Use compound hcode https://github.com/klauspost/compress/pull/622 + +* June 3, 2022 (v1.15.6) + * s2: Improve coding for long, close matches https://github.com/klauspost/compress/pull/613 + * s2c: Add Snappy/S2 stream recompression https://github.com/klauspost/compress/pull/611 + * zstd: Always use configured block size https://github.com/klauspost/compress/pull/605 + * zstd: Fix incorrect hash table placement for dict encoding in default https://github.com/klauspost/compress/pull/606 + * zstd: Apply default config to ZipDecompressor without options https://github.com/klauspost/compress/pull/608 + * gzhttp: Exclude more common archive formats https://github.com/klauspost/compress/pull/612 + * s2: Add ReaderIgnoreCRC https://github.com/klauspost/compress/pull/609 + * s2: Remove sanity load on index creation https://github.com/klauspost/compress/pull/607 + * snappy: Use dedicated function for scoring https://github.com/klauspost/compress/pull/614 + * s2c+s2d: Use official snappy framed extension https://github.com/klauspost/compress/pull/610 + +* May 25, 2022 (v1.15.5) + * s2: Add concurrent stream decompression https://github.com/klauspost/compress/pull/602 + * s2: Fix final emit oob read crash on amd64 https://github.com/klauspost/compress/pull/601 + * huff0: asm implementation of Decompress1X by @WojciechMula https://github.com/klauspost/compress/pull/596 + * zstd: Use 1 less goroutine for stream decoding https://github.com/klauspost/compress/pull/588 + * zstd: Copy literal in 16 byte blocks when possible https://github.com/klauspost/compress/pull/592 + * zstd: Speed up when WithDecoderLowmem(false) https://github.com/klauspost/compress/pull/599 + * zstd: faster next state update in BMI2 version of decode by @WojciechMula in https://github.com/klauspost/compress/pull/593 + * huff0: Do not check max size when reading table. https://github.com/klauspost/compress/pull/586 + * flate: Inplace hashing for level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/590 + + +* May 11, 2022 (v1.15.4) + * huff0: decompress directly into output by @WojciechMula in [#577](https://github.com/klauspost/compress/pull/577) + * inflate: Keep dict on stack [#581](https://github.com/klauspost/compress/pull/581) + * zstd: Faster decoding memcopy in asm [#583](https://github.com/klauspost/compress/pull/583) + * zstd: Fix ignored crc [#580](https://github.com/klauspost/compress/pull/580) + +* May 5, 2022 (v1.15.3) + * zstd: Allow to ignore checksum checking by @WojciechMula [#572](https://github.com/klauspost/compress/pull/572) + * s2: Fix incorrect seek for io.SeekEnd in [#575](https://github.com/klauspost/compress/pull/575) + +* Apr 26, 2022 (v1.15.2) + * zstd: Add x86-64 assembly for decompression on streams and blocks. Contributed by [@WojciechMula](https://github.com/WojciechMula). Typically 2x faster. [#528](https://github.com/klauspost/compress/pull/528) [#531](https://github.com/klauspost/compress/pull/531) [#545](https://github.com/klauspost/compress/pull/545) [#537](https://github.com/klauspost/compress/pull/537) + * zstd: Add options to ZipDecompressor and fixes [#539](https://github.com/klauspost/compress/pull/539) + * s2: Use sorted search for index [#555](https://github.com/klauspost/compress/pull/555) + * Minimum version is Go 1.16, added CI test on 1.18. + +* Mar 11, 2022 (v1.15.1) + * huff0: Add x86 assembly of Decode4X by @WojciechMula in [#512](https://github.com/klauspost/compress/pull/512) + * zstd: Reuse zip decoders in [#514](https://github.com/klauspost/compress/pull/514) + * zstd: Detect extra block data and report as corrupted in [#520](https://github.com/klauspost/compress/pull/520) + * zstd: Handle zero sized frame content size stricter in [#521](https://github.com/klauspost/compress/pull/521) + * zstd: Add stricter block size checks in [#523](https://github.com/klauspost/compress/pull/523) + +* Mar 3, 2022 (v1.15.0) + * zstd: Refactor decoder by @klauspost in [#498](https://github.com/klauspost/compress/pull/498) + * zstd: Add stream encoding without goroutines by @klauspost in [#505](https://github.com/klauspost/compress/pull/505) + * huff0: Prevent single blocks exceeding 16 bits by @klauspost in[#507](https://github.com/klauspost/compress/pull/507) + * flate: Inline literal emission by @klauspost in [#509](https://github.com/klauspost/compress/pull/509) + * gzhttp: Add zstd to transport by @klauspost in [#400](https://github.com/klauspost/compress/pull/400) + * gzhttp: Make content-type optional by @klauspost in [#510](https://github.com/klauspost/compress/pull/510) + +
+ See Details +Both compression and decompression now supports "synchronous" stream operations. This means that whenever "concurrency" is set to 1, they will operate without spawning goroutines. + +Stream decompression is now faster on asynchronous, since the goroutine allocation much more effectively splits the workload. On typical streams this will typically use 2 cores fully for decompression. When a stream has finished decoding no goroutines will be left over, so decoders can now safely be pooled and still be garbage collected. + +While the release has been extensively tested, it is recommended to testing when upgrading. +
+ +* Feb 22, 2022 (v1.14.4) + * flate: Fix rare huffman only (-2) corruption. [#503](https://github.com/klauspost/compress/pull/503) + * zip: Update deprecated CreateHeaderRaw to correctly call CreateRaw by @saracen in [#502](https://github.com/klauspost/compress/pull/502) + * zip: don't read data descriptor early by @saracen in [#501](https://github.com/klauspost/compress/pull/501) #501 + * huff0: Use static decompression buffer up to 30% faster by @klauspost in [#499](https://github.com/klauspost/compress/pull/499) [#500](https://github.com/klauspost/compress/pull/500) + +* Feb 17, 2022 (v1.14.3) + * flate: Improve fastest levels compression speed ~10% more throughput. [#482](https://github.com/klauspost/compress/pull/482) [#489](https://github.com/klauspost/compress/pull/489) [#490](https://github.com/klauspost/compress/pull/490) [#491](https://github.com/klauspost/compress/pull/491) [#494](https://github.com/klauspost/compress/pull/494) [#478](https://github.com/klauspost/compress/pull/478) + * flate: Faster decompression speed, ~5-10%. [#483](https://github.com/klauspost/compress/pull/483) + * s2: Faster compression with Go v1.18 and amd64 microarch level 3+. [#484](https://github.com/klauspost/compress/pull/484) [#486](https://github.com/klauspost/compress/pull/486) + +* Jan 25, 2022 (v1.14.2) + * zstd: improve header decoder by @dsnet [#476](https://github.com/klauspost/compress/pull/476) + * zstd: Add bigger default blocks [#469](https://github.com/klauspost/compress/pull/469) + * zstd: Remove unused decompression buffer [#470](https://github.com/klauspost/compress/pull/470) + * zstd: Fix logically dead code by @ningmingxiao [#472](https://github.com/klauspost/compress/pull/472) + * flate: Improve level 7-9 [#471](https://github.com/klauspost/compress/pull/471) [#473](https://github.com/klauspost/compress/pull/473) + * zstd: Add noasm tag for xxhash [#475](https://github.com/klauspost/compress/pull/475) + +* Jan 11, 2022 (v1.14.1) + * s2: Add stream index in [#462](https://github.com/klauspost/compress/pull/462) + * flate: Speed and efficiency improvements in [#439](https://github.com/klauspost/compress/pull/439) [#461](https://github.com/klauspost/compress/pull/461) [#455](https://github.com/klauspost/compress/pull/455) [#452](https://github.com/klauspost/compress/pull/452) [#458](https://github.com/klauspost/compress/pull/458) + * zstd: Performance improvement in [#420]( https://github.com/klauspost/compress/pull/420) [#456](https://github.com/klauspost/compress/pull/456) [#437](https://github.com/klauspost/compress/pull/437) [#467](https://github.com/klauspost/compress/pull/467) [#468](https://github.com/klauspost/compress/pull/468) + * zstd: add arm64 xxhash assembly in [#464](https://github.com/klauspost/compress/pull/464) + * Add garbled for binaries for s2 in [#445](https://github.com/klauspost/compress/pull/445) + +
+ See changes to v1.13.x + +* Aug 30, 2021 (v1.13.5) + * gz/zlib/flate: Alias stdlib errors [#425](https://github.com/klauspost/compress/pull/425) + * s2: Add block support to commandline tools [#413](https://github.com/klauspost/compress/pull/413) + * zstd: pooledZipWriter should return Writers to the same pool [#426](https://github.com/klauspost/compress/pull/426) + * Removed golang/snappy as external dependency for tests [#421](https://github.com/klauspost/compress/pull/421) + +* Aug 12, 2021 (v1.13.4) + * Add [snappy replacement package](https://github.com/klauspost/compress/tree/master/snappy). + * zstd: Fix incorrect encoding in "best" mode [#415](https://github.com/klauspost/compress/pull/415) + +* Aug 3, 2021 (v1.13.3) + * zstd: Improve Best compression [#404](https://github.com/klauspost/compress/pull/404) + * zstd: Fix WriteTo error forwarding [#411](https://github.com/klauspost/compress/pull/411) + * gzhttp: Return http.HandlerFunc instead of http.Handler. Unlikely breaking change. [#406](https://github.com/klauspost/compress/pull/406) + * s2sx: Fix max size error [#399](https://github.com/klauspost/compress/pull/399) + * zstd: Add optional stream content size on reset [#401](https://github.com/klauspost/compress/pull/401) + * zstd: use SpeedBestCompression for level >= 10 [#410](https://github.com/klauspost/compress/pull/410) + +* Jun 14, 2021 (v1.13.1) + * s2: Add full Snappy output support [#396](https://github.com/klauspost/compress/pull/396) + * zstd: Add configurable [Decoder window](https://pkg.go.dev/github.com/klauspost/compress/zstd#WithDecoderMaxWindow) size [#394](https://github.com/klauspost/compress/pull/394) + * gzhttp: Add header to skip compression [#389](https://github.com/klauspost/compress/pull/389) + * s2: Improve speed with bigger output margin [#395](https://github.com/klauspost/compress/pull/395) + +* Jun 3, 2021 (v1.13.0) + * Added [gzhttp](https://github.com/klauspost/compress/tree/master/gzhttp#gzip-handler) which allows wrapping HTTP servers and clients with GZIP compressors. + * zstd: Detect short invalid signatures [#382](https://github.com/klauspost/compress/pull/382) + * zstd: Spawn decoder goroutine only if needed. [#380](https://github.com/klauspost/compress/pull/380) +
+ + +
+ See changes to v1.12.x + +* May 25, 2021 (v1.12.3) + * deflate: Better/faster Huffman encoding [#374](https://github.com/klauspost/compress/pull/374) + * deflate: Allocate less for history. [#375](https://github.com/klauspost/compress/pull/375) + * zstd: Forward read errors [#373](https://github.com/klauspost/compress/pull/373) + +* Apr 27, 2021 (v1.12.2) + * zstd: Improve better/best compression [#360](https://github.com/klauspost/compress/pull/360) [#364](https://github.com/klauspost/compress/pull/364) [#365](https://github.com/klauspost/compress/pull/365) + * zstd: Add helpers to compress/decompress zstd inside zip files [#363](https://github.com/klauspost/compress/pull/363) + * deflate: Improve level 5+6 compression [#367](https://github.com/klauspost/compress/pull/367) + * s2: Improve better/best compression [#358](https://github.com/klauspost/compress/pull/358) [#359](https://github.com/klauspost/compress/pull/358) + * s2: Load after checking src limit on amd64. [#362](https://github.com/klauspost/compress/pull/362) + * s2sx: Limit max executable size [#368](https://github.com/klauspost/compress/pull/368) + +* Apr 14, 2021 (v1.12.1) + * snappy package removed. Upstream added as dependency. + * s2: Better compression in "best" mode [#353](https://github.com/klauspost/compress/pull/353) + * s2sx: Add stdin input and detect pre-compressed from signature [#352](https://github.com/klauspost/compress/pull/352) + * s2c/s2d: Add http as possible input [#348](https://github.com/klauspost/compress/pull/348) + * s2c/s2d/s2sx: Always truncate when writing files [#352](https://github.com/klauspost/compress/pull/352) + * zstd: Reduce memory usage further when using [WithLowerEncoderMem](https://pkg.go.dev/github.com/klauspost/compress/zstd#WithLowerEncoderMem) [#346](https://github.com/klauspost/compress/pull/346) + * s2: Fix potential problem with amd64 assembly and profilers [#349](https://github.com/klauspost/compress/pull/349) +
+ +
+ See changes to v1.11.x + +* Mar 26, 2021 (v1.11.13) + * zstd: Big speedup on small dictionary encodes [#344](https://github.com/klauspost/compress/pull/344) [#345](https://github.com/klauspost/compress/pull/345) + * zstd: Add [WithLowerEncoderMem](https://pkg.go.dev/github.com/klauspost/compress/zstd#WithLowerEncoderMem) encoder option [#336](https://github.com/klauspost/compress/pull/336) + * deflate: Improve entropy compression [#338](https://github.com/klauspost/compress/pull/338) + * s2: Clean up and minor performance improvement in best [#341](https://github.com/klauspost/compress/pull/341) + +* Mar 5, 2021 (v1.11.12) + * s2: Add `s2sx` binary that creates [self extracting archives](https://github.com/klauspost/compress/tree/master/s2#s2sx-self-extracting-archives). + * s2: Speed up decompression on non-assembly platforms [#328](https://github.com/klauspost/compress/pull/328) + +* Mar 1, 2021 (v1.11.9) + * s2: Add ARM64 decompression assembly. Around 2x output speed. [#324](https://github.com/klauspost/compress/pull/324) + * s2: Improve "better" speed and efficiency. [#325](https://github.com/klauspost/compress/pull/325) + * s2: Fix binaries. + +* Feb 25, 2021 (v1.11.8) + * s2: Fixed occational out-of-bounds write on amd64. Upgrade recommended. + * s2: Add AMD64 assembly for better mode. 25-50% faster. [#315](https://github.com/klauspost/compress/pull/315) + * s2: Less upfront decoder allocation. [#322](https://github.com/klauspost/compress/pull/322) + * zstd: Faster "compression" of incompressible data. [#314](https://github.com/klauspost/compress/pull/314) + * zip: Fix zip64 headers. [#313](https://github.com/klauspost/compress/pull/313) + +* Jan 14, 2021 (v1.11.7) + * Use Bytes() interface to get bytes across packages. [#309](https://github.com/klauspost/compress/pull/309) + * s2: Add 'best' compression option. [#310](https://github.com/klauspost/compress/pull/310) + * s2: Add ReaderMaxBlockSize, changes `s2.NewReader` signature to include varargs. [#311](https://github.com/klauspost/compress/pull/311) + * s2: Fix crash on small better buffers. [#308](https://github.com/klauspost/compress/pull/308) + * s2: Clean up decoder. [#312](https://github.com/klauspost/compress/pull/312) + +* Jan 7, 2021 (v1.11.6) + * zstd: Make decoder allocations smaller [#306](https://github.com/klauspost/compress/pull/306) + * zstd: Free Decoder resources when Reset is called with a nil io.Reader [#305](https://github.com/klauspost/compress/pull/305) + +* Dec 20, 2020 (v1.11.4) + * zstd: Add Best compression mode [#304](https://github.com/klauspost/compress/pull/304) + * Add header decoder [#299](https://github.com/klauspost/compress/pull/299) + * s2: Add uncompressed stream option [#297](https://github.com/klauspost/compress/pull/297) + * Simplify/speed up small blocks with known max size. [#300](https://github.com/klauspost/compress/pull/300) + * zstd: Always reset literal dict encoder [#303](https://github.com/klauspost/compress/pull/303) + +* Nov 15, 2020 (v1.11.3) + * inflate: 10-15% faster decompression [#293](https://github.com/klauspost/compress/pull/293) + * zstd: Tweak DecodeAll default allocation [#295](https://github.com/klauspost/compress/pull/295) + +* Oct 11, 2020 (v1.11.2) + * s2: Fix out of bounds read in "better" block compression [#291](https://github.com/klauspost/compress/pull/291) + +* Oct 1, 2020 (v1.11.1) + * zstd: Set allLitEntropy true in default configuration [#286](https://github.com/klauspost/compress/pull/286) + +* Sept 8, 2020 (v1.11.0) + * zstd: Add experimental compression [dictionaries](https://github.com/klauspost/compress/tree/master/zstd#dictionaries) [#281](https://github.com/klauspost/compress/pull/281) + * zstd: Fix mixed Write and ReadFrom calls [#282](https://github.com/klauspost/compress/pull/282) + * inflate/gz: Limit variable shifts, ~5% faster decompression [#274](https://github.com/klauspost/compress/pull/274) +
+ +
+ See changes to v1.10.x + +* July 8, 2020 (v1.10.11) + * zstd: Fix extra block when compressing with ReadFrom. [#278](https://github.com/klauspost/compress/pull/278) + * huff0: Also populate compression table when reading decoding table. [#275](https://github.com/klauspost/compress/pull/275) + +* June 23, 2020 (v1.10.10) + * zstd: Skip entropy compression in fastest mode when no matches. [#270](https://github.com/klauspost/compress/pull/270) + +* June 16, 2020 (v1.10.9): + * zstd: API change for specifying dictionaries. See [#268](https://github.com/klauspost/compress/pull/268) + * zip: update CreateHeaderRaw to handle zip64 fields. [#266](https://github.com/klauspost/compress/pull/266) + * Fuzzit tests removed. The service has been purchased and is no longer available. + +* June 5, 2020 (v1.10.8): + * 1.15x faster zstd block decompression. [#265](https://github.com/klauspost/compress/pull/265) + +* June 1, 2020 (v1.10.7): + * Added zstd decompression [dictionary support](https://github.com/klauspost/compress/tree/master/zstd#dictionaries) + * Increase zstd decompression speed up to 1.19x. [#259](https://github.com/klauspost/compress/pull/259) + * Remove internal reset call in zstd compression and reduce allocations. [#263](https://github.com/klauspost/compress/pull/263) + +* May 21, 2020: (v1.10.6) + * zstd: Reduce allocations while decoding. [#258](https://github.com/klauspost/compress/pull/258), [#252](https://github.com/klauspost/compress/pull/252) + * zstd: Stricter decompression checks. + +* April 12, 2020: (v1.10.5) + * s2-commands: Flush output when receiving SIGINT. [#239](https://github.com/klauspost/compress/pull/239) + +* Apr 8, 2020: (v1.10.4) + * zstd: Minor/special case optimizations. [#251](https://github.com/klauspost/compress/pull/251), [#250](https://github.com/klauspost/compress/pull/250), [#249](https://github.com/klauspost/compress/pull/249), [#247](https://github.com/klauspost/compress/pull/247) +* Mar 11, 2020: (v1.10.3) + * s2: Use S2 encoder in pure Go mode for Snappy output as well. [#245](https://github.com/klauspost/compress/pull/245) + * s2: Fix pure Go block encoder. [#244](https://github.com/klauspost/compress/pull/244) + * zstd: Added "better compression" mode. [#240](https://github.com/klauspost/compress/pull/240) + * zstd: Improve speed of fastest compression mode by 5-10% [#241](https://github.com/klauspost/compress/pull/241) + * zstd: Skip creating encoders when not needed. [#238](https://github.com/klauspost/compress/pull/238) + +* Feb 27, 2020: (v1.10.2) + * Close to 50% speedup in inflate (gzip/zip decompression). [#236](https://github.com/klauspost/compress/pull/236) [#234](https://github.com/klauspost/compress/pull/234) [#232](https://github.com/klauspost/compress/pull/232) + * Reduce deflate level 1-6 memory usage up to 59%. [#227](https://github.com/klauspost/compress/pull/227) + +* Feb 18, 2020: (v1.10.1) + * Fix zstd crash when resetting multiple times without sending data. [#226](https://github.com/klauspost/compress/pull/226) + * deflate: Fix dictionary use on level 1-6. [#224](https://github.com/klauspost/compress/pull/224) + * Remove deflate writer reference when closing. [#224](https://github.com/klauspost/compress/pull/224) + +* Feb 4, 2020: (v1.10.0) + * Add optional dictionary to [stateless deflate](https://pkg.go.dev/github.com/klauspost/compress/flate?tab=doc#StatelessDeflate). Breaking change, send `nil` for previous behaviour. [#216](https://github.com/klauspost/compress/pull/216) + * Fix buffer overflow on repeated small block deflate. [#218](https://github.com/klauspost/compress/pull/218) + * Allow copying content from an existing ZIP file without decompressing+compressing. [#214](https://github.com/klauspost/compress/pull/214) + * Added [S2](https://github.com/klauspost/compress/tree/master/s2#s2-compression) AMD64 assembler and various optimizations. Stream speed >10GB/s. [#186](https://github.com/klauspost/compress/pull/186) + +
+ +
+ See changes prior to v1.10.0 + +* Jan 20,2020 (v1.9.8) Optimize gzip/deflate with better size estimates and faster table generation. [#207](https://github.com/klauspost/compress/pull/207) by [luyu6056](https://github.com/luyu6056), [#206](https://github.com/klauspost/compress/pull/206). +* Jan 11, 2020: S2 Encode/Decode will use provided buffer if capacity is big enough. [#204](https://github.com/klauspost/compress/pull/204) +* Jan 5, 2020: (v1.9.7) Fix another zstd regression in v1.9.5 - v1.9.6 removed. +* Jan 4, 2020: (v1.9.6) Regression in v1.9.5 fixed causing corrupt zstd encodes in rare cases. +* Jan 4, 2020: Faster IO in [s2c + s2d commandline tools](https://github.com/klauspost/compress/tree/master/s2#commandline-tools) compression/decompression. [#192](https://github.com/klauspost/compress/pull/192) +* Dec 29, 2019: Removed v1.9.5 since fuzz tests showed a compatibility problem with the reference zstandard decoder. +* Dec 29, 2019: (v1.9.5) zstd: 10-20% faster block compression. [#199](https://github.com/klauspost/compress/pull/199) +* Dec 29, 2019: [zip](https://godoc.org/github.com/klauspost/compress/zip) package updated with latest Go features +* Dec 29, 2019: zstd: Single segment flag condintions tweaked. [#197](https://github.com/klauspost/compress/pull/197) +* Dec 18, 2019: s2: Faster compression when ReadFrom is used. [#198](https://github.com/klauspost/compress/pull/198) +* Dec 10, 2019: s2: Fix repeat length output when just above at 16MB limit. +* Dec 10, 2019: zstd: Add function to get decoder as io.ReadCloser. [#191](https://github.com/klauspost/compress/pull/191) +* Dec 3, 2019: (v1.9.4) S2: limit max repeat length. [#188](https://github.com/klauspost/compress/pull/188) +* Dec 3, 2019: Add [WithNoEntropyCompression](https://godoc.org/github.com/klauspost/compress/zstd#WithNoEntropyCompression) to zstd [#187](https://github.com/klauspost/compress/pull/187) +* Dec 3, 2019: Reduce memory use for tests. Check for leaked goroutines. +* Nov 28, 2019 (v1.9.3) Less allocations in stateless deflate. +* Nov 28, 2019: 5-20% Faster huff0 decode. Impacts zstd as well. [#184](https://github.com/klauspost/compress/pull/184) +* Nov 12, 2019 (v1.9.2) Added [Stateless Compression](#stateless-compression) for gzip/deflate. +* Nov 12, 2019: Fixed zstd decompression of large single blocks. [#180](https://github.com/klauspost/compress/pull/180) +* Nov 11, 2019: Set default [s2c](https://github.com/klauspost/compress/tree/master/s2#commandline-tools) block size to 4MB. +* Nov 11, 2019: Reduce inflate memory use by 1KB. +* Nov 10, 2019: Less allocations in deflate bit writer. +* Nov 10, 2019: Fix inconsistent error returned by zstd decoder. +* Oct 28, 2019 (v1.9.1) ztsd: Fix crash when compressing blocks. [#174](https://github.com/klauspost/compress/pull/174) +* Oct 24, 2019 (v1.9.0) zstd: Fix rare data corruption [#173](https://github.com/klauspost/compress/pull/173) +* Oct 24, 2019 zstd: Fix huff0 out of buffer write [#171](https://github.com/klauspost/compress/pull/171) and always return errors [#172](https://github.com/klauspost/compress/pull/172) +* Oct 10, 2019: Big deflate rewrite, 30-40% faster with better compression [#105](https://github.com/klauspost/compress/pull/105) + +
+ +
+ See changes prior to v1.9.0 + +* Oct 10, 2019: (v1.8.6) zstd: Allow partial reads to get flushed data. [#169](https://github.com/klauspost/compress/pull/169) +* Oct 3, 2019: Fix inconsistent results on broken zstd streams. +* Sep 25, 2019: Added `-rm` (remove source files) and `-q` (no output except errors) to `s2c` and `s2d` [commands](https://github.com/klauspost/compress/tree/master/s2#commandline-tools) +* Sep 16, 2019: (v1.8.4) Add `s2c` and `s2d` [commandline tools](https://github.com/klauspost/compress/tree/master/s2#commandline-tools). +* Sep 10, 2019: (v1.8.3) Fix s2 decoder [Skip](https://godoc.org/github.com/klauspost/compress/s2#Reader.Skip). +* Sep 7, 2019: zstd: Added [WithWindowSize](https://godoc.org/github.com/klauspost/compress/zstd#WithWindowSize), contributed by [ianwilkes](https://github.com/ianwilkes). +* Sep 5, 2019: (v1.8.2) Add [WithZeroFrames](https://godoc.org/github.com/klauspost/compress/zstd#WithZeroFrames) which adds full zero payload block encoding option. +* Sep 5, 2019: Lazy initialization of zstandard predefined en/decoder tables. +* Aug 26, 2019: (v1.8.1) S2: 1-2% compression increase in "better" compression mode. +* Aug 26, 2019: zstd: Check maximum size of Huffman 1X compressed literals while decoding. +* Aug 24, 2019: (v1.8.0) Added [S2 compression](https://github.com/klauspost/compress/tree/master/s2#s2-compression), a high performance replacement for Snappy. +* Aug 21, 2019: (v1.7.6) Fixed minor issues found by fuzzer. One could lead to zstd not decompressing. +* Aug 18, 2019: Add [fuzzit](https://fuzzit.dev/) continuous fuzzing. +* Aug 14, 2019: zstd: Skip incompressible data 2x faster. [#147](https://github.com/klauspost/compress/pull/147) +* Aug 4, 2019 (v1.7.5): Better literal compression. [#146](https://github.com/klauspost/compress/pull/146) +* Aug 4, 2019: Faster zstd compression. [#143](https://github.com/klauspost/compress/pull/143) [#144](https://github.com/klauspost/compress/pull/144) +* Aug 4, 2019: Faster zstd decompression. [#145](https://github.com/klauspost/compress/pull/145) [#143](https://github.com/klauspost/compress/pull/143) [#142](https://github.com/klauspost/compress/pull/142) +* July 15, 2019 (v1.7.4): Fix double EOF block in rare cases on zstd encoder. +* July 15, 2019 (v1.7.3): Minor speedup/compression increase in default zstd encoder. +* July 14, 2019: zstd decoder: Fix decompression error on multiple uses with mixed content. +* July 7, 2019 (v1.7.2): Snappy update, zstd decoder potential race fix. +* June 17, 2019: zstd decompression bugfix. +* June 17, 2019: fix 32 bit builds. +* June 17, 2019: Easier use in modules (less dependencies). +* June 9, 2019: New stronger "default" [zstd](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression mode. Matches zstd default compression ratio. +* June 5, 2019: 20-40% throughput in [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression and better compression. +* June 5, 2019: deflate/gzip compression: Reduce memory usage of lower compression levels. +* June 2, 2019: Added [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression! +* May 25, 2019: deflate/gzip: 10% faster bit writer, mostly visible in lower levels. +* Apr 22, 2019: [zstd](https://github.com/klauspost/compress/tree/master/zstd#zstd) decompression added. +* Aug 1, 2018: Added [huff0 README](https://github.com/klauspost/compress/tree/master/huff0#huff0-entropy-compression). +* Jul 8, 2018: Added [Performance Update 2018](#performance-update-2018) below. +* Jun 23, 2018: Merged [Go 1.11 inflate optimizations](https://go-review.googlesource.com/c/go/+/102235). Go 1.9 is now required. Backwards compatible version tagged with [v1.3.0](https://github.com/klauspost/compress/releases/tag/v1.3.0). +* Apr 2, 2018: Added [huff0](https://godoc.org/github.com/klauspost/compress/huff0) en/decoder. Experimental for now, API may change. +* Mar 4, 2018: Added [FSE Entropy](https://godoc.org/github.com/klauspost/compress/fse) en/decoder. Experimental for now, API may change. +* Nov 3, 2017: Add compression [Estimate](https://godoc.org/github.com/klauspost/compress#Estimate) function. +* May 28, 2017: Reduce allocations when resetting decoder. +* Apr 02, 2017: Change back to official crc32, since changes were merged in Go 1.7. +* Jan 14, 2017: Reduce stack pressure due to array copies. See [Issue #18625](https://github.com/golang/go/issues/18625). +* Oct 25, 2016: Level 2-4 have been rewritten and now offers significantly better performance than before. +* Oct 20, 2016: Port zlib changes from Go 1.7 to fix zlib writer issue. Please update. +* Oct 16, 2016: Go 1.7 changes merged. Apples to apples this package is a few percent faster, but has a significantly better balance between speed and compression per level. +* Mar 24, 2016: Always attempt Huffman encoding on level 4-7. This improves base 64 encoded data compression. +* Mar 24, 2016: Small speedup for level 1-3. +* Feb 19, 2016: Faster bit writer, level -2 is 15% faster, level 1 is 4% faster. +* Feb 19, 2016: Handle small payloads faster in level 1-3. +* Feb 19, 2016: Added faster level 2 + 3 compression modes. +* Feb 19, 2016: [Rebalanced compression levels](https://blog.klauspost.com/rebalancing-deflate-compression-levels/), so there is a more even progresssion in terms of compression. New default level is 5. +* Feb 14, 2016: Snappy: Merge upstream changes. +* Feb 14, 2016: Snappy: Fix aggressive skipping. +* Feb 14, 2016: Snappy: Update benchmark. +* Feb 13, 2016: Deflate: Fixed assembler problem that could lead to sub-optimal compression. +* Feb 12, 2016: Snappy: Added AMD64 SSE 4.2 optimizations to matching, which makes easy to compress material run faster. Typical speedup is around 25%. +* Feb 9, 2016: Added Snappy package fork. This version is 5-7% faster, much more on hard to compress content. +* Jan 30, 2016: Optimize level 1 to 3 by not considering static dictionary or storing uncompressed. ~4-5% speedup. +* Jan 16, 2016: Optimization on deflate level 1,2,3 compression. +* Jan 8 2016: Merge [CL 18317](https://go-review.googlesource.com/#/c/18317): fix reading, writing of zip64 archives. +* Dec 8 2015: Make level 1 and -2 deterministic even if write size differs. +* Dec 8 2015: Split encoding functions, so hashing and matching can potentially be inlined. 1-3% faster on AMD64. 5% faster on other platforms. +* Dec 8 2015: Fixed rare [one byte out-of bounds read](https://github.com/klauspost/compress/issues/20). Please update! +* Nov 23 2015: Optimization on token writer. ~2-4% faster. Contributed by [@dsnet](https://github.com/dsnet). +* Nov 20 2015: Small optimization to bit writer on 64 bit systems. +* Nov 17 2015: Fixed out-of-bound errors if the underlying Writer returned an error. See [#15](https://github.com/klauspost/compress/issues/15). +* Nov 12 2015: Added [io.WriterTo](https://golang.org/pkg/io/#WriterTo) support to gzip/inflate. +* Nov 11 2015: Merged [CL 16669](https://go-review.googlesource.com/#/c/16669/4): archive/zip: enable overriding (de)compressors per file +* Oct 15 2015: Added skipping on uncompressible data. Random data speed up >5x. + +
+ +# deflate usage + +The packages are drop-in replacements for standard libraries. Simply replace the import path to use them: + +| old import | new import | Documentation +|--------------------|-----------------------------------------|--------------------| +| `compress/gzip` | `github.com/klauspost/compress/gzip` | [gzip](https://pkg.go.dev/github.com/klauspost/compress/gzip?tab=doc) +| `compress/zlib` | `github.com/klauspost/compress/zlib` | [zlib](https://pkg.go.dev/github.com/klauspost/compress/zlib?tab=doc) +| `archive/zip` | `github.com/klauspost/compress/zip` | [zip](https://pkg.go.dev/github.com/klauspost/compress/zip?tab=doc) +| `compress/flate` | `github.com/klauspost/compress/flate` | [flate](https://pkg.go.dev/github.com/klauspost/compress/flate?tab=doc) + +* Optimized [deflate](https://godoc.org/github.com/klauspost/compress/flate) packages which can be used as a dropin replacement for [gzip](https://godoc.org/github.com/klauspost/compress/gzip), [zip](https://godoc.org/github.com/klauspost/compress/zip) and [zlib](https://godoc.org/github.com/klauspost/compress/zlib). + +You may also be interested in [pgzip](https://github.com/klauspost/pgzip), which is a drop in replacement for gzip, which support multithreaded compression on big files and the optimized [crc32](https://github.com/klauspost/crc32) package used by these packages. + +The packages contains the same as the standard library, so you can use the godoc for that: [gzip](http://golang.org/pkg/compress/gzip/), [zip](http://golang.org/pkg/archive/zip/), [zlib](http://golang.org/pkg/compress/zlib/), [flate](http://golang.org/pkg/compress/flate/). + +Currently there is only minor speedup on decompression (mostly CRC32 calculation). + +Memory usage is typically 1MB for a Writer. stdlib is in the same range. +If you expect to have a lot of concurrently allocated Writers consider using +the stateless compress described below. + +For compression performance, see: [this spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing). + +# Stateless compression + +This package offers stateless compression as a special option for gzip/deflate. +It will do compression but without maintaining any state between Write calls. + +This means there will be no memory kept between Write calls, but compression and speed will be suboptimal. + +This is only relevant in cases where you expect to run many thousands of compressors concurrently, +but with very little activity. This is *not* intended for regular web servers serving individual requests. + +Because of this, the size of actual Write calls will affect output size. + +In gzip, specify level `-3` / `gzip.StatelessCompression` to enable. + +For direct deflate use, NewStatelessWriter and StatelessDeflate are available. See [documentation](https://godoc.org/github.com/klauspost/compress/flate#NewStatelessWriter) + +A `bufio.Writer` can of course be used to control write sizes. For example, to use a 4KB buffer: + +``` + // replace 'ioutil.Discard' with your output. + gzw, err := gzip.NewWriterLevel(ioutil.Discard, gzip.StatelessCompression) + if err != nil { + return err + } + defer gzw.Close() + + w := bufio.NewWriterSize(gzw, 4096) + defer w.Flush() + + // Write to 'w' +``` + +This will only use up to 4KB in memory when the writer is idle. + +Compression is almost always worse than the fastest compression level +and each write will allocate (a little) memory. + +# Performance Update 2018 + +It has been a while since we have been looking at the speed of this package compared to the standard library, so I thought I would re-do my tests and give some overall recommendations based on the current state. All benchmarks have been performed with Go 1.10 on my Desktop Intel(R) Core(TM) i7-2600 CPU @3.40GHz. Since I last ran the tests, I have gotten more RAM, which means tests with big files are no longer limited by my SSD. + +The raw results are in my [updated spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing). Due to cgo changes and upstream updates i could not get the cgo version of gzip to compile. Instead I included the [zstd](https://github.com/datadog/zstd) cgo implementation. If I get cgo gzip to work again, I might replace the results in the sheet. + +The columns to take note of are: *MB/s* - the throughput. *Reduction* - the data size reduction in percent of the original. *Rel Speed* relative speed compared to the standard library at the same level. *Smaller* - how many percent smaller is the compressed output compared to stdlib. Negative means the output was bigger. *Loss* means the loss (or gain) in compression as a percentage difference of the input. + +The `gzstd` (standard library gzip) and `gzkp` (this package gzip) only uses one CPU core. [`pgzip`](https://github.com/klauspost/pgzip), [`bgzf`](https://github.com/biogo/hts/tree/master/bgzf) uses all 4 cores. [`zstd`](https://github.com/DataDog/zstd) uses one core, and is a beast (but not Go, yet). + + +## Overall differences. + +There appears to be a roughly 5-10% speed advantage over the standard library when comparing at similar compression levels. + +The biggest difference you will see is the result of [re-balancing](https://blog.klauspost.com/rebalancing-deflate-compression-levels/) the compression levels. I wanted by library to give a smoother transition between the compression levels than the standard library. + +This package attempts to provide a more smooth transition, where "1" is taking a lot of shortcuts, "5" is the reasonable trade-off and "9" is the "give me the best compression", and the values in between gives something reasonable in between. The standard library has big differences in levels 1-4, but levels 5-9 having no significant gains - often spending a lot more time than can be justified by the achieved compression. + +There are links to all the test data in the [spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing) in the top left field on each tab. + +## Web Content + +This test set aims to emulate typical use in a web server. The test-set is 4GB data in 53k files, and is a mixture of (mostly) HTML, JS, CSS. + +Since level 1 and 9 are close to being the same code, they are quite close. But looking at the levels in-between the differences are quite big. + +Looking at level 6, this package is 88% faster, but will output about 6% more data. For a web server, this means you can serve 88% more data, but have to pay for 6% more bandwidth. You can draw your own conclusions on what would be the most expensive for your case. + +## Object files + +This test is for typical data files stored on a server. In this case it is a collection of Go precompiled objects. They are very compressible. + +The picture is similar to the web content, but with small differences since this is very compressible. Levels 2-3 offer good speed, but is sacrificing quite a bit of compression. + +The standard library seems suboptimal on level 3 and 4 - offering both worse compression and speed than level 6 & 7 of this package respectively. + +## Highly Compressible File + +This is a JSON file with very high redundancy. The reduction starts at 95% on level 1, so in real life terms we are dealing with something like a highly redundant stream of data, etc. + +It is definitely visible that we are dealing with specialized content here, so the results are very scattered. This package does not do very well at levels 1-4, but picks up significantly at level 5 and levels 7 and 8 offering great speed for the achieved compression. + +So if you know you content is extremely compressible you might want to go slightly higher than the defaults. The standard library has a huge gap between levels 3 and 4 in terms of speed (2.75x slowdown), so it offers little "middle ground". + +## Medium-High Compressible + +This is a pretty common test corpus: [enwik9](http://mattmahoney.net/dc/textdata.html). It contains the first 10^9 bytes of the English Wikipedia dump on Mar. 3, 2006. This is a very good test of typical text based compression and more data heavy streams. + +We see a similar picture here as in "Web Content". On equal levels some compression is sacrificed for more speed. Level 5 seems to be the best trade-off between speed and size, beating stdlib level 3 in both. + +## Medium Compressible + +I will combine two test sets, one [10GB file set](http://mattmahoney.net/dc/10gb.html) and a VM disk image (~8GB). Both contain different data types and represent a typical backup scenario. + +The most notable thing is how quickly the standard library drops to very low compression speeds around level 5-6 without any big gains in compression. Since this type of data is fairly common, this does not seem like good behavior. + + +## Un-compressible Content + +This is mainly a test of how good the algorithms are at detecting un-compressible input. The standard library only offers this feature with very conservative settings at level 1. Obviously there is no reason for the algorithms to try to compress input that cannot be compressed. The only downside is that it might skip some compressible data on false detections. + + +## Huffman only compression + +This compression library adds a special compression level, named `HuffmanOnly`, which allows near linear time compression. This is done by completely disabling matching of previous data, and only reduce the number of bits to represent each character. + +This means that often used characters, like 'e' and ' ' (space) in text use the fewest bits to represent, and rare characters like '¤' takes more bits to represent. For more information see [wikipedia](https://en.wikipedia.org/wiki/Huffman_coding) or this nice [video](https://youtu.be/ZdooBTdW5bM). + +Since this type of compression has much less variance, the compression speed is mostly unaffected by the input data, and is usually more than *180MB/s* for a single core. + +The downside is that the compression ratio is usually considerably worse than even the fastest conventional compression. The compression ratio can never be better than 8:1 (12.5%). + +The linear time compression can be used as a "better than nothing" mode, where you cannot risk the encoder to slow down on some content. For comparison, the size of the "Twain" text is *233460 bytes* (+29% vs. level 1) and encode speed is 144MB/s (4.5x level 1). So in this case you trade a 30% size increase for a 4 times speedup. + +For more information see my blog post on [Fast Linear Time Compression](http://blog.klauspost.com/constant-time-gzipzip-compression/). + +This is implemented on Go 1.7 as "Huffman Only" mode, though not exposed for gzip. + +# Other packages + +Here are other packages of good quality and pure Go (no cgo wrappers or autoconverted code): + +* [github.com/pierrec/lz4](https://github.com/pierrec/lz4) - strong multithreaded LZ4 compression. +* [github.com/cosnicolaou/pbzip2](https://github.com/cosnicolaou/pbzip2) - multithreaded bzip2 decompression. +* [github.com/dsnet/compress](https://github.com/dsnet/compress) - brotli decompression, bzip2 writer. + +# license + +This code is licensed under the same conditions as the original Go code. See LICENSE file. diff --git a/vendor/github.com/klauspost/compress/compressible.go b/vendor/github.com/klauspost/compress/compressible.go new file mode 100644 index 000000000..ea5a692d5 --- /dev/null +++ b/vendor/github.com/klauspost/compress/compressible.go @@ -0,0 +1,85 @@ +package compress + +import "math" + +// Estimate returns a normalized compressibility estimate of block b. +// Values close to zero are likely uncompressible. +// Values above 0.1 are likely to be compressible. +// Values above 0.5 are very compressible. +// Very small lengths will return 0. +func Estimate(b []byte) float64 { + if len(b) < 16 { + return 0 + } + + // Correctly predicted order 1 + hits := 0 + lastMatch := false + var o1 [256]byte + var hist [256]int + c1 := byte(0) + for _, c := range b { + if c == o1[c1] { + // We only count a hit if there was two correct predictions in a row. + if lastMatch { + hits++ + } + lastMatch = true + } else { + lastMatch = false + } + o1[c1] = c + c1 = c + hist[c]++ + } + + // Use x^0.6 to give better spread + prediction := math.Pow(float64(hits)/float64(len(b)), 0.6) + + // Calculate histogram distribution + variance := float64(0) + avg := float64(len(b)) / 256 + + for _, v := range hist { + Δ := float64(v) - avg + variance += Δ * Δ + } + + stddev := math.Sqrt(float64(variance)) / float64(len(b)) + exp := math.Sqrt(1 / float64(len(b))) + + // Subtract expected stddev + stddev -= exp + if stddev < 0 { + stddev = 0 + } + stddev *= 1 + exp + + // Use x^0.4 to give better spread + entropy := math.Pow(stddev, 0.4) + + // 50/50 weight between prediction and histogram distribution + return math.Pow((prediction+entropy)/2, 0.9) +} + +// ShannonEntropyBits returns the number of bits minimum required to represent +// an entropy encoding of the input bytes. +// https://en.wiktionary.org/wiki/Shannon_entropy +func ShannonEntropyBits(b []byte) int { + if len(b) == 0 { + return 0 + } + var hist [256]int + for _, c := range b { + hist[c]++ + } + shannon := float64(0) + invTotal := 1.0 / float64(len(b)) + for _, v := range hist[:] { + if v > 0 { + n := float64(v) + shannon += math.Ceil(-math.Log2(n*invTotal) * n) + } + } + return int(math.Ceil(shannon)) +} diff --git a/vendor/github.com/klauspost/compress/fse/compress.go b/vendor/github.com/klauspost/compress/fse/compress.go index 0d31f5ebc..6f341914c 100644 --- a/vendor/github.com/klauspost/compress/fse/compress.go +++ b/vendor/github.com/klauspost/compress/fse/compress.go @@ -92,7 +92,6 @@ func (c *cState) init(bw *bitWriter, ct *cTable, tableLog uint8, first symbolTra im := int32((nbBitsOut << 16) - first.deltaNbBits) lu := (im >> nbBitsOut) + first.deltaFindState c.state = c.stateTable[lu] - return } // encode the output symbol provided and write it to the bitstream. diff --git a/vendor/github.com/klauspost/compress/gen.sh b/vendor/github.com/klauspost/compress/gen.sh new file mode 100644 index 000000000..aff942205 --- /dev/null +++ b/vendor/github.com/klauspost/compress/gen.sh @@ -0,0 +1,4 @@ +#!/bin/sh + +cd s2/cmd/_s2sx/ || exit 1 +go generate . diff --git a/vendor/github.com/klauspost/compress/huff0/bitreader.go b/vendor/github.com/klauspost/compress/huff0/bitreader.go index a4979e886..504a7be9d 100644 --- a/vendor/github.com/klauspost/compress/huff0/bitreader.go +++ b/vendor/github.com/klauspost/compress/huff0/bitreader.go @@ -8,115 +8,10 @@ package huff0 import ( "encoding/binary" "errors" + "fmt" "io" ) -// bitReader reads a bitstream in reverse. -// The last set bit indicates the start of the stream and is used -// for aligning the input. -type bitReader struct { - in []byte - off uint // next byte to read is at in[off - 1] - value uint64 - bitsRead uint8 -} - -// init initializes and resets the bit reader. -func (b *bitReader) init(in []byte) error { - if len(in) < 1 { - return errors.New("corrupt stream: too short") - } - b.in = in - b.off = uint(len(in)) - // The highest bit of the last byte indicates where to start - v := in[len(in)-1] - if v == 0 { - return errors.New("corrupt stream, did not find end of stream") - } - b.bitsRead = 64 - b.value = 0 - if len(in) >= 8 { - b.fillFastStart() - } else { - b.fill() - b.fill() - } - b.bitsRead += 8 - uint8(highBit32(uint32(v))) - return nil -} - -// peekBitsFast requires that at least one bit is requested every time. -// There are no checks if the buffer is filled. -func (b *bitReader) peekBitsFast(n uint8) uint16 { - const regMask = 64 - 1 - v := uint16((b.value << (b.bitsRead & regMask)) >> ((regMask + 1 - n) & regMask)) - return v -} - -// fillFast() will make sure at least 32 bits are available. -// There must be at least 4 bytes available. -func (b *bitReader) fillFast() { - if b.bitsRead < 32 { - return - } - - // 2 bounds checks. - v := b.in[b.off-4 : b.off] - v = v[:4] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) - b.value = (b.value << 32) | uint64(low) - b.bitsRead -= 32 - b.off -= 4 -} - -func (b *bitReader) advance(n uint8) { - b.bitsRead += n -} - -// fillFastStart() assumes the bitreader is empty and there is at least 8 bytes to read. -func (b *bitReader) fillFastStart() { - // Do single re-slice to avoid bounds checks. - b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) - b.bitsRead = 0 - b.off -= 8 -} - -// fill() will make sure at least 32 bits are available. -func (b *bitReader) fill() { - if b.bitsRead < 32 { - return - } - if b.off > 4 { - v := b.in[b.off-4:] - v = v[:4] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) - b.value = (b.value << 32) | uint64(low) - b.bitsRead -= 32 - b.off -= 4 - return - } - for b.off > 0 { - b.value = (b.value << 8) | uint64(b.in[b.off-1]) - b.bitsRead -= 8 - b.off-- - } -} - -// finished returns true if all bits have been read from the bit stream. -func (b *bitReader) finished() bool { - return b.off == 0 && b.bitsRead >= 64 -} - -// close the bitstream and returns an error if out-of-buffer reads occurred. -func (b *bitReader) close() error { - // Release reference. - b.in = nil - if b.bitsRead > 64 { - return io.ErrUnexpectedEOF - } - return nil -} - // bitReader reads a bitstream in reverse. // The last set bit indicates the start of the stream and is used // for aligning the input. @@ -213,10 +108,17 @@ func (b *bitReaderBytes) finished() bool { return b.off == 0 && b.bitsRead >= 64 } +func (b *bitReaderBytes) remaining() uint { + return b.off*8 + uint(64-b.bitsRead) +} + // close the bitstream and returns an error if out-of-buffer reads occurred. func (b *bitReaderBytes) close() error { // Release reference. b.in = nil + if b.remaining() > 0 { + return fmt.Errorf("corrupt input: %d bits remain on stream", b.remaining()) + } if b.bitsRead > 64 { return io.ErrUnexpectedEOF } @@ -313,15 +215,17 @@ func (b *bitReaderShifted) fill() { } } -// finished returns true if all bits have been read from the bit stream. -func (b *bitReaderShifted) finished() bool { - return b.off == 0 && b.bitsRead >= 64 +func (b *bitReaderShifted) remaining() uint { + return b.off*8 + uint(64-b.bitsRead) } // close the bitstream and returns an error if out-of-buffer reads occurred. func (b *bitReaderShifted) close() error { // Release reference. b.in = nil + if b.remaining() > 0 { + return fmt.Errorf("corrupt input: %d bits remain on stream", b.remaining()) + } if b.bitsRead > 64 { return io.ErrUnexpectedEOF } diff --git a/vendor/github.com/klauspost/compress/huff0/bitwriter.go b/vendor/github.com/klauspost/compress/huff0/bitwriter.go index 6bce4e87d..ec71f7a34 100644 --- a/vendor/github.com/klauspost/compress/huff0/bitwriter.go +++ b/vendor/github.com/klauspost/compress/huff0/bitwriter.go @@ -5,8 +5,6 @@ package huff0 -import "fmt" - // bitWriter will write bits. // First bit will be LSB of the first byte of output. type bitWriter struct { @@ -23,14 +21,6 @@ var bitMask16 = [32]uint16{ 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF} /* up to 16 bits */ -// addBits16NC will add up to 16 bits. -// It will not check if there is space for them, -// so the caller must ensure that it has flushed recently. -func (b *bitWriter) addBits16NC(value uint16, bits uint8) { - b.bitContainer |= uint64(value&bitMask16[bits&31]) << (b.nBits & 63) - b.nBits += bits -} - // addBits16Clean will add up to 16 bits. value may not contain more set bits than indicated. // It will not check if there is space for them, so the caller must ensure that it has flushed recently. func (b *bitWriter) addBits16Clean(value uint16, bits uint8) { @@ -70,104 +60,6 @@ func (b *bitWriter) encTwoSymbols(ct cTable, av, bv byte) { b.nBits += encA.nBits + encB.nBits } -// addBits16ZeroNC will add up to 16 bits. -// It will not check if there is space for them, -// so the caller must ensure that it has flushed recently. -// This is fastest if bits can be zero. -func (b *bitWriter) addBits16ZeroNC(value uint16, bits uint8) { - if bits == 0 { - return - } - value <<= (16 - bits) & 15 - value >>= (16 - bits) & 15 - b.bitContainer |= uint64(value) << (b.nBits & 63) - b.nBits += bits -} - -// flush will flush all pending full bytes. -// There will be at least 56 bits available for writing when this has been called. -// Using flush32 is faster, but leaves less space for writing. -func (b *bitWriter) flush() { - v := b.nBits >> 3 - switch v { - case 0: - return - case 1: - b.out = append(b.out, - byte(b.bitContainer), - ) - b.bitContainer >>= 1 << 3 - case 2: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - ) - b.bitContainer >>= 2 << 3 - case 3: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - ) - b.bitContainer >>= 3 << 3 - case 4: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - ) - b.bitContainer >>= 4 << 3 - case 5: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - ) - b.bitContainer >>= 5 << 3 - case 6: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - byte(b.bitContainer>>40), - ) - b.bitContainer >>= 6 << 3 - case 7: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - byte(b.bitContainer>>40), - byte(b.bitContainer>>48), - ) - b.bitContainer >>= 7 << 3 - case 8: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - byte(b.bitContainer>>40), - byte(b.bitContainer>>48), - byte(b.bitContainer>>56), - ) - b.bitContainer = 0 - b.nBits = 0 - return - default: - panic(fmt.Errorf("bits (%d) > 64", b.nBits)) - } - b.nBits &= 7 -} - // flush32 will flush out, so there are at least 32 bits available for writing. func (b *bitWriter) flush32() { if b.nBits < 32 { @@ -201,10 +93,3 @@ func (b *bitWriter) close() error { b.flushAlign() return nil } - -// reset and continue writing by appending to out. -func (b *bitWriter) reset(out []byte) { - b.bitContainer = 0 - b.nBits = 0 - b.out = out -} diff --git a/vendor/github.com/klauspost/compress/huff0/bytereader.go b/vendor/github.com/klauspost/compress/huff0/bytereader.go index 50bcdf6ea..4dcab8d23 100644 --- a/vendor/github.com/klauspost/compress/huff0/bytereader.go +++ b/vendor/github.com/klauspost/compress/huff0/bytereader.go @@ -20,11 +20,6 @@ func (b *byteReader) init(in []byte) { b.off = 0 } -// advance the stream b n bytes. -func (b *byteReader) advance(n uint) { - b.off += int(n) -} - // Int32 returns a little endian int32 starting at current offset. func (b byteReader) Int32() int32 { v3 := int32(b.b[b.off+3]) @@ -43,11 +38,6 @@ func (b byteReader) Uint32() uint32 { return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0 } -// unread returns the unread portion of the input. -func (b byteReader) unread() []byte { - return b.b[b.off:] -} - // remain will return the number of bytes remaining. func (b byteReader) remain() int { return len(b.b) - b.off diff --git a/vendor/github.com/klauspost/compress/huff0/compress.go b/vendor/github.com/klauspost/compress/huff0/compress.go index dea115b33..4d14542fa 100644 --- a/vendor/github.com/klauspost/compress/huff0/compress.go +++ b/vendor/github.com/klauspost/compress/huff0/compress.go @@ -2,6 +2,7 @@ package huff0 import ( "fmt" + "math" "runtime" "sync" ) @@ -161,6 +162,70 @@ func compress(in []byte, s *Scratch, compressor func(src []byte) ([]byte, error) return s.Out, false, nil } +// EstimateSizes will estimate the data sizes +func EstimateSizes(in []byte, s *Scratch) (tableSz, dataSz, reuseSz int, err error) { + s, err = s.prepare(in) + if err != nil { + return 0, 0, 0, err + } + + // Create histogram, if none was provided. + tableSz, dataSz, reuseSz = -1, -1, -1 + maxCount := s.maxCount + var canReuse = false + if maxCount == 0 { + maxCount, canReuse = s.countSimple(in) + } else { + canReuse = s.canUseTable(s.prevTable) + } + + // We want the output size to be less than this: + wantSize := len(in) + if s.WantLogLess > 0 { + wantSize -= wantSize >> s.WantLogLess + } + + // Reset for next run. + s.clearCount = true + s.maxCount = 0 + if maxCount >= len(in) { + if maxCount > len(in) { + return 0, 0, 0, fmt.Errorf("maxCount (%d) > length (%d)", maxCount, len(in)) + } + if len(in) == 1 { + return 0, 0, 0, ErrIncompressible + } + // One symbol, use RLE + return 0, 0, 0, ErrUseRLE + } + if maxCount == 1 || maxCount < (len(in)>>7) { + // Each symbol present maximum once or too well distributed. + return 0, 0, 0, ErrIncompressible + } + + // Calculate new table. + err = s.buildCTable() + if err != nil { + return 0, 0, 0, err + } + + if false && !s.canUseTable(s.cTable) { + panic("invalid table generated") + } + + tableSz, err = s.cTable.estTableSize(s) + if err != nil { + return 0, 0, 0, err + } + if canReuse { + reuseSz = s.prevTable.estimateSize(s.count[:s.symbolLen]) + } + dataSz = s.cTable.estimateSize(s.count[:s.symbolLen]) + + // Restore + return tableSz, dataSz, reuseSz, nil +} + func (s *Scratch) compress1X(src []byte) ([]byte, error) { return s.compress1xDo(s.Out, src) } @@ -225,6 +290,10 @@ func (s *Scratch) compress4X(src []byte) ([]byte, error) { if err != nil { return nil, err } + if len(s.Out)-idx > math.MaxUint16 { + // We cannot store the size in the jump table + return nil, ErrIncompressible + } // Write compressed length as little endian before block. if i < 3 { // Last length is not written. @@ -268,6 +337,10 @@ func (s *Scratch) compress4Xp(src []byte) ([]byte, error) { return nil, errs[i] } o := s.tmpOut[i] + if len(o) > math.MaxUint16 { + // We cannot store the size in the jump table + return nil, ErrIncompressible + } // Write compressed length as little endian before block. if i < 3 { // Last length is not written. @@ -331,6 +404,7 @@ func (s *Scratch) canUseTable(c cTable) bool { return true } +//lint:ignore U1000 used for debugging func (s *Scratch) validateTable(c cTable) bool { if len(c) < int(s.symbolLen) { return false @@ -536,7 +610,6 @@ func (s *Scratch) huffSort() { } nodes[pos&huffNodesMask] = nodeElt{count: c, symbol: byte(n)} } - return } func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { diff --git a/vendor/github.com/klauspost/compress/huff0/decompress.go b/vendor/github.com/klauspost/compress/huff0/decompress.go index 41703bba4..c0c48bd70 100644 --- a/vendor/github.com/klauspost/compress/huff0/decompress.go +++ b/vendor/github.com/klauspost/compress/huff0/decompress.go @@ -4,13 +4,13 @@ import ( "errors" "fmt" "io" + "sync" "github.com/klauspost/compress/fse" ) type dTable struct { single []dEntrySingle - double []dEntryDouble } // single-symbols decoding @@ -18,13 +18,6 @@ type dEntrySingle struct { entry uint16 } -// double-symbols decoding -type dEntryDouble struct { - seq uint16 - nBits uint8 - len uint8 -} - // Uses special code for all tables that are < 8 bits. const use8BitTables = true @@ -34,7 +27,7 @@ const use8BitTables = true // If no Scratch is provided a new one is allocated. // The returned Scratch can be used for encoding or decoding input using this table. func ReadTable(in []byte, s *Scratch) (s2 *Scratch, remain []byte, err error) { - s, err = s.prepare(in) + s, err = s.prepare(nil) if err != nil { return s, nil, err } @@ -216,6 +209,7 @@ func (s *Scratch) Decoder() *Decoder { return &Decoder{ dt: s.dt, actualTableLog: s.actualTableLog, + bufs: &s.decPool, } } @@ -223,103 +217,15 @@ func (s *Scratch) Decoder() *Decoder { type Decoder struct { dt dTable actualTableLog uint8 + bufs *sync.Pool } -// Decompress1X will decompress a 1X encoded stream. -// The cap of the output buffer will be the maximum decompressed size. -// The length of the supplied input must match the end of a block exactly. -func (d *Decoder) Decompress1X(dst, src []byte) ([]byte, error) { - if len(d.dt.single) == 0 { - return nil, errors.New("no table loaded") +func (d *Decoder) buffer() *[4][256]byte { + buf, ok := d.bufs.Get().(*[4][256]byte) + if ok { + return buf } - if use8BitTables && d.actualTableLog <= 8 { - return d.decompress1X8Bit(dst, src) - } - var br bitReaderShifted - err := br.init(src) - if err != nil { - return dst, err - } - maxDecodedSize := cap(dst) - dst = dst[:0] - - // Avoid bounds check by always having full sized table. - const tlSize = 1 << tableLogMax - const tlMask = tlSize - 1 - dt := d.dt.single[:tlSize] - - // Use temp table to avoid bound checks/append penalty. - var buf [256]byte - var off uint8 - - for br.off >= 8 { - br.fillFast() - v := dt[br.peekBitsFast(d.actualTableLog)&tlMask] - br.advance(uint8(v.entry)) - buf[off+0] = uint8(v.entry >> 8) - - v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] - br.advance(uint8(v.entry)) - buf[off+1] = uint8(v.entry >> 8) - - // Refill - br.fillFast() - - v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] - br.advance(uint8(v.entry)) - buf[off+2] = uint8(v.entry >> 8) - - v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] - br.advance(uint8(v.entry)) - buf[off+3] = uint8(v.entry >> 8) - - off += 4 - if off == 0 { - if len(dst)+256 > maxDecodedSize { - br.close() - return nil, ErrMaxDecodedSizeExceeded - } - dst = append(dst, buf[:]...) - } - } - - if len(dst)+int(off) > maxDecodedSize { - br.close() - return nil, ErrMaxDecodedSizeExceeded - } - dst = append(dst, buf[:off]...) - - // br < 8, so uint8 is fine - bitsLeft := uint8(br.off)*8 + 64 - br.bitsRead - for bitsLeft > 0 { - br.fill() - if false && br.bitsRead >= 32 { - if br.off >= 4 { - v := br.in[br.off-4:] - v = v[:4] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) - br.value = (br.value << 32) | uint64(low) - br.bitsRead -= 32 - br.off -= 4 - } else { - for br.off > 0 { - br.value = (br.value << 8) | uint64(br.in[br.off-1]) - br.bitsRead -= 8 - br.off-- - } - } - } - if len(dst) >= maxDecodedSize { - br.close() - return nil, ErrMaxDecodedSizeExceeded - } - v := d.dt.single[br.peekBitsFast(d.actualTableLog)&tlMask] - nBits := uint8(v.entry) - br.advance(nBits) - bitsLeft -= nBits - dst = append(dst, uint8(v.entry>>8)) - } - return dst, br.close() + return &[4][256]byte{} } // decompress1X8Bit will decompress a 1X encoded stream with tablelog <= 8. @@ -341,41 +247,258 @@ func (d *Decoder) decompress1X8Bit(dst, src []byte) ([]byte, error) { dt := d.dt.single[:256] // Use temp table to avoid bound checks/append penalty. - var buf [256]byte + bufs := d.buffer() + buf := &bufs[0] var off uint8 - shift := (8 - d.actualTableLog) & 7 - - //fmt.Printf("mask: %b, tl:%d\n", mask, d.actualTableLog) - for br.off >= 4 { - br.fillFast() - v := dt[br.peekByteFast()>>shift] - br.advance(uint8(v.entry)) - buf[off+0] = uint8(v.entry >> 8) - - v = dt[br.peekByteFast()>>shift] - br.advance(uint8(v.entry)) - buf[off+1] = uint8(v.entry >> 8) - - v = dt[br.peekByteFast()>>shift] - br.advance(uint8(v.entry)) - buf[off+2] = uint8(v.entry >> 8) - - v = dt[br.peekByteFast()>>shift] - br.advance(uint8(v.entry)) - buf[off+3] = uint8(v.entry >> 8) - - off += 4 - if off == 0 { - if len(dst)+256 > maxDecodedSize { - br.close() - return nil, ErrMaxDecodedSizeExceeded + switch d.actualTableLog { + case 8: + const shift = 8 - 8 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 7: + const shift = 8 - 7 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 6: + const shift = 8 - 6 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) } - dst = append(dst, buf[:]...) } + case 5: + const shift = 8 - 5 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 4: + const shift = 8 - 4 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 3: + const shift = 8 - 3 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 2: + const shift = 8 - 2 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 1: + const shift = 8 - 1 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + default: + d.bufs.Put(bufs) + return nil, fmt.Errorf("invalid tablelog: %d", d.actualTableLog) } if len(dst)+int(off) > maxDecodedSize { + d.bufs.Put(bufs) br.close() return nil, ErrMaxDecodedSizeExceeded } @@ -383,6 +506,8 @@ func (d *Decoder) decompress1X8Bit(dst, src []byte) ([]byte, error) { // br < 4, so uint8 is fine bitsLeft := int8(uint8(br.off)*8 + (64 - br.bitsRead)) + shift := (8 - d.actualTableLog) & 7 + for bitsLeft > 0 { if br.bitsRead >= 64-8 { for br.off > 0 { @@ -393,6 +518,7 @@ func (d *Decoder) decompress1X8Bit(dst, src []byte) ([]byte, error) { } if len(dst) >= maxDecodedSize { br.close() + d.bufs.Put(bufs) return nil, ErrMaxDecodedSizeExceeded } v := dt[br.peekByteFast()>>shift] @@ -401,6 +527,7 @@ func (d *Decoder) decompress1X8Bit(dst, src []byte) ([]byte, error) { bitsLeft -= int8(nBits) dst = append(dst, uint8(v.entry>>8)) } + d.bufs.Put(bufs) return dst, br.close() } @@ -420,33 +547,35 @@ func (d *Decoder) decompress1X8BitExactly(dst, src []byte) ([]byte, error) { dt := d.dt.single[:256] // Use temp table to avoid bound checks/append penalty. - var buf [256]byte + bufs := d.buffer() + buf := &bufs[0] var off uint8 - const shift = 0 + const shift = 56 //fmt.Printf("mask: %b, tl:%d\n", mask, d.actualTableLog) for br.off >= 4 { br.fillFast() - v := dt[br.peekByteFast()>>shift] + v := dt[uint8(br.value>>shift)] br.advance(uint8(v.entry)) buf[off+0] = uint8(v.entry >> 8) - v = dt[br.peekByteFast()>>shift] + v = dt[uint8(br.value>>shift)] br.advance(uint8(v.entry)) buf[off+1] = uint8(v.entry >> 8) - v = dt[br.peekByteFast()>>shift] + v = dt[uint8(br.value>>shift)] br.advance(uint8(v.entry)) buf[off+2] = uint8(v.entry >> 8) - v = dt[br.peekByteFast()>>shift] + v = dt[uint8(br.value>>shift)] br.advance(uint8(v.entry)) buf[off+3] = uint8(v.entry >> 8) off += 4 if off == 0 { if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) br.close() return nil, ErrMaxDecodedSizeExceeded } @@ -455,6 +584,7 @@ func (d *Decoder) decompress1X8BitExactly(dst, src []byte) ([]byte, error) { } if len(dst)+int(off) > maxDecodedSize { + d.bufs.Put(bufs) br.close() return nil, ErrMaxDecodedSizeExceeded } @@ -471,208 +601,20 @@ func (d *Decoder) decompress1X8BitExactly(dst, src []byte) ([]byte, error) { } } if len(dst) >= maxDecodedSize { + d.bufs.Put(bufs) br.close() return nil, ErrMaxDecodedSizeExceeded } - v := dt[br.peekByteFast()>>shift] + v := dt[br.peekByteFast()] nBits := uint8(v.entry) br.advance(nBits) bitsLeft -= int8(nBits) dst = append(dst, uint8(v.entry>>8)) } + d.bufs.Put(bufs) return dst, br.close() } -// Decompress4X will decompress a 4X encoded stream. -// The length of the supplied input must match the end of a block exactly. -// The *capacity* of the dst slice must match the destination size of -// the uncompressed data exactly. -func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { - if len(d.dt.single) == 0 { - return nil, errors.New("no table loaded") - } - if len(src) < 6+(4*1) { - return nil, errors.New("input too small") - } - if use8BitTables && d.actualTableLog <= 8 { - return d.decompress4X8bit(dst, src) - } - - var br [4]bitReaderShifted - start := 6 - for i := 0; i < 3; i++ { - length := int(src[i*2]) | (int(src[i*2+1]) << 8) - if start+length >= len(src) { - return nil, errors.New("truncated input (or invalid offset)") - } - err := br[i].init(src[start : start+length]) - if err != nil { - return nil, err - } - start += length - } - err := br[3].init(src[start:]) - if err != nil { - return nil, err - } - - // destination, offset to match first output - dstSize := cap(dst) - dst = dst[:dstSize] - out := dst - dstEvery := (dstSize + 3) / 4 - - const tlSize = 1 << tableLogMax - const tlMask = tlSize - 1 - single := d.dt.single[:tlSize] - - // Use temp table to avoid bound checks/append penalty. - var buf [256]byte - var off uint8 - var decoded int - - // Decode 2 values from each decoder/loop. - const bufoff = 256 / 4 - for { - if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { - break - } - - { - const stream = 0 - const stream2 = 1 - br[stream].fillFast() - br[stream2].fillFast() - - val := br[stream].peekBitsFast(d.actualTableLog) - v := single[val&tlMask] - br[stream].advance(uint8(v.entry)) - buf[off+bufoff*stream] = uint8(v.entry >> 8) - - val2 := br[stream2].peekBitsFast(d.actualTableLog) - v2 := single[val2&tlMask] - br[stream2].advance(uint8(v2.entry)) - buf[off+bufoff*stream2] = uint8(v2.entry >> 8) - - val = br[stream].peekBitsFast(d.actualTableLog) - v = single[val&tlMask] - br[stream].advance(uint8(v.entry)) - buf[off+bufoff*stream+1] = uint8(v.entry >> 8) - - val2 = br[stream2].peekBitsFast(d.actualTableLog) - v2 = single[val2&tlMask] - br[stream2].advance(uint8(v2.entry)) - buf[off+bufoff*stream2+1] = uint8(v2.entry >> 8) - } - - { - const stream = 2 - const stream2 = 3 - br[stream].fillFast() - br[stream2].fillFast() - - val := br[stream].peekBitsFast(d.actualTableLog) - v := single[val&tlMask] - br[stream].advance(uint8(v.entry)) - buf[off+bufoff*stream] = uint8(v.entry >> 8) - - val2 := br[stream2].peekBitsFast(d.actualTableLog) - v2 := single[val2&tlMask] - br[stream2].advance(uint8(v2.entry)) - buf[off+bufoff*stream2] = uint8(v2.entry >> 8) - - val = br[stream].peekBitsFast(d.actualTableLog) - v = single[val&tlMask] - br[stream].advance(uint8(v.entry)) - buf[off+bufoff*stream+1] = uint8(v.entry >> 8) - - val2 = br[stream2].peekBitsFast(d.actualTableLog) - v2 = single[val2&tlMask] - br[stream2].advance(uint8(v2.entry)) - buf[off+bufoff*stream2+1] = uint8(v2.entry >> 8) - } - - off += 2 - - if off == bufoff { - if bufoff > dstEvery { - return nil, errors.New("corruption detected: stream overrun 1") - } - copy(out, buf[:bufoff]) - copy(out[dstEvery:], buf[bufoff:bufoff*2]) - copy(out[dstEvery*2:], buf[bufoff*2:bufoff*3]) - copy(out[dstEvery*3:], buf[bufoff*3:bufoff*4]) - off = 0 - out = out[bufoff:] - decoded += 256 - // There must at least be 3 buffers left. - if len(out) < dstEvery*3 { - return nil, errors.New("corruption detected: stream overrun 2") - } - } - } - if off > 0 { - ioff := int(off) - if len(out) < dstEvery*3+ioff { - return nil, errors.New("corruption detected: stream overrun 3") - } - copy(out, buf[:off]) - copy(out[dstEvery:dstEvery+ioff], buf[bufoff:bufoff*2]) - copy(out[dstEvery*2:dstEvery*2+ioff], buf[bufoff*2:bufoff*3]) - copy(out[dstEvery*3:dstEvery*3+ioff], buf[bufoff*3:bufoff*4]) - decoded += int(off) * 4 - out = out[off:] - } - - // Decode remaining. - for i := range br { - offset := dstEvery * i - br := &br[i] - bitsLeft := br.off*8 + uint(64-br.bitsRead) - for bitsLeft > 0 { - br.fill() - if false && br.bitsRead >= 32 { - if br.off >= 4 { - v := br.in[br.off-4:] - v = v[:4] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) - br.value = (br.value << 32) | uint64(low) - br.bitsRead -= 32 - br.off -= 4 - } else { - for br.off > 0 { - br.value = (br.value << 8) | uint64(br.in[br.off-1]) - br.bitsRead -= 8 - br.off-- - } - } - } - // end inline... - if offset >= len(out) { - return nil, errors.New("corruption detected: stream overrun 4") - } - - // Read value and increment offset. - val := br.peekBitsFast(d.actualTableLog) - v := single[val&tlMask].entry - nBits := uint8(v) - br.advance(nBits) - bitsLeft -= uint(nBits) - out[offset] = uint8(v >> 8) - offset++ - } - decoded += offset - dstEvery*i - err = br.close() - if err != nil { - return nil, err - } - } - if dstSize != decoded { - return nil, errors.New("corruption detected: short output block") - } - return dst, nil -} - // Decompress4X will decompress a 4X encoded stream. // The length of the supplied input must match the end of a block exactly. // The *capacity* of the dst slice must match the destination size of @@ -706,19 +648,18 @@ func (d *Decoder) decompress4X8bit(dst, src []byte) ([]byte, error) { out := dst dstEvery := (dstSize + 3) / 4 - shift := (8 - d.actualTableLog) & 7 + shift := (56 + (8 - d.actualTableLog)) & 63 const tlSize = 1 << 8 - const tlMask = tlSize - 1 single := d.dt.single[:tlSize] // Use temp table to avoid bound checks/append penalty. - var buf [256]byte + buf := d.buffer() var off uint8 var decoded int // Decode 4 values from each decoder/loop. - const bufoff = 256 / 4 + const bufoff = 256 for { if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { break @@ -728,96 +669,109 @@ func (d *Decoder) decompress4X8bit(dst, src []byte) ([]byte, error) { // Interleave 2 decodes. const stream = 0 const stream2 = 1 - br[stream].fillFast() - br[stream2].fillFast() - - v := single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 := single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+1] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+1] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+2] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+3] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+3] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) } { const stream = 2 const stream2 = 3 - br[stream].fillFast() - br[stream2].fillFast() - - v := single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 := single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+1] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+1] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+2] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+3] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+3] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) } off += 4 - if off == bufoff { + if off == 0 { if bufoff > dstEvery { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 1") } - copy(out, buf[:bufoff]) - copy(out[dstEvery:], buf[bufoff:bufoff*2]) - copy(out[dstEvery*2:], buf[bufoff*2:bufoff*3]) - copy(out[dstEvery*3:], buf[bufoff*3:bufoff*4]) - off = 0 + copy(out, buf[0][:]) + copy(out[dstEvery:], buf[1][:]) + copy(out[dstEvery*2:], buf[2][:]) + copy(out[dstEvery*3:], buf[3][:]) out = out[bufoff:] - decoded += 256 + decoded += bufoff * 4 // There must at least be 3 buffers left. if len(out) < dstEvery*3 { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 2") } } @@ -825,23 +779,31 @@ func (d *Decoder) decompress4X8bit(dst, src []byte) ([]byte, error) { if off > 0 { ioff := int(off) if len(out) < dstEvery*3+ioff { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 3") } - copy(out, buf[:off]) - copy(out[dstEvery:dstEvery+ioff], buf[bufoff:bufoff*2]) - copy(out[dstEvery*2:dstEvery*2+ioff], buf[bufoff*2:bufoff*3]) - copy(out[dstEvery*3:dstEvery*3+ioff], buf[bufoff*3:bufoff*4]) + copy(out, buf[0][:off]) + copy(out[dstEvery:], buf[1][:off]) + copy(out[dstEvery*2:], buf[2][:off]) + copy(out[dstEvery*3:], buf[3][:off]) decoded += int(off) * 4 out = out[off:] } // Decode remaining. + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) for i := range br { offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } br := &br[i] - bitsLeft := int(br.off*8) + int(64-br.bitsRead) + bitsLeft := br.remaining() for bitsLeft > 0 { if br.finished() { + d.bufs.Put(buf) return nil, io.ErrUnexpectedEOF } if br.bitsRead >= 56 { @@ -861,24 +823,31 @@ func (d *Decoder) decompress4X8bit(dst, src []byte) ([]byte, error) { } } // end inline... - if offset >= len(out) { + if offset >= endsAt { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 4") } // Read value and increment offset. - v := single[br.peekByteFast()>>shift].entry + v := single[uint8(br.value>>shift)].entry nBits := uint8(v) br.advance(nBits) - bitsLeft -= int(nBits) + bitsLeft -= uint(nBits) out[offset] = uint8(v >> 8) offset++ } + if offset != endsAt { + d.bufs.Put(buf) + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } decoded += offset - dstEvery*i err = br.close() if err != nil { + d.bufs.Put(buf) return nil, err } } + d.bufs.Put(buf) if dstSize != decoded { return nil, errors.New("corruption detected: short output block") } @@ -914,18 +883,17 @@ func (d *Decoder) decompress4X8bitExactly(dst, src []byte) ([]byte, error) { out := dst dstEvery := (dstSize + 3) / 4 - const shift = 0 + const shift = 56 const tlSize = 1 << 8 - const tlMask = tlSize - 1 single := d.dt.single[:tlSize] // Use temp table to avoid bound checks/append penalty. - var buf [256]byte + buf := d.buffer() var off uint8 var decoded int // Decode 4 values from each decoder/loop. - const bufoff = 256 / 4 + const bufoff = 256 for { if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { break @@ -935,96 +903,109 @@ func (d *Decoder) decompress4X8bitExactly(dst, src []byte) ([]byte, error) { // Interleave 2 decodes. const stream = 0 const stream2 = 1 - br[stream].fillFast() - br[stream2].fillFast() - - v := single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 := single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+1] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+1] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+2] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+3] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+3] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) } { const stream = 2 const stream2 = 3 - br[stream].fillFast() - br[stream2].fillFast() - - v := single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 := single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+1] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+1] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+2] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+2] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) - - v = single[br[stream].peekByteFast()>>shift].entry - buf[off+bufoff*stream+3] = uint8(v >> 8) - br[stream].advance(uint8(v)) - - v2 = single[br[stream2].peekByteFast()>>shift].entry - buf[off+bufoff*stream2+3] = uint8(v2 >> 8) - br[stream2].advance(uint8(v2)) + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) } off += 4 - if off == bufoff { + if off == 0 { if bufoff > dstEvery { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 1") } - copy(out, buf[:bufoff]) - copy(out[dstEvery:], buf[bufoff:bufoff*2]) - copy(out[dstEvery*2:], buf[bufoff*2:bufoff*3]) - copy(out[dstEvery*3:], buf[bufoff*3:bufoff*4]) - off = 0 + copy(out, buf[0][:]) + copy(out[dstEvery:], buf[1][:]) + copy(out[dstEvery*2:], buf[2][:]) + copy(out[dstEvery*3:], buf[3][:]) out = out[bufoff:] - decoded += 256 + decoded += bufoff * 4 // There must at least be 3 buffers left. if len(out) < dstEvery*3 { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 2") } } @@ -1034,21 +1015,27 @@ func (d *Decoder) decompress4X8bitExactly(dst, src []byte) ([]byte, error) { if len(out) < dstEvery*3+ioff { return nil, errors.New("corruption detected: stream overrun 3") } - copy(out, buf[:off]) - copy(out[dstEvery:dstEvery+ioff], buf[bufoff:bufoff*2]) - copy(out[dstEvery*2:dstEvery*2+ioff], buf[bufoff*2:bufoff*3]) - copy(out[dstEvery*3:dstEvery*3+ioff], buf[bufoff*3:bufoff*4]) + copy(out, buf[0][:off]) + copy(out[dstEvery:], buf[1][:off]) + copy(out[dstEvery*2:], buf[2][:off]) + copy(out[dstEvery*3:], buf[3][:off]) decoded += int(off) * 4 out = out[off:] } // Decode remaining. + remainBytes := dstEvery - (decoded / 4) for i := range br { offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } br := &br[i] - bitsLeft := int(br.off*8) + int(64-br.bitsRead) + bitsLeft := br.remaining() for bitsLeft > 0 { if br.finished() { + d.bufs.Put(buf) return nil, io.ErrUnexpectedEOF } if br.bitsRead >= 56 { @@ -1068,24 +1055,32 @@ func (d *Decoder) decompress4X8bitExactly(dst, src []byte) ([]byte, error) { } } // end inline... - if offset >= len(out) { + if offset >= endsAt { + d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 4") } // Read value and increment offset. - v := single[br.peekByteFast()>>shift].entry + v := single[br.peekByteFast()].entry nBits := uint8(v) br.advance(nBits) - bitsLeft -= int(nBits) + bitsLeft -= uint(nBits) out[offset] = uint8(v >> 8) offset++ } + if offset != endsAt { + d.bufs.Put(buf) + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + decoded += offset - dstEvery*i err = br.close() if err != nil { + d.bufs.Put(buf) return nil, err } } + d.bufs.Put(buf) if dstSize != decoded { return nil, errors.New("corruption detected: short output block") } diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go new file mode 100644 index 000000000..9f3e9f79e --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go @@ -0,0 +1,222 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +// This file contains the specialisation of Decoder.Decompress4X +// and Decoder.Decompress1X that use an asm implementation of thir main loops. +package huff0 + +import ( + "errors" + "fmt" + + "github.com/klauspost/compress/internal/cpuinfo" +) + +// decompress4x_main_loop_x86 is an x86 assembler implementation +// of Decompress4X when tablelog > 8. +//go:noescape +func decompress4x_main_loop_amd64(ctx *decompress4xContext) + +// decompress4x_8b_loop_x86 is an x86 assembler implementation +// of Decompress4X when tablelog <= 8 which decodes 4 entries +// per loop. +//go:noescape +func decompress4x_8b_main_loop_amd64(ctx *decompress4xContext) + +// fallback8BitSize is the size where using Go version is faster. +const fallback8BitSize = 800 + +type decompress4xContext struct { + pbr *[4]bitReaderShifted + peekBits uint8 + out *byte + dstEvery int + tbl *dEntrySingle + decoded int + limit *byte +} + +// Decompress4X will decompress a 4X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// The *capacity* of the dst slice must match the destination size of +// the uncompressed data exactly. +func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + if len(src) < 6+(4*1) { + return nil, errors.New("input too small") + } + + use8BitTables := d.actualTableLog <= 8 + if cap(dst) < fallback8BitSize && use8BitTables { + return d.decompress4X8bit(dst, src) + } + + var br [4]bitReaderShifted + // Decode "jump table" + start := 6 + for i := 0; i < 3; i++ { + length := int(src[i*2]) | (int(src[i*2+1]) << 8) + if start+length >= len(src) { + return nil, errors.New("truncated input (or invalid offset)") + } + err := br[i].init(src[start : start+length]) + if err != nil { + return nil, err + } + start += length + } + err := br[3].init(src[start:]) + if err != nil { + return nil, err + } + + // destination, offset to match first output + dstSize := cap(dst) + dst = dst[:dstSize] + out := dst + dstEvery := (dstSize + 3) / 4 + + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + single := d.dt.single[:tlSize] + + var decoded int + + if len(out) > 4*4 && !(br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4) { + ctx := decompress4xContext{ + pbr: &br, + peekBits: uint8((64 - d.actualTableLog) & 63), // see: bitReaderShifted.peekBitsFast() + out: &out[0], + dstEvery: dstEvery, + tbl: &single[0], + limit: &out[dstEvery-4], // Always stop decoding when first buffer gets here to avoid writing OOB on last. + } + if use8BitTables { + decompress4x_8b_main_loop_amd64(&ctx) + } else { + decompress4x_main_loop_amd64(&ctx) + } + + decoded = ctx.decoded + out = out[decoded/4:] + } + + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) + for i := range br { + offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } + br := &br[i] + bitsLeft := br.remaining() + for bitsLeft > 0 { + br.fill() + if offset >= endsAt { + return nil, errors.New("corruption detected: stream overrun 4") + } + + // Read value and increment offset. + val := br.peekBitsFast(d.actualTableLog) + v := single[val&tlMask].entry + nBits := uint8(v) + br.advance(nBits) + bitsLeft -= uint(nBits) + out[offset] = uint8(v >> 8) + offset++ + } + if offset != endsAt { + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + decoded += offset - dstEvery*i + err = br.close() + if err != nil { + return nil, err + } + } + if dstSize != decoded { + return nil, errors.New("corruption detected: short output block") + } + return dst, nil +} + +// decompress4x_main_loop_x86 is an x86 assembler implementation +// of Decompress1X when tablelog > 8. +//go:noescape +func decompress1x_main_loop_amd64(ctx *decompress1xContext) + +// decompress4x_main_loop_x86 is an x86 with BMI2 assembler implementation +// of Decompress1X when tablelog > 8. +//go:noescape +func decompress1x_main_loop_bmi2(ctx *decompress1xContext) + +type decompress1xContext struct { + pbr *bitReaderShifted + peekBits uint8 + out *byte + outCap int + tbl *dEntrySingle + decoded int +} + +// Error reported by asm implementations +const error_max_decoded_size_exeeded = -1 + +// Decompress1X will decompress a 1X encoded stream. +// The cap of the output buffer will be the maximum decompressed size. +// The length of the supplied input must match the end of a block exactly. +func (d *Decoder) Decompress1X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + var br bitReaderShifted + err := br.init(src) + if err != nil { + return dst, err + } + maxDecodedSize := cap(dst) + dst = dst[:maxDecodedSize] + + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + + if maxDecodedSize >= 4 { + ctx := decompress1xContext{ + pbr: &br, + out: &dst[0], + outCap: maxDecodedSize, + peekBits: uint8((64 - d.actualTableLog) & 63), // see: bitReaderShifted.peekBitsFast() + tbl: &d.dt.single[0], + } + + if cpuinfo.HasBMI2() { + decompress1x_main_loop_bmi2(&ctx) + } else { + decompress1x_main_loop_amd64(&ctx) + } + if ctx.decoded == error_max_decoded_size_exeeded { + return nil, ErrMaxDecodedSizeExceeded + } + + dst = dst[:ctx.decoded] + } + + // br < 8, so uint8 is fine + bitsLeft := uint8(br.off)*8 + 64 - br.bitsRead + for bitsLeft > 0 { + br.fill() + if len(dst) >= maxDecodedSize { + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + v := d.dt.single[br.peekBitsFast(d.actualTableLog)&tlMask] + nBits := uint8(v.entry) + br.advance(nBits) + bitsLeft -= nBits + dst = append(dst, uint8(v.entry>>8)) + } + return dst, br.close() +} diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s new file mode 100644 index 000000000..dd1a5aecd --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s @@ -0,0 +1,847 @@ +// Code generated by command: go run gen.go -out ../decompress_amd64.s -pkg=huff0. DO NOT EDIT. + +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +// func decompress4x_main_loop_amd64(ctx *decompress4xContext) +TEXT ·decompress4x_main_loop_amd64(SB), $0-8 + XORQ DX, DX + + // Preload values + MOVQ ctx+0(FP), AX + MOVBQZX 8(AX), DI + MOVQ 16(AX), SI + MOVQ 48(AX), BX + MOVQ 24(AX), R9 + MOVQ 32(AX), R10 + MOVQ (AX), R11 + + // Main loop +main_loop: + MOVQ SI, R8 + CMPQ R8, BX + SETGE DL + + // br0.fillFast32() + MOVQ 32(R11), R12 + MOVBQZX 40(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill0 + MOVQ 24(R11), AX + SUBQ $0x20, R13 + SUBQ $0x04, AX + MOVQ (R11), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R14*1), R14 + MOVQ R13, CX + SHLQ CL, R14 + MOVQ AX, 24(R11) + ORQ R14, R12 + + // exhausted = exhausted || (br0.off < 4) + CMPQ AX, $0x04 + SETLT AL + ORB AL, DL + +skip_fill0: + // val0 := br0.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br0.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br0.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R12, R14 + SHRQ CL, R14 + + // v1 := table[val1&mask] + MOVW (R10)(R14*2), CX + + // br0.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (R8) + + // update the bitreader structure + MOVQ R12, 32(R11) + MOVB R13, 40(R11) + ADDQ R9, R8 + + // br1.fillFast32() + MOVQ 80(R11), R12 + MOVBQZX 88(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill1 + MOVQ 72(R11), AX + SUBQ $0x20, R13 + SUBQ $0x04, AX + MOVQ 48(R11), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R14*1), R14 + MOVQ R13, CX + SHLQ CL, R14 + MOVQ AX, 72(R11) + ORQ R14, R12 + + // exhausted = exhausted || (br1.off < 4) + CMPQ AX, $0x04 + SETLT AL + ORB AL, DL + +skip_fill1: + // val0 := br1.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br1.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br1.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R12, R14 + SHRQ CL, R14 + + // v1 := table[val1&mask] + MOVW (R10)(R14*2), CX + + // br1.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (R8) + + // update the bitreader structure + MOVQ R12, 80(R11) + MOVB R13, 88(R11) + ADDQ R9, R8 + + // br2.fillFast32() + MOVQ 128(R11), R12 + MOVBQZX 136(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill2 + MOVQ 120(R11), AX + SUBQ $0x20, R13 + SUBQ $0x04, AX + MOVQ 96(R11), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R14*1), R14 + MOVQ R13, CX + SHLQ CL, R14 + MOVQ AX, 120(R11) + ORQ R14, R12 + + // exhausted = exhausted || (br2.off < 4) + CMPQ AX, $0x04 + SETLT AL + ORB AL, DL + +skip_fill2: + // val0 := br2.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br2.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br2.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R12, R14 + SHRQ CL, R14 + + // v1 := table[val1&mask] + MOVW (R10)(R14*2), CX + + // br2.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (R8) + + // update the bitreader structure + MOVQ R12, 128(R11) + MOVB R13, 136(R11) + ADDQ R9, R8 + + // br3.fillFast32() + MOVQ 176(R11), R12 + MOVBQZX 184(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill3 + MOVQ 168(R11), AX + SUBQ $0x20, R13 + SUBQ $0x04, AX + MOVQ 144(R11), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R14*1), R14 + MOVQ R13, CX + SHLQ CL, R14 + MOVQ AX, 168(R11) + ORQ R14, R12 + + // exhausted = exhausted || (br3.off < 4) + CMPQ AX, $0x04 + SETLT AL + ORB AL, DL + +skip_fill3: + // val0 := br3.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br3.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br3.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R12, R14 + SHRQ CL, R14 + + // v1 := table[val1&mask] + MOVW (R10)(R14*2), CX + + // br3.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (R8) + + // update the bitreader structure + MOVQ R12, 176(R11) + MOVB R13, 184(R11) + ADDQ $0x02, SI + TESTB DL, DL + JZ main_loop + MOVQ ctx+0(FP), AX + SUBQ 16(AX), SI + SHLQ $0x02, SI + MOVQ SI, 40(AX) + RET + +// func decompress4x_8b_main_loop_amd64(ctx *decompress4xContext) +TEXT ·decompress4x_8b_main_loop_amd64(SB), $0-8 + XORQ DX, DX + + // Preload values + MOVQ ctx+0(FP), CX + MOVBQZX 8(CX), DI + MOVQ 16(CX), BX + MOVQ 48(CX), SI + MOVQ 24(CX), R9 + MOVQ 32(CX), R10 + MOVQ (CX), R11 + + // Main loop +main_loop: + MOVQ BX, R8 + CMPQ R8, SI + SETGE DL + + // br0.fillFast32() + MOVQ 32(R11), R12 + MOVBQZX 40(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill0 + MOVQ 24(R11), R14 + SUBQ $0x20, R13 + SUBQ $0x04, R14 + MOVQ (R11), R15 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R14)(R15*1), R15 + MOVQ R13, CX + SHLQ CL, R15 + MOVQ R14, 24(R11) + ORQ R15, R12 + + // exhausted = exhausted || (br0.off < 4) + CMPQ R14, $0x04 + SETLT AL + ORB AL, DL + +skip_fill0: + // val0 := br0.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br0.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br0.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v1 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br0.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // val2 := br0.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v2 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br0.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // val3 := br0.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v3 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br0.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (R8) + + // update the bitreader structure + MOVQ R12, 32(R11) + MOVB R13, 40(R11) + ADDQ R9, R8 + + // br1.fillFast32() + MOVQ 80(R11), R12 + MOVBQZX 88(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill1 + MOVQ 72(R11), R14 + SUBQ $0x20, R13 + SUBQ $0x04, R14 + MOVQ 48(R11), R15 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R14)(R15*1), R15 + MOVQ R13, CX + SHLQ CL, R15 + MOVQ R14, 72(R11) + ORQ R15, R12 + + // exhausted = exhausted || (br1.off < 4) + CMPQ R14, $0x04 + SETLT AL + ORB AL, DL + +skip_fill1: + // val0 := br1.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br1.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br1.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v1 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br1.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // val2 := br1.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v2 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br1.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // val3 := br1.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v3 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br1.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (R8) + + // update the bitreader structure + MOVQ R12, 80(R11) + MOVB R13, 88(R11) + ADDQ R9, R8 + + // br2.fillFast32() + MOVQ 128(R11), R12 + MOVBQZX 136(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill2 + MOVQ 120(R11), R14 + SUBQ $0x20, R13 + SUBQ $0x04, R14 + MOVQ 96(R11), R15 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R14)(R15*1), R15 + MOVQ R13, CX + SHLQ CL, R15 + MOVQ R14, 120(R11) + ORQ R15, R12 + + // exhausted = exhausted || (br2.off < 4) + CMPQ R14, $0x04 + SETLT AL + ORB AL, DL + +skip_fill2: + // val0 := br2.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br2.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br2.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v1 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br2.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // val2 := br2.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v2 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br2.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // val3 := br2.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v3 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br2.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (R8) + + // update the bitreader structure + MOVQ R12, 128(R11) + MOVB R13, 136(R11) + ADDQ R9, R8 + + // br3.fillFast32() + MOVQ 176(R11), R12 + MOVBQZX 184(R11), R13 + CMPQ R13, $0x20 + JBE skip_fill3 + MOVQ 168(R11), R14 + SUBQ $0x20, R13 + SUBQ $0x04, R14 + MOVQ 144(R11), R15 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R14)(R15*1), R15 + MOVQ R13, CX + SHLQ CL, R15 + MOVQ R14, 168(R11) + ORQ R15, R12 + + // exhausted = exhausted || (br3.off < 4) + CMPQ R14, $0x04 + SETLT AL + ORB AL, DL + +skip_fill3: + // val0 := br3.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v0 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br3.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + + // val1 := br3.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v1 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br3.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // val2 := br3.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v2 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br3.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R12 + ADDB CL, R13 + + // val3 := br3.peekTopBits(peekBits) + MOVQ R12, R14 + MOVQ DI, CX + SHRQ CL, R14 + + // v3 := table[val0&mask] + MOVW (R10)(R14*2), CX + + // br3.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R12 + ADDB CL, R13 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (R8) + + // update the bitreader structure + MOVQ R12, 176(R11) + MOVB R13, 184(R11) + ADDQ $0x04, BX + TESTB DL, DL + JZ main_loop + MOVQ ctx+0(FP), AX + SUBQ 16(AX), BX + SHLQ $0x02, BX + MOVQ BX, 40(AX) + RET + +// func decompress1x_main_loop_amd64(ctx *decompress1xContext) +TEXT ·decompress1x_main_loop_amd64(SB), $0-8 + MOVQ ctx+0(FP), CX + MOVQ 16(CX), DX + MOVQ 24(CX), BX + CMPQ BX, $0x04 + JB error_max_decoded_size_exeeded + LEAQ (DX)(BX*1), BX + MOVQ (CX), SI + MOVQ (SI), R8 + MOVQ 24(SI), R9 + MOVQ 32(SI), R10 + MOVBQZX 40(SI), R11 + MOVQ 32(CX), SI + MOVBQZX 8(CX), DI + JMP loop_condition + +main_loop: + // Check if we have room for 4 bytes in the output buffer + LEAQ 4(DX), CX + CMPQ CX, BX + JGE error_max_decoded_size_exeeded + + // Decode 4 values + CMPQ R11, $0x20 + JL bitReader_fillFast_1_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), R12 + MOVQ R11, CX + SHLQ CL, R12 + ORQ R12, R10 + +bitReader_fillFast_1_end: + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + BSWAPL AX + CMPQ R11, $0x20 + JL bitReader_fillFast_2_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), R12 + MOVQ R11, CX + SHLQ CL, R12 + ORQ R12, R10 + +bitReader_fillFast_2_end: + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + BSWAPL AX + + // Store the decoded values + MOVL AX, (DX) + ADDQ $0x04, DX + +loop_condition: + CMPQ R9, $0x08 + JGE main_loop + + // Update ctx structure + MOVQ ctx+0(FP), AX + SUBQ 16(AX), DX + MOVQ DX, 40(AX) + MOVQ (AX), AX + MOVQ R9, 24(AX) + MOVQ R10, 32(AX) + MOVB R11, 40(AX) + RET + + // Report error +error_max_decoded_size_exeeded: + MOVQ ctx+0(FP), AX + MOVQ $-1, CX + MOVQ CX, 40(AX) + RET + +// func decompress1x_main_loop_bmi2(ctx *decompress1xContext) +// Requires: BMI2 +TEXT ·decompress1x_main_loop_bmi2(SB), $0-8 + MOVQ ctx+0(FP), CX + MOVQ 16(CX), DX + MOVQ 24(CX), BX + CMPQ BX, $0x04 + JB error_max_decoded_size_exeeded + LEAQ (DX)(BX*1), BX + MOVQ (CX), SI + MOVQ (SI), R8 + MOVQ 24(SI), R9 + MOVQ 32(SI), R10 + MOVBQZX 40(SI), R11 + MOVQ 32(CX), SI + MOVBQZX 8(CX), DI + JMP loop_condition + +main_loop: + // Check if we have room for 4 bytes in the output buffer + LEAQ 4(DX), CX + CMPQ CX, BX + JGE error_max_decoded_size_exeeded + + // Decode 4 values + CMPQ R11, $0x20 + JL bitReader_fillFast_1_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), CX + SHLXQ R11, CX, CX + ORQ CX, R10 + +bitReader_fillFast_1_end: + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + BSWAPL AX + CMPQ R11, $0x20 + JL bitReader_fillFast_2_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), CX + SHLXQ R11, CX, CX + ORQ CX, R10 + +bitReader_fillFast_2_end: + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + BSWAPL AX + + // Store the decoded values + MOVL AX, (DX) + ADDQ $0x04, DX + +loop_condition: + CMPQ R9, $0x08 + JGE main_loop + + // Update ctx structure + MOVQ ctx+0(FP), AX + SUBQ 16(AX), DX + MOVQ DX, 40(AX) + MOVQ (AX), AX + MOVQ R9, 24(AX) + MOVQ R10, 32(AX) + MOVB R11, 40(AX) + RET + + // Report error +error_max_decoded_size_exeeded: + MOVQ ctx+0(FP), AX + MOVQ $-1, CX + MOVQ CX, 40(AX) + RET diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_generic.go b/vendor/github.com/klauspost/compress/huff0/decompress_generic.go new file mode 100644 index 000000000..4f6f37cb2 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress_generic.go @@ -0,0 +1,295 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +// This file contains a generic implementation of Decoder.Decompress4X. +package huff0 + +import ( + "errors" + "fmt" +) + +// Decompress4X will decompress a 4X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// The *capacity* of the dst slice must match the destination size of +// the uncompressed data exactly. +func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + if len(src) < 6+(4*1) { + return nil, errors.New("input too small") + } + if use8BitTables && d.actualTableLog <= 8 { + return d.decompress4X8bit(dst, src) + } + + var br [4]bitReaderShifted + // Decode "jump table" + start := 6 + for i := 0; i < 3; i++ { + length := int(src[i*2]) | (int(src[i*2+1]) << 8) + if start+length >= len(src) { + return nil, errors.New("truncated input (or invalid offset)") + } + err := br[i].init(src[start : start+length]) + if err != nil { + return nil, err + } + start += length + } + err := br[3].init(src[start:]) + if err != nil { + return nil, err + } + + // destination, offset to match first output + dstSize := cap(dst) + dst = dst[:dstSize] + out := dst + dstEvery := (dstSize + 3) / 4 + + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + single := d.dt.single[:tlSize] + + // Use temp table to avoid bound checks/append penalty. + buf := d.buffer() + var off uint8 + var decoded int + + // Decode 2 values from each decoder/loop. + const bufoff = 256 + for { + if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { + break + } + + { + const stream = 0 + const stream2 = 1 + br[stream].fillFast() + br[stream2].fillFast() + + val := br[stream].peekBitsFast(d.actualTableLog) + val2 := br[stream2].peekBitsFast(d.actualTableLog) + v := single[val&tlMask] + v2 := single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off] = uint8(v.entry >> 8) + buf[stream2][off] = uint8(v2.entry >> 8) + + val = br[stream].peekBitsFast(d.actualTableLog) + val2 = br[stream2].peekBitsFast(d.actualTableLog) + v = single[val&tlMask] + v2 = single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off+1] = uint8(v.entry >> 8) + buf[stream2][off+1] = uint8(v2.entry >> 8) + } + + { + const stream = 2 + const stream2 = 3 + br[stream].fillFast() + br[stream2].fillFast() + + val := br[stream].peekBitsFast(d.actualTableLog) + val2 := br[stream2].peekBitsFast(d.actualTableLog) + v := single[val&tlMask] + v2 := single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off] = uint8(v.entry >> 8) + buf[stream2][off] = uint8(v2.entry >> 8) + + val = br[stream].peekBitsFast(d.actualTableLog) + val2 = br[stream2].peekBitsFast(d.actualTableLog) + v = single[val&tlMask] + v2 = single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off+1] = uint8(v.entry >> 8) + buf[stream2][off+1] = uint8(v2.entry >> 8) + } + + off += 2 + + if off == 0 { + if bufoff > dstEvery { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 1") + } + copy(out, buf[0][:]) + copy(out[dstEvery:], buf[1][:]) + copy(out[dstEvery*2:], buf[2][:]) + copy(out[dstEvery*3:], buf[3][:]) + out = out[bufoff:] + decoded += bufoff * 4 + // There must at least be 3 buffers left. + if len(out) < dstEvery*3 { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 2") + } + } + } + if off > 0 { + ioff := int(off) + if len(out) < dstEvery*3+ioff { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 3") + } + copy(out, buf[0][:off]) + copy(out[dstEvery:], buf[1][:off]) + copy(out[dstEvery*2:], buf[2][:off]) + copy(out[dstEvery*3:], buf[3][:off]) + decoded += int(off) * 4 + out = out[off:] + } + + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) + for i := range br { + offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } + br := &br[i] + bitsLeft := br.remaining() + for bitsLeft > 0 { + br.fill() + if offset >= endsAt { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 4") + } + + // Read value and increment offset. + val := br.peekBitsFast(d.actualTableLog) + v := single[val&tlMask].entry + nBits := uint8(v) + br.advance(nBits) + bitsLeft -= uint(nBits) + out[offset] = uint8(v >> 8) + offset++ + } + if offset != endsAt { + d.bufs.Put(buf) + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + decoded += offset - dstEvery*i + err = br.close() + if err != nil { + return nil, err + } + } + d.bufs.Put(buf) + if dstSize != decoded { + return nil, errors.New("corruption detected: short output block") + } + return dst, nil +} + +// Decompress1X will decompress a 1X encoded stream. +// The cap of the output buffer will be the maximum decompressed size. +// The length of the supplied input must match the end of a block exactly. +func (d *Decoder) Decompress1X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + if use8BitTables && d.actualTableLog <= 8 { + return d.decompress1X8Bit(dst, src) + } + var br bitReaderShifted + err := br.init(src) + if err != nil { + return dst, err + } + maxDecodedSize := cap(dst) + dst = dst[:0] + + // Avoid bounds check by always having full sized table. + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + dt := d.dt.single[:tlSize] + + // Use temp table to avoid bound checks/append penalty. + bufs := d.buffer() + buf := &bufs[0] + var off uint8 + + for br.off >= 8 { + br.fillFast() + v := dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + // Refill + br.fillFast() + + v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + + if len(dst)+int(off) > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:off]...) + + // br < 8, so uint8 is fine + bitsLeft := uint8(br.off)*8 + 64 - br.bitsRead + for bitsLeft > 0 { + br.fill() + if false && br.bitsRead >= 32 { + if br.off >= 4 { + v := br.in[br.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + br.value = (br.value << 32) | uint64(low) + br.bitsRead -= 32 + br.off -= 4 + } else { + for br.off > 0 { + br.value = (br.value << 8) | uint64(br.in[br.off-1]) + br.bitsRead -= 8 + br.off-- + } + } + } + if len(dst) >= maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + v := d.dt.single[br.peekBitsFast(d.actualTableLog)&tlMask] + nBits := uint8(v.entry) + br.advance(nBits) + bitsLeft -= nBits + dst = append(dst, uint8(v.entry>>8)) + } + d.bufs.Put(bufs) + return dst, br.close() +} diff --git a/vendor/github.com/klauspost/compress/huff0/huff0.go b/vendor/github.com/klauspost/compress/huff0/huff0.go index 7ec2022b6..e8ad17ad0 100644 --- a/vendor/github.com/klauspost/compress/huff0/huff0.go +++ b/vendor/github.com/klauspost/compress/huff0/huff0.go @@ -8,6 +8,7 @@ import ( "fmt" "math" "math/bits" + "sync" "github.com/klauspost/compress/fse" ) @@ -116,6 +117,7 @@ type Scratch struct { nodes []nodeElt tmpOut [4][]byte fse *fse.Scratch + decPool sync.Pool // *[4][256]byte buffers. huffWeight [maxSymbolValue + 1]byte } @@ -245,6 +247,68 @@ func (c cTable) write(s *Scratch) error { return nil } +func (c cTable) estTableSize(s *Scratch) (sz int, err error) { + var ( + // precomputed conversion table + bitsToWeight [tableLogMax + 1]byte + huffLog = s.actualTableLog + // last weight is not saved. + maxSymbolValue = uint8(s.symbolLen - 1) + huffWeight = s.huffWeight[:256] + ) + const ( + maxFSETableLog = 6 + ) + // convert to weight + bitsToWeight[0] = 0 + for n := uint8(1); n < huffLog+1; n++ { + bitsToWeight[n] = huffLog + 1 - n + } + + // Acquire histogram for FSE. + hist := s.fse.Histogram() + hist = hist[:256] + for i := range hist[:16] { + hist[i] = 0 + } + for n := uint8(0); n < maxSymbolValue; n++ { + v := bitsToWeight[c[n].nBits] & 15 + huffWeight[n] = v + hist[v]++ + } + + // FSE compress if feasible. + if maxSymbolValue >= 2 { + huffMaxCnt := uint32(0) + huffMax := uint8(0) + for i, v := range hist[:16] { + if v == 0 { + continue + } + huffMax = byte(i) + if v > huffMaxCnt { + huffMaxCnt = v + } + } + s.fse.HistogramFinished(huffMax, int(huffMaxCnt)) + s.fse.TableLog = maxFSETableLog + b, err := fse.Compress(huffWeight[:maxSymbolValue], s.fse) + if err == nil && len(b) < int(s.symbolLen>>1) { + sz += 1 + len(b) + return sz, nil + } + // Unable to compress (RLE/uncompressible) + } + // write raw values as 4-bits (max : 15) + if maxSymbolValue > (256 - 128) { + // should not happen : likely means source cannot be compressed + return 0, ErrIncompressible + } + // special case, pack weights 4 bits/weight. + sz += 1 + int(maxSymbolValue/2) + return sz, nil +} + // estimateSize returns the estimated size in bytes of the input represented in the // histogram supplied. func (c cTable) estimateSize(hist []uint32) int { diff --git a/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go new file mode 100644 index 000000000..3954c5121 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go @@ -0,0 +1,34 @@ +// Package cpuinfo gives runtime info about the current CPU. +// +// This is a very limited module meant for use internally +// in this project. For more versatile solution check +// https://github.com/klauspost/cpuid. +package cpuinfo + +// HasBMI1 checks whether an x86 CPU supports the BMI1 extension. +func HasBMI1() bool { + return hasBMI1 +} + +// HasBMI2 checks whether an x86 CPU supports the BMI2 extension. +func HasBMI2() bool { + return hasBMI2 +} + +// DisableBMI2 will disable BMI2, for testing purposes. +// Call returned function to restore previous state. +func DisableBMI2() func() { + old := hasBMI2 + hasBMI2 = false + return func() { + hasBMI2 = old + } +} + +// HasBMI checks whether an x86 CPU supports both BMI1 and BMI2 extensions. +func HasBMI() bool { + return HasBMI1() && HasBMI2() +} + +var hasBMI1 bool +var hasBMI2 bool diff --git a/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go new file mode 100644 index 000000000..e802579c4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go @@ -0,0 +1,11 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +package cpuinfo + +// go:noescape +func x86extensions() (bmi1, bmi2 bool) + +func init() { + hasBMI1, hasBMI2 = x86extensions() +} diff --git a/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s new file mode 100644 index 000000000..4465fbe9e --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s @@ -0,0 +1,36 @@ +// +build !appengine +// +build gc +// +build !noasm + +#include "textflag.h" +#include "funcdata.h" +#include "go_asm.h" + +TEXT ·x86extensions(SB), NOSPLIT, $0 + // 1. determine max EAX value + XORQ AX, AX + CPUID + + CMPQ AX, $7 + JB unsupported + + // 2. EAX = 7, ECX = 0 --- see Table 3-8 "Information Returned by CPUID Instruction" + MOVQ $7, AX + MOVQ $0, CX + CPUID + + BTQ $3, BX // bit 3 = BMI1 + SETCS AL + + BTQ $8, BX // bit 8 = BMI2 + SETCS AH + + MOVB AL, bmi1+0(FP) + MOVB AH, bmi2+1(FP) + RET + +unsupported: + XORQ AX, AX + MOVB AL, bmi1+0(FP) + MOVB AL, bmi2+1(FP) + RET diff --git a/vendor/github.com/klauspost/compress/snappy/LICENSE b/vendor/github.com/klauspost/compress/internal/snapref/LICENSE similarity index 100% rename from vendor/github.com/klauspost/compress/snappy/LICENSE rename to vendor/github.com/klauspost/compress/internal/snapref/LICENSE diff --git a/vendor/github.com/klauspost/compress/snappy/decode.go b/vendor/github.com/klauspost/compress/internal/snapref/decode.go similarity index 85% rename from vendor/github.com/klauspost/compress/snappy/decode.go rename to vendor/github.com/klauspost/compress/internal/snapref/decode.go index 72efb0353..40796a49d 100644 --- a/vendor/github.com/klauspost/compress/snappy/decode.go +++ b/vendor/github.com/klauspost/compress/internal/snapref/decode.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package snappy +package snapref import ( "encoding/binary" @@ -52,6 +52,8 @@ const ( // Otherwise, a newly allocated slice will be returned. // // The dst and src must not overlap. It is valid to pass a nil dst. +// +// Decode handles the Snappy block format, not the Snappy stream format. func Decode(dst, src []byte) ([]byte, error) { dLen, s, err := decodedLen(src) if err != nil { @@ -83,6 +85,8 @@ func NewReader(r io.Reader) *Reader { } // Reader is an io.Reader that can read Snappy-compressed bytes. +// +// Reader handles the Snappy stream format, not the Snappy block format. type Reader struct { r io.Reader err error @@ -114,32 +118,23 @@ func (r *Reader) readFull(p []byte, allowEOF bool) (ok bool) { return true } -// Read satisfies the io.Reader interface. -func (r *Reader) Read(p []byte) (int, error) { - if r.err != nil { - return 0, r.err - } - for { - if r.i < r.j { - n := copy(p, r.decoded[r.i:r.j]) - r.i += n - return n, nil - } +func (r *Reader) fill() error { + for r.i >= r.j { if !r.readFull(r.buf[:4], true) { - return 0, r.err + return r.err } chunkType := r.buf[0] if !r.readHeader { if chunkType != chunkTypeStreamIdentifier { r.err = ErrCorrupt - return 0, r.err + return r.err } r.readHeader = true } chunkLen := int(r.buf[1]) | int(r.buf[2])<<8 | int(r.buf[3])<<16 if chunkLen > len(r.buf) { r.err = ErrUnsupported - return 0, r.err + return r.err } // The chunk types are specified at @@ -149,11 +144,11 @@ func (r *Reader) Read(p []byte) (int, error) { // Section 4.2. Compressed data (chunk type 0x00). if chunkLen < checksumSize { r.err = ErrCorrupt - return 0, r.err + return r.err } buf := r.buf[:chunkLen] if !r.readFull(buf, false) { - return 0, r.err + return r.err } checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 buf = buf[checksumSize:] @@ -161,19 +156,19 @@ func (r *Reader) Read(p []byte) (int, error) { n, err := DecodedLen(buf) if err != nil { r.err = err - return 0, r.err + return r.err } if n > len(r.decoded) { r.err = ErrCorrupt - return 0, r.err + return r.err } if _, err := Decode(r.decoded, buf); err != nil { r.err = err - return 0, r.err + return r.err } if crc(r.decoded[:n]) != checksum { r.err = ErrCorrupt - return 0, r.err + return r.err } r.i, r.j = 0, n continue @@ -182,25 +177,25 @@ func (r *Reader) Read(p []byte) (int, error) { // Section 4.3. Uncompressed data (chunk type 0x01). if chunkLen < checksumSize { r.err = ErrCorrupt - return 0, r.err + return r.err } buf := r.buf[:checksumSize] if !r.readFull(buf, false) { - return 0, r.err + return r.err } checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 // Read directly into r.decoded instead of via r.buf. n := chunkLen - checksumSize if n > len(r.decoded) { r.err = ErrCorrupt - return 0, r.err + return r.err } if !r.readFull(r.decoded[:n], false) { - return 0, r.err + return r.err } if crc(r.decoded[:n]) != checksum { r.err = ErrCorrupt - return 0, r.err + return r.err } r.i, r.j = 0, n continue @@ -209,15 +204,15 @@ func (r *Reader) Read(p []byte) (int, error) { // Section 4.1. Stream identifier (chunk type 0xff). if chunkLen != len(magicBody) { r.err = ErrCorrupt - return 0, r.err + return r.err } if !r.readFull(r.buf[:len(magicBody)], false) { - return 0, r.err + return r.err } for i := 0; i < len(magicBody); i++ { if r.buf[i] != magicBody[i] { r.err = ErrCorrupt - return 0, r.err + return r.err } } continue @@ -226,12 +221,44 @@ func (r *Reader) Read(p []byte) (int, error) { if chunkType <= 0x7f { // Section 4.5. Reserved unskippable chunks (chunk types 0x02-0x7f). r.err = ErrUnsupported - return 0, r.err + return r.err } // Section 4.4 Padding (chunk type 0xfe). // Section 4.6. Reserved skippable chunks (chunk types 0x80-0xfd). if !r.readFull(r.buf[:chunkLen], false) { - return 0, r.err + return r.err } } + + return nil +} + +// Read satisfies the io.Reader interface. +func (r *Reader) Read(p []byte) (int, error) { + if r.err != nil { + return 0, r.err + } + + if err := r.fill(); err != nil { + return 0, err + } + + n := copy(p, r.decoded[r.i:r.j]) + r.i += n + return n, nil +} + +// ReadByte satisfies the io.ByteReader interface. +func (r *Reader) ReadByte() (byte, error) { + if r.err != nil { + return 0, r.err + } + + if err := r.fill(); err != nil { + return 0, err + } + + c := r.decoded[r.i] + r.i++ + return c, nil } diff --git a/vendor/github.com/klauspost/compress/snappy/decode_other.go b/vendor/github.com/klauspost/compress/internal/snapref/decode_other.go similarity index 97% rename from vendor/github.com/klauspost/compress/snappy/decode_other.go rename to vendor/github.com/klauspost/compress/internal/snapref/decode_other.go index 94a96c5d7..77395a6b8 100644 --- a/vendor/github.com/klauspost/compress/snappy/decode_other.go +++ b/vendor/github.com/klauspost/compress/internal/snapref/decode_other.go @@ -2,9 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build !amd64 appengine !gc noasm - -package snappy +package snapref // decode writes the decoding of src to dst. It assumes that the varint-encoded // length of the decompressed bytes has already been read, and that len(dst) @@ -87,7 +85,7 @@ func decode(dst, src []byte) int { } // Copy from an earlier sub-slice of dst to a later sub-slice. // If no overlap, use the built-in copy: - if offset > length { + if offset >= length { copy(dst[d:d+length], dst[d-offset:]) d += length continue diff --git a/vendor/github.com/klauspost/compress/snappy/encode.go b/vendor/github.com/klauspost/compress/internal/snapref/encode.go similarity index 98% rename from vendor/github.com/klauspost/compress/snappy/encode.go rename to vendor/github.com/klauspost/compress/internal/snapref/encode.go index 8d393e904..13c6040a5 100644 --- a/vendor/github.com/klauspost/compress/snappy/encode.go +++ b/vendor/github.com/klauspost/compress/internal/snapref/encode.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package snappy +package snapref import ( "encoding/binary" @@ -15,6 +15,8 @@ import ( // Otherwise, a newly allocated slice will be returned. // // The dst and src must not overlap. It is valid to pass a nil dst. +// +// Encode handles the Snappy block format, not the Snappy stream format. func Encode(dst, src []byte) []byte { if n := MaxEncodedLen(len(src)); n < 0 { panic(ErrTooLarge) @@ -139,6 +141,8 @@ func NewBufferedWriter(w io.Writer) *Writer { } // Writer is an io.Writer that can write Snappy-compressed bytes. +// +// Writer handles the Snappy stream format, not the Snappy block format. type Writer struct { w io.Writer err error diff --git a/vendor/github.com/klauspost/compress/snappy/encode_other.go b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go similarity index 99% rename from vendor/github.com/klauspost/compress/snappy/encode_other.go rename to vendor/github.com/klauspost/compress/internal/snapref/encode_other.go index dbcae905e..511bba65d 100644 --- a/vendor/github.com/klauspost/compress/snappy/encode_other.go +++ b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go @@ -2,9 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build !amd64 appengine !gc noasm - -package snappy +package snapref func load32(b []byte, i int) uint32 { b = b[i : i+4 : len(b)] // Help the compiler eliminate bounds checks on the next line. diff --git a/vendor/github.com/klauspost/compress/snappy/snappy.go b/vendor/github.com/klauspost/compress/internal/snapref/snappy.go similarity index 96% rename from vendor/github.com/klauspost/compress/snappy/snappy.go rename to vendor/github.com/klauspost/compress/internal/snapref/snappy.go index ea58ced88..34d01f4aa 100644 --- a/vendor/github.com/klauspost/compress/snappy/snappy.go +++ b/vendor/github.com/klauspost/compress/internal/snapref/snappy.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package snappy implements the Snappy compression format. It aims for very +// Package snapref implements the Snappy compression format. It aims for very // high speeds and reasonable compression. // // There are actually two Snappy formats: block and stream. They are related, @@ -17,7 +17,7 @@ // // The canonical, C++ implementation is at https://github.com/google/snappy and // it only implements the block format. -package snappy +package snapref import ( "hash/crc32" @@ -94,5 +94,5 @@ var crcTable = crc32.MakeTable(crc32.Castagnoli) // https://github.com/google/snappy/blob/master/framing_format.txt func crc(b []byte) uint32 { c := crc32.Update(0, crcTable, b) - return c>>15 | c<<17 + 0xa282ead8 + return uint32(c>>15|c<<17) + 0xa282ead8 } diff --git a/vendor/github.com/klauspost/compress/s2sx.mod b/vendor/github.com/klauspost/compress/s2sx.mod new file mode 100644 index 000000000..2263853fc --- /dev/null +++ b/vendor/github.com/klauspost/compress/s2sx.mod @@ -0,0 +1,4 @@ +module github.com/klauspost/compress + +go 1.16 + diff --git a/vendor/github.com/klauspost/compress/s2sx.sum b/vendor/github.com/klauspost/compress/s2sx.sum new file mode 100644 index 000000000..e69de29bb diff --git a/vendor/github.com/klauspost/compress/snappy/.gitignore b/vendor/github.com/klauspost/compress/snappy/.gitignore deleted file mode 100644 index 042091d9b..000000000 --- a/vendor/github.com/klauspost/compress/snappy/.gitignore +++ /dev/null @@ -1,16 +0,0 @@ -cmd/snappytool/snappytool -testdata/bench - -# These explicitly listed benchmark data files are for an obsolete version of -# snappy_test.go. -testdata/alice29.txt -testdata/asyoulik.txt -testdata/fireworks.jpeg -testdata/geo.protodata -testdata/html -testdata/html_x_4 -testdata/kppkn.gtb -testdata/lcet10.txt -testdata/paper-100k.pdf -testdata/plrabn12.txt -testdata/urls.10K diff --git a/vendor/github.com/klauspost/compress/snappy/AUTHORS b/vendor/github.com/klauspost/compress/snappy/AUTHORS deleted file mode 100644 index bcfa19520..000000000 --- a/vendor/github.com/klauspost/compress/snappy/AUTHORS +++ /dev/null @@ -1,15 +0,0 @@ -# This is the official list of Snappy-Go authors for copyright purposes. -# This file is distinct from the CONTRIBUTORS files. -# See the latter for an explanation. - -# Names should be added to this file as -# Name or Organization -# The email address is not required for organizations. - -# Please keep the list sorted. - -Damian Gryski -Google Inc. -Jan Mercl <0xjnml@gmail.com> -Rodolfo Carvalho -Sebastien Binet diff --git a/vendor/github.com/klauspost/compress/snappy/CONTRIBUTORS b/vendor/github.com/klauspost/compress/snappy/CONTRIBUTORS deleted file mode 100644 index 931ae3160..000000000 --- a/vendor/github.com/klauspost/compress/snappy/CONTRIBUTORS +++ /dev/null @@ -1,37 +0,0 @@ -# This is the official list of people who can contribute -# (and typically have contributed) code to the Snappy-Go repository. -# The AUTHORS file lists the copyright holders; this file -# lists people. For example, Google employees are listed here -# but not in AUTHORS, because Google holds the copyright. -# -# The submission process automatically checks to make sure -# that people submitting code are listed in this file (by email address). -# -# Names should be added to this file only after verifying that -# the individual or the individual's organization has agreed to -# the appropriate Contributor License Agreement, found here: -# -# http://code.google.com/legal/individual-cla-v1.0.html -# http://code.google.com/legal/corporate-cla-v1.0.html -# -# The agreement for individuals can be filled out on the web. -# -# When adding J Random Contributor's name to this file, -# either J's name or J's organization's name should be -# added to the AUTHORS file, depending on whether the -# individual or corporate CLA was used. - -# Names should be added to this file like so: -# Name - -# Please keep the list sorted. - -Damian Gryski -Jan Mercl <0xjnml@gmail.com> -Kai Backman -Marc-Antoine Ruel -Nigel Tao -Rob Pike -Rodolfo Carvalho -Russ Cox -Sebastien Binet diff --git a/vendor/github.com/klauspost/compress/snappy/README b/vendor/github.com/klauspost/compress/snappy/README deleted file mode 100644 index cea12879a..000000000 --- a/vendor/github.com/klauspost/compress/snappy/README +++ /dev/null @@ -1,107 +0,0 @@ -The Snappy compression format in the Go programming language. - -To download and install from source: -$ go get github.com/golang/snappy - -Unless otherwise noted, the Snappy-Go source files are distributed -under the BSD-style license found in the LICENSE file. - - - -Benchmarks. - -The golang/snappy benchmarks include compressing (Z) and decompressing (U) ten -or so files, the same set used by the C++ Snappy code (github.com/google/snappy -and note the "google", not "golang"). On an "Intel(R) Core(TM) i7-3770 CPU @ -3.40GHz", Go's GOARCH=amd64 numbers as of 2016-05-29: - -"go test -test.bench=." - -_UFlat0-8 2.19GB/s ± 0% html -_UFlat1-8 1.41GB/s ± 0% urls -_UFlat2-8 23.5GB/s ± 2% jpg -_UFlat3-8 1.91GB/s ± 0% jpg_200 -_UFlat4-8 14.0GB/s ± 1% pdf -_UFlat5-8 1.97GB/s ± 0% html4 -_UFlat6-8 814MB/s ± 0% txt1 -_UFlat7-8 785MB/s ± 0% txt2 -_UFlat8-8 857MB/s ± 0% txt3 -_UFlat9-8 719MB/s ± 1% txt4 -_UFlat10-8 2.84GB/s ± 0% pb -_UFlat11-8 1.05GB/s ± 0% gaviota - -_ZFlat0-8 1.04GB/s ± 0% html -_ZFlat1-8 534MB/s ± 0% urls -_ZFlat2-8 15.7GB/s ± 1% jpg -_ZFlat3-8 740MB/s ± 3% jpg_200 -_ZFlat4-8 9.20GB/s ± 1% pdf -_ZFlat5-8 991MB/s ± 0% html4 -_ZFlat6-8 379MB/s ± 0% txt1 -_ZFlat7-8 352MB/s ± 0% txt2 -_ZFlat8-8 396MB/s ± 1% txt3 -_ZFlat9-8 327MB/s ± 1% txt4 -_ZFlat10-8 1.33GB/s ± 1% pb -_ZFlat11-8 605MB/s ± 1% gaviota - - - -"go test -test.bench=. -tags=noasm" - -_UFlat0-8 621MB/s ± 2% html -_UFlat1-8 494MB/s ± 1% urls -_UFlat2-8 23.2GB/s ± 1% jpg -_UFlat3-8 1.12GB/s ± 1% jpg_200 -_UFlat4-8 4.35GB/s ± 1% pdf -_UFlat5-8 609MB/s ± 0% html4 -_UFlat6-8 296MB/s ± 0% txt1 -_UFlat7-8 288MB/s ± 0% txt2 -_UFlat8-8 309MB/s ± 1% txt3 -_UFlat9-8 280MB/s ± 1% txt4 -_UFlat10-8 753MB/s ± 0% pb -_UFlat11-8 400MB/s ± 0% gaviota - -_ZFlat0-8 409MB/s ± 1% html -_ZFlat1-8 250MB/s ± 1% urls -_ZFlat2-8 12.3GB/s ± 1% jpg -_ZFlat3-8 132MB/s ± 0% jpg_200 -_ZFlat4-8 2.92GB/s ± 0% pdf -_ZFlat5-8 405MB/s ± 1% html4 -_ZFlat6-8 179MB/s ± 1% txt1 -_ZFlat7-8 170MB/s ± 1% txt2 -_ZFlat8-8 189MB/s ± 1% txt3 -_ZFlat9-8 164MB/s ± 1% txt4 -_ZFlat10-8 479MB/s ± 1% pb -_ZFlat11-8 270MB/s ± 1% gaviota - - - -For comparison (Go's encoded output is byte-for-byte identical to C++'s), here -are the numbers from C++ Snappy's - -make CXXFLAGS="-O2 -DNDEBUG -g" clean snappy_unittest.log && cat snappy_unittest.log - -BM_UFlat/0 2.4GB/s html -BM_UFlat/1 1.4GB/s urls -BM_UFlat/2 21.8GB/s jpg -BM_UFlat/3 1.5GB/s jpg_200 -BM_UFlat/4 13.3GB/s pdf -BM_UFlat/5 2.1GB/s html4 -BM_UFlat/6 1.0GB/s txt1 -BM_UFlat/7 959.4MB/s txt2 -BM_UFlat/8 1.0GB/s txt3 -BM_UFlat/9 864.5MB/s txt4 -BM_UFlat/10 2.9GB/s pb -BM_UFlat/11 1.2GB/s gaviota - -BM_ZFlat/0 944.3MB/s html (22.31 %) -BM_ZFlat/1 501.6MB/s urls (47.78 %) -BM_ZFlat/2 14.3GB/s jpg (99.95 %) -BM_ZFlat/3 538.3MB/s jpg_200 (73.00 %) -BM_ZFlat/4 8.3GB/s pdf (83.30 %) -BM_ZFlat/5 903.5MB/s html4 (22.52 %) -BM_ZFlat/6 336.0MB/s txt1 (57.88 %) -BM_ZFlat/7 312.3MB/s txt2 (61.91 %) -BM_ZFlat/8 353.1MB/s txt3 (54.99 %) -BM_ZFlat/9 289.9MB/s txt4 (66.26 %) -BM_ZFlat/10 1.2GB/s pb (19.68 %) -BM_ZFlat/11 527.4MB/s gaviota (37.72 %) diff --git a/vendor/github.com/klauspost/compress/snappy/decode_amd64.go b/vendor/github.com/klauspost/compress/snappy/decode_amd64.go deleted file mode 100644 index fcd192b84..000000000 --- a/vendor/github.com/klauspost/compress/snappy/decode_amd64.go +++ /dev/null @@ -1,14 +0,0 @@ -// Copyright 2016 The Snappy-Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build !appengine -// +build gc -// +build !noasm - -package snappy - -// decode has the same semantics as in decode_other.go. -// -//go:noescape -func decode(dst, src []byte) int diff --git a/vendor/github.com/klauspost/compress/snappy/decode_amd64.s b/vendor/github.com/klauspost/compress/snappy/decode_amd64.s deleted file mode 100644 index 1c66e3723..000000000 --- a/vendor/github.com/klauspost/compress/snappy/decode_amd64.s +++ /dev/null @@ -1,482 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build !appengine -// +build gc -// +build !noasm - -#include "textflag.h" - -// The asm code generally follows the pure Go code in decode_other.go, except -// where marked with a "!!!". - -// func decode(dst, src []byte) int -// -// All local variables fit into registers. The non-zero stack size is only to -// spill registers and push args when issuing a CALL. The register allocation: -// - AX scratch -// - BX scratch -// - CX length or x -// - DX offset -// - SI &src[s] -// - DI &dst[d] -// + R8 dst_base -// + R9 dst_len -// + R10 dst_base + dst_len -// + R11 src_base -// + R12 src_len -// + R13 src_base + src_len -// - R14 used by doCopy -// - R15 used by doCopy -// -// The registers R8-R13 (marked with a "+") are set at the start of the -// function, and after a CALL returns, and are not otherwise modified. -// -// The d variable is implicitly DI - R8, and len(dst)-d is R10 - DI. -// The s variable is implicitly SI - R11, and len(src)-s is R13 - SI. -TEXT ·decode(SB), NOSPLIT, $48-56 - // Initialize SI, DI and R8-R13. - MOVQ dst_base+0(FP), R8 - MOVQ dst_len+8(FP), R9 - MOVQ R8, DI - MOVQ R8, R10 - ADDQ R9, R10 - MOVQ src_base+24(FP), R11 - MOVQ src_len+32(FP), R12 - MOVQ R11, SI - MOVQ R11, R13 - ADDQ R12, R13 - -loop: - // for s < len(src) - CMPQ SI, R13 - JEQ end - - // CX = uint32(src[s]) - // - // switch src[s] & 0x03 - MOVBLZX (SI), CX - MOVL CX, BX - ANDL $3, BX - CMPL BX, $1 - JAE tagCopy - - // ---------------------------------------- - // The code below handles literal tags. - - // case tagLiteral: - // x := uint32(src[s] >> 2) - // switch - SHRL $2, CX - CMPL CX, $60 - JAE tagLit60Plus - - // case x < 60: - // s++ - INCQ SI - -doLit: - // This is the end of the inner "switch", when we have a literal tag. - // - // We assume that CX == x and x fits in a uint32, where x is the variable - // used in the pure Go decode_other.go code. - - // length = int(x) + 1 - // - // Unlike the pure Go code, we don't need to check if length <= 0 because - // CX can hold 64 bits, so the increment cannot overflow. - INCQ CX - - // Prepare to check if copying length bytes will run past the end of dst or - // src. - // - // AX = len(dst) - d - // BX = len(src) - s - MOVQ R10, AX - SUBQ DI, AX - MOVQ R13, BX - SUBQ SI, BX - - // !!! Try a faster technique for short (16 or fewer bytes) copies. - // - // if length > 16 || len(dst)-d < 16 || len(src)-s < 16 { - // goto callMemmove // Fall back on calling runtime·memmove. - // } - // - // The C++ snappy code calls this TryFastAppend. It also checks len(src)-s - // against 21 instead of 16, because it cannot assume that all of its input - // is contiguous in memory and so it needs to leave enough source bytes to - // read the next tag without refilling buffers, but Go's Decode assumes - // contiguousness (the src argument is a []byte). - CMPQ CX, $16 - JGT callMemmove - CMPQ AX, $16 - JLT callMemmove - CMPQ BX, $16 - JLT callMemmove - - // !!! Implement the copy from src to dst as a 16-byte load and store. - // (Decode's documentation says that dst and src must not overlap.) - // - // This always copies 16 bytes, instead of only length bytes, but that's - // OK. If the input is a valid Snappy encoding then subsequent iterations - // will fix up the overrun. Otherwise, Decode returns a nil []byte (and a - // non-nil error), so the overrun will be ignored. - // - // Note that on amd64, it is legal and cheap to issue unaligned 8-byte or - // 16-byte loads and stores. This technique probably wouldn't be as - // effective on architectures that are fussier about alignment. - MOVOU 0(SI), X0 - MOVOU X0, 0(DI) - - // d += length - // s += length - ADDQ CX, DI - ADDQ CX, SI - JMP loop - -callMemmove: - // if length > len(dst)-d || length > len(src)-s { etc } - CMPQ CX, AX - JGT errCorrupt - CMPQ CX, BX - JGT errCorrupt - - // copy(dst[d:], src[s:s+length]) - // - // This means calling runtime·memmove(&dst[d], &src[s], length), so we push - // DI, SI and CX as arguments. Coincidentally, we also need to spill those - // three registers to the stack, to save local variables across the CALL. - MOVQ DI, 0(SP) - MOVQ SI, 8(SP) - MOVQ CX, 16(SP) - MOVQ DI, 24(SP) - MOVQ SI, 32(SP) - MOVQ CX, 40(SP) - CALL runtime·memmove(SB) - - // Restore local variables: unspill registers from the stack and - // re-calculate R8-R13. - MOVQ 24(SP), DI - MOVQ 32(SP), SI - MOVQ 40(SP), CX - MOVQ dst_base+0(FP), R8 - MOVQ dst_len+8(FP), R9 - MOVQ R8, R10 - ADDQ R9, R10 - MOVQ src_base+24(FP), R11 - MOVQ src_len+32(FP), R12 - MOVQ R11, R13 - ADDQ R12, R13 - - // d += length - // s += length - ADDQ CX, DI - ADDQ CX, SI - JMP loop - -tagLit60Plus: - // !!! This fragment does the - // - // s += x - 58; if uint(s) > uint(len(src)) { etc } - // - // checks. In the asm version, we code it once instead of once per switch case. - ADDQ CX, SI - SUBQ $58, SI - CMPQ SI, R13 - JA errCorrupt - - // case x == 60: - CMPL CX, $61 - JEQ tagLit61 - JA tagLit62Plus - - // x = uint32(src[s-1]) - MOVBLZX -1(SI), CX - JMP doLit - -tagLit61: - // case x == 61: - // x = uint32(src[s-2]) | uint32(src[s-1])<<8 - MOVWLZX -2(SI), CX - JMP doLit - -tagLit62Plus: - CMPL CX, $62 - JA tagLit63 - - // case x == 62: - // x = uint32(src[s-3]) | uint32(src[s-2])<<8 | uint32(src[s-1])<<16 - MOVWLZX -3(SI), CX - MOVBLZX -1(SI), BX - SHLL $16, BX - ORL BX, CX - JMP doLit - -tagLit63: - // case x == 63: - // x = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24 - MOVL -4(SI), CX - JMP doLit - -// The code above handles literal tags. -// ---------------------------------------- -// The code below handles copy tags. - -tagCopy4: - // case tagCopy4: - // s += 5 - ADDQ $5, SI - - // if uint(s) > uint(len(src)) { etc } - CMPQ SI, R13 - JA errCorrupt - - // length = 1 + int(src[s-5])>>2 - SHRQ $2, CX - INCQ CX - - // offset = int(uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24) - MOVLQZX -4(SI), DX - JMP doCopy - -tagCopy2: - // case tagCopy2: - // s += 3 - ADDQ $3, SI - - // if uint(s) > uint(len(src)) { etc } - CMPQ SI, R13 - JA errCorrupt - - // length = 1 + int(src[s-3])>>2 - SHRQ $2, CX - INCQ CX - - // offset = int(uint32(src[s-2]) | uint32(src[s-1])<<8) - MOVWQZX -2(SI), DX - JMP doCopy - -tagCopy: - // We have a copy tag. We assume that: - // - BX == src[s] & 0x03 - // - CX == src[s] - CMPQ BX, $2 - JEQ tagCopy2 - JA tagCopy4 - - // case tagCopy1: - // s += 2 - ADDQ $2, SI - - // if uint(s) > uint(len(src)) { etc } - CMPQ SI, R13 - JA errCorrupt - - // offset = int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1])) - MOVQ CX, DX - ANDQ $0xe0, DX - SHLQ $3, DX - MOVBQZX -1(SI), BX - ORQ BX, DX - - // length = 4 + int(src[s-2])>>2&0x7 - SHRQ $2, CX - ANDQ $7, CX - ADDQ $4, CX - -doCopy: - // This is the end of the outer "switch", when we have a copy tag. - // - // We assume that: - // - CX == length && CX > 0 - // - DX == offset - - // if offset <= 0 { etc } - CMPQ DX, $0 - JLE errCorrupt - - // if d < offset { etc } - MOVQ DI, BX - SUBQ R8, BX - CMPQ BX, DX - JLT errCorrupt - - // if length > len(dst)-d { etc } - MOVQ R10, BX - SUBQ DI, BX - CMPQ CX, BX - JGT errCorrupt - - // forwardCopy(dst[d:d+length], dst[d-offset:]); d += length - // - // Set: - // - R14 = len(dst)-d - // - R15 = &dst[d-offset] - MOVQ R10, R14 - SUBQ DI, R14 - MOVQ DI, R15 - SUBQ DX, R15 - - // !!! Try a faster technique for short (16 or fewer bytes) forward copies. - // - // First, try using two 8-byte load/stores, similar to the doLit technique - // above. Even if dst[d:d+length] and dst[d-offset:] can overlap, this is - // still OK if offset >= 8. Note that this has to be two 8-byte load/stores - // and not one 16-byte load/store, and the first store has to be before the - // second load, due to the overlap if offset is in the range [8, 16). - // - // if length > 16 || offset < 8 || len(dst)-d < 16 { - // goto slowForwardCopy - // } - // copy 16 bytes - // d += length - CMPQ CX, $16 - JGT slowForwardCopy - CMPQ DX, $8 - JLT slowForwardCopy - CMPQ R14, $16 - JLT slowForwardCopy - MOVQ 0(R15), AX - MOVQ AX, 0(DI) - MOVQ 8(R15), BX - MOVQ BX, 8(DI) - ADDQ CX, DI - JMP loop - -slowForwardCopy: - // !!! If the forward copy is longer than 16 bytes, or if offset < 8, we - // can still try 8-byte load stores, provided we can overrun up to 10 extra - // bytes. As above, the overrun will be fixed up by subsequent iterations - // of the outermost loop. - // - // The C++ snappy code calls this technique IncrementalCopyFastPath. Its - // commentary says: - // - // ---- - // - // The main part of this loop is a simple copy of eight bytes at a time - // until we've copied (at least) the requested amount of bytes. However, - // if d and d-offset are less than eight bytes apart (indicating a - // repeating pattern of length < 8), we first need to expand the pattern in - // order to get the correct results. For instance, if the buffer looks like - // this, with the eight-byte and patterns marked as - // intervals: - // - // abxxxxxxxxxxxx - // [------] d-offset - // [------] d - // - // a single eight-byte copy from to will repeat the pattern - // once, after which we can move two bytes without moving : - // - // ababxxxxxxxxxx - // [------] d-offset - // [------] d - // - // and repeat the exercise until the two no longer overlap. - // - // This allows us to do very well in the special case of one single byte - // repeated many times, without taking a big hit for more general cases. - // - // The worst case of extra writing past the end of the match occurs when - // offset == 1 and length == 1; the last copy will read from byte positions - // [0..7] and write to [4..11], whereas it was only supposed to write to - // position 1. Thus, ten excess bytes. - // - // ---- - // - // That "10 byte overrun" worst case is confirmed by Go's - // TestSlowForwardCopyOverrun, which also tests the fixUpSlowForwardCopy - // and finishSlowForwardCopy algorithm. - // - // if length > len(dst)-d-10 { - // goto verySlowForwardCopy - // } - SUBQ $10, R14 - CMPQ CX, R14 - JGT verySlowForwardCopy - -makeOffsetAtLeast8: - // !!! As above, expand the pattern so that offset >= 8 and we can use - // 8-byte load/stores. - // - // for offset < 8 { - // copy 8 bytes from dst[d-offset:] to dst[d:] - // length -= offset - // d += offset - // offset += offset - // // The two previous lines together means that d-offset, and therefore - // // R15, is unchanged. - // } - CMPQ DX, $8 - JGE fixUpSlowForwardCopy - MOVQ (R15), BX - MOVQ BX, (DI) - SUBQ DX, CX - ADDQ DX, DI - ADDQ DX, DX - JMP makeOffsetAtLeast8 - -fixUpSlowForwardCopy: - // !!! Add length (which might be negative now) to d (implied by DI being - // &dst[d]) so that d ends up at the right place when we jump back to the - // top of the loop. Before we do that, though, we save DI to AX so that, if - // length is positive, copying the remaining length bytes will write to the - // right place. - MOVQ DI, AX - ADDQ CX, DI - -finishSlowForwardCopy: - // !!! Repeat 8-byte load/stores until length <= 0. Ending with a negative - // length means that we overrun, but as above, that will be fixed up by - // subsequent iterations of the outermost loop. - CMPQ CX, $0 - JLE loop - MOVQ (R15), BX - MOVQ BX, (AX) - ADDQ $8, R15 - ADDQ $8, AX - SUBQ $8, CX - JMP finishSlowForwardCopy - -verySlowForwardCopy: - // verySlowForwardCopy is a simple implementation of forward copy. In C - // parlance, this is a do/while loop instead of a while loop, since we know - // that length > 0. In Go syntax: - // - // for { - // dst[d] = dst[d - offset] - // d++ - // length-- - // if length == 0 { - // break - // } - // } - MOVB (R15), BX - MOVB BX, (DI) - INCQ R15 - INCQ DI - DECQ CX - JNZ verySlowForwardCopy - JMP loop - -// The code above handles copy tags. -// ---------------------------------------- - -end: - // This is the end of the "for s < len(src)". - // - // if d != len(dst) { etc } - CMPQ DI, R10 - JNE errCorrupt - - // return 0 - MOVQ $0, ret+48(FP) - RET - -errCorrupt: - // return decodeErrCodeCorrupt - MOVQ $1, ret+48(FP) - RET diff --git a/vendor/github.com/klauspost/compress/snappy/encode_amd64.go b/vendor/github.com/klauspost/compress/snappy/encode_amd64.go deleted file mode 100644 index 150d91bc8..000000000 --- a/vendor/github.com/klauspost/compress/snappy/encode_amd64.go +++ /dev/null @@ -1,29 +0,0 @@ -// Copyright 2016 The Snappy-Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build !appengine -// +build gc -// +build !noasm - -package snappy - -// emitLiteral has the same semantics as in encode_other.go. -// -//go:noescape -func emitLiteral(dst, lit []byte) int - -// emitCopy has the same semantics as in encode_other.go. -// -//go:noescape -func emitCopy(dst []byte, offset, length int) int - -// extendMatch has the same semantics as in encode_other.go. -// -//go:noescape -func extendMatch(src []byte, i, j int) int - -// encodeBlock has the same semantics as in encode_other.go. -// -//go:noescape -func encodeBlock(dst, src []byte) (d int) diff --git a/vendor/github.com/klauspost/compress/snappy/encode_amd64.s b/vendor/github.com/klauspost/compress/snappy/encode_amd64.s deleted file mode 100644 index adfd979fe..000000000 --- a/vendor/github.com/klauspost/compress/snappy/encode_amd64.s +++ /dev/null @@ -1,730 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build !appengine -// +build gc -// +build !noasm - -#include "textflag.h" - -// The XXX lines assemble on Go 1.4, 1.5 and 1.7, but not 1.6, due to a -// Go toolchain regression. See https://github.com/golang/go/issues/15426 and -// https://github.com/golang/snappy/issues/29 -// -// As a workaround, the package was built with a known good assembler, and -// those instructions were disassembled by "objdump -d" to yield the -// 4e 0f b7 7c 5c 78 movzwq 0x78(%rsp,%r11,2),%r15 -// style comments, in AT&T asm syntax. Note that rsp here is a physical -// register, not Go/asm's SP pseudo-register (see https://golang.org/doc/asm). -// The instructions were then encoded as "BYTE $0x.." sequences, which assemble -// fine on Go 1.6. - -// The asm code generally follows the pure Go code in encode_other.go, except -// where marked with a "!!!". - -// ---------------------------------------------------------------------------- - -// func emitLiteral(dst, lit []byte) int -// -// All local variables fit into registers. The register allocation: -// - AX len(lit) -// - BX n -// - DX return value -// - DI &dst[i] -// - R10 &lit[0] -// -// The 24 bytes of stack space is to call runtime·memmove. -// -// The unusual register allocation of local variables, such as R10 for the -// source pointer, matches the allocation used at the call site in encodeBlock, -// which makes it easier to manually inline this function. -TEXT ·emitLiteral(SB), NOSPLIT, $24-56 - MOVQ dst_base+0(FP), DI - MOVQ lit_base+24(FP), R10 - MOVQ lit_len+32(FP), AX - MOVQ AX, DX - MOVL AX, BX - SUBL $1, BX - - CMPL BX, $60 - JLT oneByte - CMPL BX, $256 - JLT twoBytes - -threeBytes: - MOVB $0xf4, 0(DI) - MOVW BX, 1(DI) - ADDQ $3, DI - ADDQ $3, DX - JMP memmove - -twoBytes: - MOVB $0xf0, 0(DI) - MOVB BX, 1(DI) - ADDQ $2, DI - ADDQ $2, DX - JMP memmove - -oneByte: - SHLB $2, BX - MOVB BX, 0(DI) - ADDQ $1, DI - ADDQ $1, DX - -memmove: - MOVQ DX, ret+48(FP) - - // copy(dst[i:], lit) - // - // This means calling runtime·memmove(&dst[i], &lit[0], len(lit)), so we push - // DI, R10 and AX as arguments. - MOVQ DI, 0(SP) - MOVQ R10, 8(SP) - MOVQ AX, 16(SP) - CALL runtime·memmove(SB) - RET - -// ---------------------------------------------------------------------------- - -// func emitCopy(dst []byte, offset, length int) int -// -// All local variables fit into registers. The register allocation: -// - AX length -// - SI &dst[0] -// - DI &dst[i] -// - R11 offset -// -// The unusual register allocation of local variables, such as R11 for the -// offset, matches the allocation used at the call site in encodeBlock, which -// makes it easier to manually inline this function. -TEXT ·emitCopy(SB), NOSPLIT, $0-48 - MOVQ dst_base+0(FP), DI - MOVQ DI, SI - MOVQ offset+24(FP), R11 - MOVQ length+32(FP), AX - -loop0: - // for length >= 68 { etc } - CMPL AX, $68 - JLT step1 - - // Emit a length 64 copy, encoded as 3 bytes. - MOVB $0xfe, 0(DI) - MOVW R11, 1(DI) - ADDQ $3, DI - SUBL $64, AX - JMP loop0 - -step1: - // if length > 64 { etc } - CMPL AX, $64 - JLE step2 - - // Emit a length 60 copy, encoded as 3 bytes. - MOVB $0xee, 0(DI) - MOVW R11, 1(DI) - ADDQ $3, DI - SUBL $60, AX - -step2: - // if length >= 12 || offset >= 2048 { goto step3 } - CMPL AX, $12 - JGE step3 - CMPL R11, $2048 - JGE step3 - - // Emit the remaining copy, encoded as 2 bytes. - MOVB R11, 1(DI) - SHRL $8, R11 - SHLB $5, R11 - SUBB $4, AX - SHLB $2, AX - ORB AX, R11 - ORB $1, R11 - MOVB R11, 0(DI) - ADDQ $2, DI - - // Return the number of bytes written. - SUBQ SI, DI - MOVQ DI, ret+40(FP) - RET - -step3: - // Emit the remaining copy, encoded as 3 bytes. - SUBL $1, AX - SHLB $2, AX - ORB $2, AX - MOVB AX, 0(DI) - MOVW R11, 1(DI) - ADDQ $3, DI - - // Return the number of bytes written. - SUBQ SI, DI - MOVQ DI, ret+40(FP) - RET - -// ---------------------------------------------------------------------------- - -// func extendMatch(src []byte, i, j int) int -// -// All local variables fit into registers. The register allocation: -// - DX &src[0] -// - SI &src[j] -// - R13 &src[len(src) - 8] -// - R14 &src[len(src)] -// - R15 &src[i] -// -// The unusual register allocation of local variables, such as R15 for a source -// pointer, matches the allocation used at the call site in encodeBlock, which -// makes it easier to manually inline this function. -TEXT ·extendMatch(SB), NOSPLIT, $0-48 - MOVQ src_base+0(FP), DX - MOVQ src_len+8(FP), R14 - MOVQ i+24(FP), R15 - MOVQ j+32(FP), SI - ADDQ DX, R14 - ADDQ DX, R15 - ADDQ DX, SI - MOVQ R14, R13 - SUBQ $8, R13 - -cmp8: - // As long as we are 8 or more bytes before the end of src, we can load and - // compare 8 bytes at a time. If those 8 bytes are equal, repeat. - CMPQ SI, R13 - JA cmp1 - MOVQ (R15), AX - MOVQ (SI), BX - CMPQ AX, BX - JNE bsf - ADDQ $8, R15 - ADDQ $8, SI - JMP cmp8 - -bsf: - // If those 8 bytes were not equal, XOR the two 8 byte values, and return - // the index of the first byte that differs. The BSF instruction finds the - // least significant 1 bit, the amd64 architecture is little-endian, and - // the shift by 3 converts a bit index to a byte index. - XORQ AX, BX - BSFQ BX, BX - SHRQ $3, BX - ADDQ BX, SI - - // Convert from &src[ret] to ret. - SUBQ DX, SI - MOVQ SI, ret+40(FP) - RET - -cmp1: - // In src's tail, compare 1 byte at a time. - CMPQ SI, R14 - JAE extendMatchEnd - MOVB (R15), AX - MOVB (SI), BX - CMPB AX, BX - JNE extendMatchEnd - ADDQ $1, R15 - ADDQ $1, SI - JMP cmp1 - -extendMatchEnd: - // Convert from &src[ret] to ret. - SUBQ DX, SI - MOVQ SI, ret+40(FP) - RET - -// ---------------------------------------------------------------------------- - -// func encodeBlock(dst, src []byte) (d int) -// -// All local variables fit into registers, other than "var table". The register -// allocation: -// - AX . . -// - BX . . -// - CX 56 shift (note that amd64 shifts by non-immediates must use CX). -// - DX 64 &src[0], tableSize -// - SI 72 &src[s] -// - DI 80 &dst[d] -// - R9 88 sLimit -// - R10 . &src[nextEmit] -// - R11 96 prevHash, currHash, nextHash, offset -// - R12 104 &src[base], skip -// - R13 . &src[nextS], &src[len(src) - 8] -// - R14 . len(src), bytesBetweenHashLookups, &src[len(src)], x -// - R15 112 candidate -// -// The second column (56, 64, etc) is the stack offset to spill the registers -// when calling other functions. We could pack this slightly tighter, but it's -// simpler to have a dedicated spill map independent of the function called. -// -// "var table [maxTableSize]uint16" takes up 32768 bytes of stack space. An -// extra 56 bytes, to call other functions, and an extra 64 bytes, to spill -// local variables (registers) during calls gives 32768 + 56 + 64 = 32888. -TEXT ·encodeBlock(SB), 0, $32888-56 - MOVQ dst_base+0(FP), DI - MOVQ src_base+24(FP), SI - MOVQ src_len+32(FP), R14 - - // shift, tableSize := uint32(32-8), 1<<8 - MOVQ $24, CX - MOVQ $256, DX - -calcShift: - // for ; tableSize < maxTableSize && tableSize < len(src); tableSize *= 2 { - // shift-- - // } - CMPQ DX, $16384 - JGE varTable - CMPQ DX, R14 - JGE varTable - SUBQ $1, CX - SHLQ $1, DX - JMP calcShift - -varTable: - // var table [maxTableSize]uint16 - // - // In the asm code, unlike the Go code, we can zero-initialize only the - // first tableSize elements. Each uint16 element is 2 bytes and each MOVOU - // writes 16 bytes, so we can do only tableSize/8 writes instead of the - // 2048 writes that would zero-initialize all of table's 32768 bytes. - SHRQ $3, DX - LEAQ table-32768(SP), BX - PXOR X0, X0 - -memclr: - MOVOU X0, 0(BX) - ADDQ $16, BX - SUBQ $1, DX - JNZ memclr - - // !!! DX = &src[0] - MOVQ SI, DX - - // sLimit := len(src) - inputMargin - MOVQ R14, R9 - SUBQ $15, R9 - - // !!! Pre-emptively spill CX, DX and R9 to the stack. Their values don't - // change for the rest of the function. - MOVQ CX, 56(SP) - MOVQ DX, 64(SP) - MOVQ R9, 88(SP) - - // nextEmit := 0 - MOVQ DX, R10 - - // s := 1 - ADDQ $1, SI - - // nextHash := hash(load32(src, s), shift) - MOVL 0(SI), R11 - IMULL $0x1e35a7bd, R11 - SHRL CX, R11 - -outer: - // for { etc } - - // skip := 32 - MOVQ $32, R12 - - // nextS := s - MOVQ SI, R13 - - // candidate := 0 - MOVQ $0, R15 - -inner0: - // for { etc } - - // s := nextS - MOVQ R13, SI - - // bytesBetweenHashLookups := skip >> 5 - MOVQ R12, R14 - SHRQ $5, R14 - - // nextS = s + bytesBetweenHashLookups - ADDQ R14, R13 - - // skip += bytesBetweenHashLookups - ADDQ R14, R12 - - // if nextS > sLimit { goto emitRemainder } - MOVQ R13, AX - SUBQ DX, AX - CMPQ AX, R9 - JA emitRemainder - - // candidate = int(table[nextHash]) - // XXX: MOVWQZX table-32768(SP)(R11*2), R15 - // XXX: 4e 0f b7 7c 5c 78 movzwq 0x78(%rsp,%r11,2),%r15 - BYTE $0x4e - BYTE $0x0f - BYTE $0xb7 - BYTE $0x7c - BYTE $0x5c - BYTE $0x78 - - // table[nextHash] = uint16(s) - MOVQ SI, AX - SUBQ DX, AX - - // XXX: MOVW AX, table-32768(SP)(R11*2) - // XXX: 66 42 89 44 5c 78 mov %ax,0x78(%rsp,%r11,2) - BYTE $0x66 - BYTE $0x42 - BYTE $0x89 - BYTE $0x44 - BYTE $0x5c - BYTE $0x78 - - // nextHash = hash(load32(src, nextS), shift) - MOVL 0(R13), R11 - IMULL $0x1e35a7bd, R11 - SHRL CX, R11 - - // if load32(src, s) != load32(src, candidate) { continue } break - MOVL 0(SI), AX - MOVL (DX)(R15*1), BX - CMPL AX, BX - JNE inner0 - -fourByteMatch: - // As per the encode_other.go code: - // - // A 4-byte match has been found. We'll later see etc. - - // !!! Jump to a fast path for short (<= 16 byte) literals. See the comment - // on inputMargin in encode.go. - MOVQ SI, AX - SUBQ R10, AX - CMPQ AX, $16 - JLE emitLiteralFastPath - - // ---------------------------------------- - // Begin inline of the emitLiteral call. - // - // d += emitLiteral(dst[d:], src[nextEmit:s]) - - MOVL AX, BX - SUBL $1, BX - - CMPL BX, $60 - JLT inlineEmitLiteralOneByte - CMPL BX, $256 - JLT inlineEmitLiteralTwoBytes - -inlineEmitLiteralThreeBytes: - MOVB $0xf4, 0(DI) - MOVW BX, 1(DI) - ADDQ $3, DI - JMP inlineEmitLiteralMemmove - -inlineEmitLiteralTwoBytes: - MOVB $0xf0, 0(DI) - MOVB BX, 1(DI) - ADDQ $2, DI - JMP inlineEmitLiteralMemmove - -inlineEmitLiteralOneByte: - SHLB $2, BX - MOVB BX, 0(DI) - ADDQ $1, DI - -inlineEmitLiteralMemmove: - // Spill local variables (registers) onto the stack; call; unspill. - // - // copy(dst[i:], lit) - // - // This means calling runtime·memmove(&dst[i], &lit[0], len(lit)), so we push - // DI, R10 and AX as arguments. - MOVQ DI, 0(SP) - MOVQ R10, 8(SP) - MOVQ AX, 16(SP) - ADDQ AX, DI // Finish the "d +=" part of "d += emitLiteral(etc)". - MOVQ SI, 72(SP) - MOVQ DI, 80(SP) - MOVQ R15, 112(SP) - CALL runtime·memmove(SB) - MOVQ 56(SP), CX - MOVQ 64(SP), DX - MOVQ 72(SP), SI - MOVQ 80(SP), DI - MOVQ 88(SP), R9 - MOVQ 112(SP), R15 - JMP inner1 - -inlineEmitLiteralEnd: - // End inline of the emitLiteral call. - // ---------------------------------------- - -emitLiteralFastPath: - // !!! Emit the 1-byte encoding "uint8(len(lit)-1)<<2". - MOVB AX, BX - SUBB $1, BX - SHLB $2, BX - MOVB BX, (DI) - ADDQ $1, DI - - // !!! Implement the copy from lit to dst as a 16-byte load and store. - // (Encode's documentation says that dst and src must not overlap.) - // - // This always copies 16 bytes, instead of only len(lit) bytes, but that's - // OK. Subsequent iterations will fix up the overrun. - // - // Note that on amd64, it is legal and cheap to issue unaligned 8-byte or - // 16-byte loads and stores. This technique probably wouldn't be as - // effective on architectures that are fussier about alignment. - MOVOU 0(R10), X0 - MOVOU X0, 0(DI) - ADDQ AX, DI - -inner1: - // for { etc } - - // base := s - MOVQ SI, R12 - - // !!! offset := base - candidate - MOVQ R12, R11 - SUBQ R15, R11 - SUBQ DX, R11 - - // ---------------------------------------- - // Begin inline of the extendMatch call. - // - // s = extendMatch(src, candidate+4, s+4) - - // !!! R14 = &src[len(src)] - MOVQ src_len+32(FP), R14 - ADDQ DX, R14 - - // !!! R13 = &src[len(src) - 8] - MOVQ R14, R13 - SUBQ $8, R13 - - // !!! R15 = &src[candidate + 4] - ADDQ $4, R15 - ADDQ DX, R15 - - // !!! s += 4 - ADDQ $4, SI - -inlineExtendMatchCmp8: - // As long as we are 8 or more bytes before the end of src, we can load and - // compare 8 bytes at a time. If those 8 bytes are equal, repeat. - CMPQ SI, R13 - JA inlineExtendMatchCmp1 - MOVQ (R15), AX - MOVQ (SI), BX - CMPQ AX, BX - JNE inlineExtendMatchBSF - ADDQ $8, R15 - ADDQ $8, SI - JMP inlineExtendMatchCmp8 - -inlineExtendMatchBSF: - // If those 8 bytes were not equal, XOR the two 8 byte values, and return - // the index of the first byte that differs. The BSF instruction finds the - // least significant 1 bit, the amd64 architecture is little-endian, and - // the shift by 3 converts a bit index to a byte index. - XORQ AX, BX - BSFQ BX, BX - SHRQ $3, BX - ADDQ BX, SI - JMP inlineExtendMatchEnd - -inlineExtendMatchCmp1: - // In src's tail, compare 1 byte at a time. - CMPQ SI, R14 - JAE inlineExtendMatchEnd - MOVB (R15), AX - MOVB (SI), BX - CMPB AX, BX - JNE inlineExtendMatchEnd - ADDQ $1, R15 - ADDQ $1, SI - JMP inlineExtendMatchCmp1 - -inlineExtendMatchEnd: - // End inline of the extendMatch call. - // ---------------------------------------- - - // ---------------------------------------- - // Begin inline of the emitCopy call. - // - // d += emitCopy(dst[d:], base-candidate, s-base) - - // !!! length := s - base - MOVQ SI, AX - SUBQ R12, AX - -inlineEmitCopyLoop0: - // for length >= 68 { etc } - CMPL AX, $68 - JLT inlineEmitCopyStep1 - - // Emit a length 64 copy, encoded as 3 bytes. - MOVB $0xfe, 0(DI) - MOVW R11, 1(DI) - ADDQ $3, DI - SUBL $64, AX - JMP inlineEmitCopyLoop0 - -inlineEmitCopyStep1: - // if length > 64 { etc } - CMPL AX, $64 - JLE inlineEmitCopyStep2 - - // Emit a length 60 copy, encoded as 3 bytes. - MOVB $0xee, 0(DI) - MOVW R11, 1(DI) - ADDQ $3, DI - SUBL $60, AX - -inlineEmitCopyStep2: - // if length >= 12 || offset >= 2048 { goto inlineEmitCopyStep3 } - CMPL AX, $12 - JGE inlineEmitCopyStep3 - CMPL R11, $2048 - JGE inlineEmitCopyStep3 - - // Emit the remaining copy, encoded as 2 bytes. - MOVB R11, 1(DI) - SHRL $8, R11 - SHLB $5, R11 - SUBB $4, AX - SHLB $2, AX - ORB AX, R11 - ORB $1, R11 - MOVB R11, 0(DI) - ADDQ $2, DI - JMP inlineEmitCopyEnd - -inlineEmitCopyStep3: - // Emit the remaining copy, encoded as 3 bytes. - SUBL $1, AX - SHLB $2, AX - ORB $2, AX - MOVB AX, 0(DI) - MOVW R11, 1(DI) - ADDQ $3, DI - -inlineEmitCopyEnd: - // End inline of the emitCopy call. - // ---------------------------------------- - - // nextEmit = s - MOVQ SI, R10 - - // if s >= sLimit { goto emitRemainder } - MOVQ SI, AX - SUBQ DX, AX - CMPQ AX, R9 - JAE emitRemainder - - // As per the encode_other.go code: - // - // We could immediately etc. - - // x := load64(src, s-1) - MOVQ -1(SI), R14 - - // prevHash := hash(uint32(x>>0), shift) - MOVL R14, R11 - IMULL $0x1e35a7bd, R11 - SHRL CX, R11 - - // table[prevHash] = uint16(s-1) - MOVQ SI, AX - SUBQ DX, AX - SUBQ $1, AX - - // XXX: MOVW AX, table-32768(SP)(R11*2) - // XXX: 66 42 89 44 5c 78 mov %ax,0x78(%rsp,%r11,2) - BYTE $0x66 - BYTE $0x42 - BYTE $0x89 - BYTE $0x44 - BYTE $0x5c - BYTE $0x78 - - // currHash := hash(uint32(x>>8), shift) - SHRQ $8, R14 - MOVL R14, R11 - IMULL $0x1e35a7bd, R11 - SHRL CX, R11 - - // candidate = int(table[currHash]) - // XXX: MOVWQZX table-32768(SP)(R11*2), R15 - // XXX: 4e 0f b7 7c 5c 78 movzwq 0x78(%rsp,%r11,2),%r15 - BYTE $0x4e - BYTE $0x0f - BYTE $0xb7 - BYTE $0x7c - BYTE $0x5c - BYTE $0x78 - - // table[currHash] = uint16(s) - ADDQ $1, AX - - // XXX: MOVW AX, table-32768(SP)(R11*2) - // XXX: 66 42 89 44 5c 78 mov %ax,0x78(%rsp,%r11,2) - BYTE $0x66 - BYTE $0x42 - BYTE $0x89 - BYTE $0x44 - BYTE $0x5c - BYTE $0x78 - - // if uint32(x>>8) == load32(src, candidate) { continue } - MOVL (DX)(R15*1), BX - CMPL R14, BX - JEQ inner1 - - // nextHash = hash(uint32(x>>16), shift) - SHRQ $8, R14 - MOVL R14, R11 - IMULL $0x1e35a7bd, R11 - SHRL CX, R11 - - // s++ - ADDQ $1, SI - - // break out of the inner1 for loop, i.e. continue the outer loop. - JMP outer - -emitRemainder: - // if nextEmit < len(src) { etc } - MOVQ src_len+32(FP), AX - ADDQ DX, AX - CMPQ R10, AX - JEQ encodeBlockEnd - - // d += emitLiteral(dst[d:], src[nextEmit:]) - // - // Push args. - MOVQ DI, 0(SP) - MOVQ $0, 8(SP) // Unnecessary, as the callee ignores it, but conservative. - MOVQ $0, 16(SP) // Unnecessary, as the callee ignores it, but conservative. - MOVQ R10, 24(SP) - SUBQ R10, AX - MOVQ AX, 32(SP) - MOVQ AX, 40(SP) // Unnecessary, as the callee ignores it, but conservative. - - // Spill local variables (registers) onto the stack; call; unspill. - MOVQ DI, 80(SP) - CALL ·emitLiteral(SB) - MOVQ 80(SP), DI - - // Finish the "d +=" part of "d += emitLiteral(etc)". - ADDQ 48(SP), DI - -encodeBlockEnd: - MOVQ dst_base+0(FP), AX - SUBQ AX, DI - MOVQ DI, d+48(FP) - RET diff --git a/vendor/github.com/klauspost/compress/snappy/runbench.cmd b/vendor/github.com/klauspost/compress/snappy/runbench.cmd deleted file mode 100644 index d24eb4b47..000000000 --- a/vendor/github.com/klauspost/compress/snappy/runbench.cmd +++ /dev/null @@ -1,2 +0,0 @@ -del old.txt -go test -bench=. >>old.txt && go test -bench=. >>old.txt && go test -bench=. >>old.txt && benchstat -delta-test=ttest old.txt new.txt diff --git a/vendor/github.com/klauspost/compress/zstd/README.md b/vendor/github.com/klauspost/compress/zstd/README.md index 7680bfe1d..beb7fa872 100644 --- a/vendor/github.com/klauspost/compress/zstd/README.md +++ b/vendor/github.com/klauspost/compress/zstd/README.md @@ -16,8 +16,7 @@ Currently the package is heavily optimized for 64 bit processors and will be sig Install using `go get -u github.com/klauspost/compress`. The package is located in `github.com/klauspost/compress/zstd`. -Godoc Documentation: https://godoc.org/github.com/klauspost/compress/zstd - +[![Go Reference](https://pkg.go.dev/badge/github.com/klauspost/compress/zstd.svg)](https://pkg.go.dev/github.com/klauspost/compress/zstd) ## Compressor @@ -79,6 +78,9 @@ of a stream. This is independent of the `WithEncoderConcurrency(n)`, but that is in the future. So if you want to limit concurrency for future updates, specify the concurrency you would like. +If you would like stream encoding to be done without spawning async goroutines, use `WithEncoderConcurrency(1)` +which will compress input as each block is completed, blocking on writes until each has completed. + You can specify your desired compression level using `WithEncoderLevel()` option. Currently only pre-defined compression settings can be specified. @@ -105,7 +107,8 @@ and seems to ignore concatenated streams, even though [it is part of the spec](h For compressing small blocks, the returned encoder has a function called `EncodeAll(src, dst []byte) []byte`. `EncodeAll` will encode all input in src and append it to dst. -This function can be called concurrently, but each call will only run on a single goroutine. +This function can be called concurrently. +Each call will only run on a same goroutine as the caller. Encoded blocks can be concatenated and the result will be the combined input stream. Data compressed with EncodeAll can be decoded with the Decoder, using either a stream or `DecodeAll`. @@ -150,10 +153,10 @@ http://sun.aei.polsl.pl/~sdeor/corpus/silesia.zip This package: file out level insize outsize millis mb/s -silesia.tar zskp 1 211947520 73101992 643 313.87 -silesia.tar zskp 2 211947520 67504318 969 208.38 -silesia.tar zskp 3 211947520 65177448 1899 106.44 -silesia.tar zskp 4 211947520 61381950 8115 24.91 +silesia.tar zskp 1 211947520 73821326 634 318.47 +silesia.tar zskp 2 211947520 67655404 1508 133.96 +silesia.tar zskp 3 211947520 64746933 3000 67.37 +silesia.tar zskp 4 211947520 60073508 16926 11.94 cgo zstd: silesia.tar zstd 1 211947520 73605392 543 371.56 @@ -162,84 +165,94 @@ silesia.tar zstd 6 211947520 62916450 1913 105.66 silesia.tar zstd 9 211947520 60212393 5063 39.92 gzip, stdlib/this package: -silesia.tar gzstd 1 211947520 80007735 1654 122.21 -silesia.tar gzkp 1 211947520 80369488 1168 173.06 +silesia.tar gzstd 1 211947520 80007735 1498 134.87 +silesia.tar gzkp 1 211947520 80088272 1009 200.31 GOB stream of binary data. Highly compressible. https://files.klauspost.com/compress/gob-stream.7z file out level insize outsize millis mb/s -gob-stream zskp 1 1911399616 235022249 3088 590.30 -gob-stream zskp 2 1911399616 205669791 3786 481.34 -gob-stream zskp 3 1911399616 185792019 9324 195.48 -gob-stream zskp 4 1911399616 171537212 32113 56.76 +gob-stream zskp 1 1911399616 233948096 3230 564.34 +gob-stream zskp 2 1911399616 203997694 4997 364.73 +gob-stream zskp 3 1911399616 173526523 13435 135.68 +gob-stream zskp 4 1911399616 162195235 47559 38.33 + gob-stream zstd 1 1911399616 249810424 2637 691.26 gob-stream zstd 3 1911399616 208192146 3490 522.31 gob-stream zstd 6 1911399616 193632038 6687 272.56 gob-stream zstd 9 1911399616 177620386 16175 112.70 -gob-stream gzstd 1 1911399616 357382641 10251 177.82 -gob-stream gzkp 1 1911399616 362156523 5695 320.08 + +gob-stream gzstd 1 1911399616 357382013 9046 201.49 +gob-stream gzkp 1 1911399616 359136669 4885 373.08 The test data for the Large Text Compression Benchmark is the first 10^9 bytes of the English Wikipedia dump on Mar. 3, 2006. http://mattmahoney.net/dc/textdata.html file out level insize outsize millis mb/s -enwik9 zskp 1 1000000000 343848582 3609 264.18 -enwik9 zskp 2 1000000000 317276632 5746 165.97 -enwik9 zskp 3 1000000000 294540704 11725 81.34 -enwik9 zskp 4 1000000000 276609671 44029 21.66 +enwik9 zskp 1 1000000000 343833605 3687 258.64 +enwik9 zskp 2 1000000000 317001237 7672 124.29 +enwik9 zskp 3 1000000000 291915823 15923 59.89 +enwik9 zskp 4 1000000000 261710291 77697 12.27 + enwik9 zstd 1 1000000000 358072021 3110 306.65 enwik9 zstd 3 1000000000 313734672 4784 199.35 enwik9 zstd 6 1000000000 295138875 10290 92.68 enwik9 zstd 9 1000000000 278348700 28549 33.40 -enwik9 gzstd 1 1000000000 382578136 9604 99.30 -enwik9 gzkp 1 1000000000 383825945 6544 145.73 + +enwik9 gzstd 1 1000000000 382578136 8608 110.78 +enwik9 gzkp 1 1000000000 382781160 5628 169.45 Highly compressible JSON file. https://files.klauspost.com/compress/github-june-2days-2019.json.zst file out level insize outsize millis mb/s -github-june-2days-2019.json zskp 1 6273951764 699045015 10620 563.40 -github-june-2days-2019.json zskp 2 6273951764 617881763 11687 511.96 -github-june-2days-2019.json zskp 3 6273951764 537511906 29252 204.54 -github-june-2days-2019.json zskp 4 6273951764 512796117 97791 61.18 +github-june-2days-2019.json zskp 1 6273951764 697439532 9789 611.17 +github-june-2days-2019.json zskp 2 6273951764 610876538 18553 322.49 +github-june-2days-2019.json zskp 3 6273951764 517662858 44186 135.41 +github-june-2days-2019.json zskp 4 6273951764 464617114 165373 36.18 + github-june-2days-2019.json zstd 1 6273951764 766284037 8450 708.00 github-june-2days-2019.json zstd 3 6273951764 661889476 10927 547.57 github-june-2days-2019.json zstd 6 6273951764 642756859 22996 260.18 github-june-2days-2019.json zstd 9 6273951764 601974523 52413 114.16 -github-june-2days-2019.json gzstd 1 6273951764 1164400847 29948 199.79 -github-june-2days-2019.json gzkp 1 6273951764 1128755542 19236 311.03 + +github-june-2days-2019.json gzstd 1 6273951764 1164397768 26793 223.32 +github-june-2days-2019.json gzkp 1 6273951764 1120631856 17693 338.16 VM Image, Linux mint with a few installed applications: https://files.klauspost.com/compress/rawstudio-mint14.7z file out level insize outsize millis mb/s -rawstudio-mint14.tar zskp 1 8558382592 3667489370 20210 403.84 -rawstudio-mint14.tar zskp 2 8558382592 3364592300 31873 256.07 -rawstudio-mint14.tar zskp 3 8558382592 3224594213 71751 113.75 -rawstudio-mint14.tar zskp 4 8558382592 3027332295 486243 16.79 +rawstudio-mint14.tar zskp 1 8558382592 3718400221 18206 448.29 +rawstudio-mint14.tar zskp 2 8558382592 3326118337 37074 220.15 +rawstudio-mint14.tar zskp 3 8558382592 3163842361 87306 93.49 +rawstudio-mint14.tar zskp 4 8558382592 2970480650 783862 10.41 + rawstudio-mint14.tar zstd 1 8558382592 3609250104 17136 476.27 rawstudio-mint14.tar zstd 3 8558382592 3341679997 29262 278.92 rawstudio-mint14.tar zstd 6 8558382592 3235846406 77904 104.77 rawstudio-mint14.tar zstd 9 8558382592 3160778861 140946 57.91 -rawstudio-mint14.tar gzstd 1 8558382592 3926257486 57722 141.40 -rawstudio-mint14.tar gzkp 1 8558382592 3970463184 41749 195.49 + +rawstudio-mint14.tar gzstd 1 8558382592 3926234992 51345 158.96 +rawstudio-mint14.tar gzkp 1 8558382592 3960117298 36722 222.26 CSV data: https://files.klauspost.com/compress/nyc-taxi-data-10M.csv.zst file out level insize outsize millis mb/s -nyc-taxi-data-10M.csv zskp 1 3325605752 641339945 8925 355.35 -nyc-taxi-data-10M.csv zskp 2 3325605752 591748091 11268 281.44 -nyc-taxi-data-10M.csv zskp 3 3325605752 538490114 19880 159.53 -nyc-taxi-data-10M.csv zskp 4 3325605752 495986829 89368 35.49 +nyc-taxi-data-10M.csv zskp 1 3325605752 641319332 9462 335.17 +nyc-taxi-data-10M.csv zskp 2 3325605752 588976126 17570 180.50 +nyc-taxi-data-10M.csv zskp 3 3325605752 529329260 32432 97.79 +nyc-taxi-data-10M.csv zskp 4 3325605752 474949772 138025 22.98 + nyc-taxi-data-10M.csv zstd 1 3325605752 687399637 8233 385.18 nyc-taxi-data-10M.csv zstd 3 3325605752 598514411 10065 315.07 nyc-taxi-data-10M.csv zstd 6 3325605752 570522953 20038 158.27 nyc-taxi-data-10M.csv zstd 9 3325605752 517554797 64565 49.12 -nyc-taxi-data-10M.csv gzstd 1 3325605752 928656485 23876 132.83 -nyc-taxi-data-10M.csv gzkp 1 3325605752 924718719 16388 193.53 + +nyc-taxi-data-10M.csv gzstd 1 3325605752 928654908 21270 149.11 +nyc-taxi-data-10M.csv gzkp 1 3325605752 922273214 13929 227.68 ``` ## Decompressor @@ -274,8 +287,13 @@ func Decompress(in io.Reader, out io.Writer) error { } ``` -It is important to use the "Close" function when you no longer need the Reader to stop running goroutines. -See "Allocation-less operation" below. +It is important to use the "Close" function when you no longer need the Reader to stop running goroutines, +when running with default settings. +Goroutines will exit once an error has been returned, including `io.EOF` at the end of a stream. + +Streams are decoded concurrently in 4 asynchronous stages to give the best possible throughput. +However, if you prefer synchronous decompression, use `WithDecoderConcurrency(1)` which will decompress data +as it is being requested only. For decoding buffers, it could look something like this: @@ -284,7 +302,7 @@ import "github.com/klauspost/compress/zstd" // Create a reader that caches decompressors. // For this operation type we supply a nil Reader. -var decoder, _ = zstd.NewReader(nil) +var decoder, _ = zstd.NewReader(nil, WithDecoderConcurrency(0)) // Decompress a buffer. We don't supply a destination buffer, // so it will be allocated by the decoder. @@ -294,9 +312,12 @@ func Decompress(src []byte) ([]byte, error) { ``` Both of these cases should provide the functionality needed. -The decoder can be used for *concurrent* decompression of multiple buffers. +The decoder can be used for *concurrent* decompression of multiple buffers. +By default 4 decompressors will be created. + It will only allow a certain number of concurrent operations to run. -To tweak that yourself use the `WithDecoderConcurrency(n)` option when creating the decoder. +To tweak that yourself use the `WithDecoderConcurrency(n)` option when creating the decoder. +It is possible to use `WithDecoderConcurrency(0)` to create GOMAXPROCS decoders. ### Dictionaries @@ -348,70 +369,71 @@ In this case no unneeded allocations should be made. The buffer decoder does everything on the same goroutine and does nothing concurrently. It can however decode several buffers concurrently. Use `WithDecoderConcurrency(n)` to limit that. -The stream decoder operates on +The stream decoder will create goroutines that: -* One goroutine reads input and splits the input to several block decoders. -* A number of decoders will decode blocks. -* A goroutine coordinates these blocks and sends history from one to the next. +1) Reads input and splits the input into blocks. +2) Decompression of literals. +3) Decompression of sequences. +4) Reconstruction of output stream. So effectively this also means the decoder will "read ahead" and prepare data to always be available for output. +The concurrency level will, for streams, determine how many blocks ahead the compression will start. + Since "blocks" are quite dependent on the output of the previous block stream decoding will only have limited concurrency. -In practice this means that concurrency is often limited to utilizing about 2 cores effectively. - - +In practice this means that concurrency is often limited to utilizing about 3 cores effectively. + ### Benchmarks -These are some examples of performance compared to [datadog cgo library](https://github.com/DataDog/zstd). - The first two are streaming decodes and the last are smaller inputs. - + +Running on AMD Ryzen 9 3950X 16-Core Processor. AMD64 assembly used. + ``` -BenchmarkDecoderSilesia-8 3 385000067 ns/op 550.51 MB/s 5498 B/op 8 allocs/op -BenchmarkDecoderSilesiaCgo-8 6 197666567 ns/op 1072.25 MB/s 270672 B/op 8 allocs/op - -BenchmarkDecoderEnwik9-8 1 2027001600 ns/op 493.34 MB/s 10496 B/op 18 allocs/op -BenchmarkDecoderEnwik9Cgo-8 2 979499200 ns/op 1020.93 MB/s 270672 B/op 8 allocs/op - -Concurrent performance: - -BenchmarkDecoder_DecodeAllParallel/kppkn.gtb.zst-16 28915 42469 ns/op 4340.07 MB/s 114 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/geo.protodata.zst-16 116505 9965 ns/op 11900.16 MB/s 16 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/plrabn12.txt.zst-16 8952 134272 ns/op 3588.70 MB/s 915 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/lcet10.txt.zst-16 11820 102538 ns/op 4161.90 MB/s 594 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/asyoulik.txt.zst-16 34782 34184 ns/op 3661.88 MB/s 60 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/alice29.txt.zst-16 27712 43447 ns/op 3500.58 MB/s 99 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/html_x_4.zst-16 62826 18750 ns/op 21845.10 MB/s 104 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/paper-100k.pdf.zst-16 631545 1794 ns/op 57078.74 MB/s 2 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/fireworks.jpeg.zst-16 1690140 712 ns/op 172938.13 MB/s 1 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/urls.10K.zst-16 10432 113593 ns/op 6180.73 MB/s 1143 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/html.zst-16 113206 10671 ns/op 9596.27 MB/s 15 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallel/comp-data.bin.zst-16 1530615 779 ns/op 5229.49 MB/s 0 B/op 0 allocs/op - -BenchmarkDecoder_DecodeAllParallelCgo/kppkn.gtb.zst-16 65217 16192 ns/op 11383.34 MB/s 46 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/geo.protodata.zst-16 292671 4039 ns/op 29363.19 MB/s 6 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/plrabn12.txt.zst-16 26314 46021 ns/op 10470.43 MB/s 293 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/lcet10.txt.zst-16 33897 34900 ns/op 12227.96 MB/s 205 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/asyoulik.txt.zst-16 104348 11433 ns/op 10949.01 MB/s 20 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/alice29.txt.zst-16 75949 15510 ns/op 9805.60 MB/s 32 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/html_x_4.zst-16 173910 6756 ns/op 60624.29 MB/s 37 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/paper-100k.pdf.zst-16 923076 1339 ns/op 76474.87 MB/s 1 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/fireworks.jpeg.zst-16 922920 1351 ns/op 91102.57 MB/s 2 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/urls.10K.zst-16 27649 43618 ns/op 16096.19 MB/s 407 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/html.zst-16 279073 4160 ns/op 24614.18 MB/s 6 B/op 0 allocs/op -BenchmarkDecoder_DecodeAllParallelCgo/comp-data.bin.zst-16 749938 1579 ns/op 2581.71 MB/s 0 B/op 0 allocs/op +BenchmarkDecoderSilesia-32 5 206878840 ns/op 1024.50 MB/s 49808 B/op 43 allocs/op +BenchmarkDecoderEnwik9-32 1 1271809000 ns/op 786.28 MB/s 72048 B/op 52 allocs/op + +Concurrent blocks, performance: + +BenchmarkDecoder_DecodeAllParallel/kppkn.gtb.zst-32 67356 17857 ns/op 10321.96 MB/s 22.48 pct 102 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/geo.protodata.zst-32 266656 4421 ns/op 26823.21 MB/s 11.89 pct 19 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/plrabn12.txt.zst-32 20992 56842 ns/op 8477.17 MB/s 39.90 pct 754 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/lcet10.txt.zst-32 27456 43932 ns/op 9714.01 MB/s 33.27 pct 524 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/asyoulik.txt.zst-32 78432 15047 ns/op 8319.15 MB/s 40.34 pct 66 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/alice29.txt.zst-32 65800 18436 ns/op 8249.63 MB/s 37.75 pct 88 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/html_x_4.zst-32 102993 11523 ns/op 35546.09 MB/s 3.637 pct 143 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/paper-100k.pdf.zst-32 1000000 1070 ns/op 95720.98 MB/s 80.53 pct 3 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/fireworks.jpeg.zst-32 749802 1752 ns/op 70272.35 MB/s 100.0 pct 5 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/urls.10K.zst-32 22640 52934 ns/op 13263.37 MB/s 26.25 pct 1014 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/html.zst-32 226412 5232 ns/op 19572.27 MB/s 14.49 pct 20 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/comp-data.bin.zst-32 923041 1276 ns/op 3194.71 MB/s 31.26 pct 0 B/op 0 allocs/op ``` -This reflects the performance around May 2020, but this may be out of date. +This reflects the performance around May 2022, but this may be out of date. + +## Zstd inside ZIP files + +It is possible to use zstandard to compress individual files inside zip archives. +While this isn't widely supported it can be useful for internal files. + +To support the compression and decompression of these files you must register a compressor and decompressor. + +It is highly recommended registering the (de)compressors on individual zip Reader/Writer and NOT +use the global registration functions. The main reason for this is that 2 registrations from +different packages will result in a panic. + +It is a good idea to only have a single compressor and decompressor, since they can be used for multiple zip +files concurrently, and using a single instance will allow reusing some resources. + +See [this example](https://pkg.go.dev/github.com/klauspost/compress/zstd#example-ZipCompressor) for +how to compress and decompress files inside zip archives. # Contributions Contributions are always welcome. For new features/fixes, remember to add tests and for performance enhancements include benchmarks. -For sending files for reproducing errors use a service like [goobox](https://goobox.io/#/upload) or similar to share your files. - For general feedback and experience reports, feel free to open an issue or write me on [Twitter](https://twitter.com/sh0dan). This package includes the excellent [`github.com/cespare/xxhash`](https://github.com/cespare/xxhash) package Copyright (c) 2016 Caleb Spare. diff --git a/vendor/github.com/klauspost/compress/zstd/bitreader.go b/vendor/github.com/klauspost/compress/zstd/bitreader.go index 854458537..97299d499 100644 --- a/vendor/github.com/klauspost/compress/zstd/bitreader.go +++ b/vendor/github.com/klauspost/compress/zstd/bitreader.go @@ -7,6 +7,7 @@ package zstd import ( "encoding/binary" "errors" + "fmt" "io" "math/bits" ) @@ -50,16 +51,16 @@ func (b *bitReader) getBits(n uint8) int { if n == 0 /*|| b.bitsRead >= 64 */ { return 0 } - return b.getBitsFast(n) + return int(b.get32BitsFast(n)) } -// getBitsFast requires that at least one bit is requested every time. +// get32BitsFast requires that at least one bit is requested every time. // There are no checks if the buffer is filled. -func (b *bitReader) getBitsFast(n uint8) int { +func (b *bitReader) get32BitsFast(n uint8) uint32 { const regMask = 64 - 1 v := uint32((b.value << (b.bitsRead & regMask)) >> ((regMask + 1 - n) & regMask)) b.bitsRead += n - return int(v) + return v } // fillFast() will make sure at least 32 bits are available. @@ -125,6 +126,9 @@ func (b *bitReader) remain() uint { func (b *bitReader) close() error { // Release reference. b.in = nil + if !b.finished() { + return fmt.Errorf("%d extra bits on block, should be 0", b.remain()) + } if b.bitsRead > 64 { return io.ErrUnexpectedEOF } diff --git a/vendor/github.com/klauspost/compress/zstd/bitwriter.go b/vendor/github.com/klauspost/compress/zstd/bitwriter.go index 303ae90f9..78b3c61be 100644 --- a/vendor/github.com/klauspost/compress/zstd/bitwriter.go +++ b/vendor/github.com/klauspost/compress/zstd/bitwriter.go @@ -5,8 +5,6 @@ package zstd -import "fmt" - // bitWriter will write bits. // First bit will be LSB of the first byte of output. type bitWriter struct { @@ -38,7 +36,7 @@ func (b *bitWriter) addBits16NC(value uint16, bits uint8) { b.nBits += bits } -// addBits32NC will add up to 32 bits. +// addBits32NC will add up to 31 bits. // It will not check if there is space for them, // so the caller must ensure that it has flushed recently. func (b *bitWriter) addBits32NC(value uint32, bits uint8) { @@ -46,6 +44,26 @@ func (b *bitWriter) addBits32NC(value uint32, bits uint8) { b.nBits += bits } +// addBits64NC will add up to 64 bits. +// There must be space for 32 bits. +func (b *bitWriter) addBits64NC(value uint64, bits uint8) { + if bits <= 31 { + b.addBits32Clean(uint32(value), bits) + return + } + b.addBits32Clean(uint32(value), 32) + b.flush32() + b.addBits32Clean(uint32(value>>32), bits-32) +} + +// addBits32Clean will add up to 32 bits. +// It will not check if there is space for them. +// The input must not contain more bits than specified. +func (b *bitWriter) addBits32Clean(value uint32, bits uint8) { + b.bitContainer |= uint64(value) << (b.nBits & 63) + b.nBits += bits +} + // addBits16Clean will add up to 16 bits. value may not contain more set bits than indicated. // It will not check if there is space for them, so the caller must ensure that it has flushed recently. func (b *bitWriter) addBits16Clean(value uint16, bits uint8) { @@ -53,80 +71,6 @@ func (b *bitWriter) addBits16Clean(value uint16, bits uint8) { b.nBits += bits } -// flush will flush all pending full bytes. -// There will be at least 56 bits available for writing when this has been called. -// Using flush32 is faster, but leaves less space for writing. -func (b *bitWriter) flush() { - v := b.nBits >> 3 - switch v { - case 0: - case 1: - b.out = append(b.out, - byte(b.bitContainer), - ) - case 2: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - ) - case 3: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - ) - case 4: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - ) - case 5: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - ) - case 6: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - byte(b.bitContainer>>40), - ) - case 7: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - byte(b.bitContainer>>40), - byte(b.bitContainer>>48), - ) - case 8: - b.out = append(b.out, - byte(b.bitContainer), - byte(b.bitContainer>>8), - byte(b.bitContainer>>16), - byte(b.bitContainer>>24), - byte(b.bitContainer>>32), - byte(b.bitContainer>>40), - byte(b.bitContainer>>48), - byte(b.bitContainer>>56), - ) - default: - panic(fmt.Errorf("bits (%d) > 64", b.nBits)) - } - b.bitContainer >>= v << 3 - b.nBits &= 7 -} - // flush32 will flush out, so there are at least 32 bits available for writing. func (b *bitWriter) flush32() { if b.nBits < 32 { diff --git a/vendor/github.com/klauspost/compress/zstd/blockdec.go b/vendor/github.com/klauspost/compress/zstd/blockdec.go index b51d922bd..7eed729be 100644 --- a/vendor/github.com/klauspost/compress/zstd/blockdec.go +++ b/vendor/github.com/klauspost/compress/zstd/blockdec.go @@ -5,9 +5,14 @@ package zstd import ( + "bytes" + "encoding/binary" "errors" "fmt" "io" + "io/ioutil" + "os" + "path/filepath" "sync" "github.com/klauspost/compress/huff0" @@ -38,14 +43,14 @@ const ( // maxCompressedBlockSize is the biggest allowed compressed block size (128KB) maxCompressedBlockSize = 128 << 10 + compressedBlockOverAlloc = 16 + maxCompressedBlockSizeAlloc = 128<<10 + compressedBlockOverAlloc + // Maximum possible block size (all Raw+Uncompressed). maxBlockSize = (1 << 21) - 1 - // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#literals_section_header - maxCompressedLiteralSize = 1 << 18 - maxRLELiteralSize = 1 << 20 - maxMatchLen = 131074 - maxSequences = 0x7f00 + 0xffff + maxMatchLen = 131074 + maxSequences = 0x7f00 + 0xffff // We support slightly less than the reference decoder to be able to // use ints on 32 bit archs. @@ -76,20 +81,27 @@ type blockDec struct { // Window size of the block. WindowSize uint64 - history chan *history - input chan struct{} - result chan decodeOutput - sequenceBuf []seq - err error - decWG sync.WaitGroup + err error + + // Check against this crc + checkCRC []byte // Frame to use for singlethreaded decoding. // Should not be used by the decoder itself since parent may be another frame. localFrame *frameDec + sequence []seqVals + + async struct { + newHist *history + literals []byte + seqData []byte + seqSize int // Size of uncompressed sequences + fcs uint64 + } + // Block is RLE, this is the size. RLESize uint32 - tmp [4]byte Type blockType @@ -109,13 +121,8 @@ func (b *blockDec) String() string { func newBlockDec(lowMem bool) *blockDec { b := blockDec{ - lowMem: lowMem, - result: make(chan decodeOutput, 1), - input: make(chan struct{}, 1), - history: make(chan *history, 1), + lowMem: lowMem, } - b.decWG.Add(1) - go b.startDecoder() return &b } @@ -123,44 +130,60 @@ func newBlockDec(lowMem bool) *blockDec { // Input must be a start of a block and will be at the end of the block when returned. func (b *blockDec) reset(br byteBuffer, windowSize uint64) error { b.WindowSize = windowSize - tmp := br.readSmall(3) - if tmp == nil { - if debug { - println("Reading block header:", io.ErrUnexpectedEOF) - } - return io.ErrUnexpectedEOF + tmp, err := br.readSmall(3) + if err != nil { + println("Reading block header:", err) + return err } bh := uint32(tmp[0]) | (uint32(tmp[1]) << 8) | (uint32(tmp[2]) << 16) b.Last = bh&1 != 0 b.Type = blockType((bh >> 1) & 3) // find size. cSize := int(bh >> 3) - maxSize := maxBlockSize + maxSize := maxCompressedBlockSizeAlloc switch b.Type { case blockTypeReserved: return ErrReservedBlockType case blockTypeRLE: + if cSize > maxCompressedBlockSize || cSize > int(b.WindowSize) { + if debugDecoder { + printf("rle block too big: csize:%d block: %+v\n", uint64(cSize), b) + } + return ErrWindowSizeExceeded + } b.RLESize = uint32(cSize) if b.lowMem { maxSize = cSize } cSize = 1 case blockTypeCompressed: - if debug { + if debugDecoder { println("Data size on stream:", cSize) } b.RLESize = 0 - maxSize = maxCompressedBlockSize + maxSize = maxCompressedBlockSizeAlloc if windowSize < maxCompressedBlockSize && b.lowMem { - maxSize = int(windowSize) + maxSize = int(windowSize) + compressedBlockOverAlloc } if cSize > maxCompressedBlockSize || uint64(cSize) > b.WindowSize { - if debug { + if debugDecoder { printf("compressed block too big: csize:%d block: %+v\n", uint64(cSize), b) } return ErrCompressedSizeTooBig } + // Empty compressed blocks must at least be 2 bytes + // for Literals_Block_Type and one for Sequences_Section_Header. + if cSize < 2 { + return ErrBlockTooSmall + } case blockTypeRaw: + if cSize > maxCompressedBlockSize || cSize > int(b.WindowSize) { + if debugDecoder { + printf("rle block too big: csize:%d block: %+v\n", uint64(cSize), b) + } + return ErrWindowSizeExceeded + } + b.RLESize = 0 // We do not need a destination for raw blocks. maxSize = -1 @@ -170,19 +193,18 @@ func (b *blockDec) reset(br byteBuffer, windowSize uint64) error { // Read block data. if cap(b.dataStorage) < cSize { - if b.lowMem { - b.dataStorage = make([]byte, 0, cSize) + if b.lowMem || cSize > maxCompressedBlockSize { + b.dataStorage = make([]byte, 0, cSize+compressedBlockOverAlloc) } else { - b.dataStorage = make([]byte, 0, maxBlockSize) + b.dataStorage = make([]byte, 0, maxCompressedBlockSizeAlloc) } } if cap(b.dst) <= maxSize { b.dst = make([]byte, 0, maxSize+1) } - var err error b.data, err = br.readBig(cSize, b.dataStorage) if err != nil { - if debug { + if debugDecoder { println("Reading block:", err, "(", cSize, ")", len(b.data)) printf("%T", br) } @@ -196,85 +218,14 @@ func (b *blockDec) sendErr(err error) { b.Last = true b.Type = blockTypeReserved b.err = err - b.input <- struct{}{} } // Close will release resources. // Closed blockDec cannot be reset. func (b *blockDec) Close() { - close(b.input) - close(b.history) - close(b.result) - b.decWG.Wait() } -// decodeAsync will prepare decoding the block when it receives input. -// This will separate output and history. -func (b *blockDec) startDecoder() { - defer b.decWG.Done() - for range b.input { - //println("blockDec: Got block input") - switch b.Type { - case blockTypeRLE: - if cap(b.dst) < int(b.RLESize) { - if b.lowMem { - b.dst = make([]byte, b.RLESize) - } else { - b.dst = make([]byte, maxBlockSize) - } - } - o := decodeOutput{ - d: b, - b: b.dst[:b.RLESize], - err: nil, - } - v := b.data[0] - for i := range o.b { - o.b[i] = v - } - hist := <-b.history - hist.append(o.b) - b.result <- o - case blockTypeRaw: - o := decodeOutput{ - d: b, - b: b.data, - err: nil, - } - hist := <-b.history - hist.append(o.b) - b.result <- o - case blockTypeCompressed: - b.dst = b.dst[:0] - err := b.decodeCompressed(nil) - o := decodeOutput{ - d: b, - b: b.dst, - err: err, - } - if debug { - println("Decompressed to", len(b.dst), "bytes, error:", err) - } - b.result <- o - case blockTypeReserved: - // Used for returning errors. - <-b.history - b.result <- decodeOutput{ - d: b, - b: nil, - err: b.err, - } - default: - panic("Invalid block type") - } - if debug { - println("blockDec: Finished block") - } - } -} - -// decodeAsync will prepare decoding the block when it receives the history. -// If history is provided, it will not fetch it from the channel. +// decodeBuf func (b *blockDec) decodeBuf(hist *history) error { switch b.Type { case blockTypeRLE: @@ -297,14 +248,23 @@ func (b *blockDec) decodeBuf(hist *history) error { return nil case blockTypeCompressed: saved := b.dst - b.dst = hist.b - hist.b = nil + // Append directly to history + if hist.ignoreBuffer == 0 { + b.dst = hist.b + hist.b = nil + } else { + b.dst = b.dst[:0] + } err := b.decodeCompressed(hist) - if debug { + if debugDecoder { println("Decompressed to total", len(b.dst), "bytes, hash:", xxhash.Sum64(b.dst), "error:", err) } - hist.b = b.dst - b.dst = saved + if hist.ignoreBuffer == 0 { + hist.b = b.dst + b.dst = saved + } else { + hist.appendKeep(b.dst) + } return err case blockTypeReserved: // Used for returning errors. @@ -314,30 +274,18 @@ func (b *blockDec) decodeBuf(hist *history) error { } } -// decodeCompressed will start decompressing a block. -// If no history is supplied the decoder will decodeAsync as much as possible -// before fetching from blockDec.history -func (b *blockDec) decodeCompressed(hist *history) error { - in := b.data - delayedHistory := hist == nil - - if delayedHistory { - // We must always grab history. - defer func() { - if hist == nil { - <-b.history - } - }() - } +func (b *blockDec) decodeLiterals(in []byte, hist *history) (remain []byte, err error) { // There must be at least one byte for Literals_Block_Type and one for Sequences_Section_Header if len(in) < 2 { - return ErrBlockTooSmall + return in, ErrBlockTooSmall } + litType := literalsBlockType(in[0] & 3) var litRegenSize int var litCompSize int sizeFormat := (in[0] >> 2) & 3 var fourStreams bool + var literals []byte switch litType { case literalsBlockRaw, literalsBlockRLE: switch sizeFormat { @@ -353,7 +301,7 @@ func (b *blockDec) decodeCompressed(hist *history) error { // Regenerated_Size uses 20 bits (0-1048575). Literals_Section_Header uses 3 bytes. if len(in) < 3 { println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } litRegenSize = int(in[0]>>4) + (int(in[1]) << 4) + (int(in[2]) << 12) in = in[3:] @@ -364,7 +312,7 @@ func (b *blockDec) decodeCompressed(hist *history) error { // Both Regenerated_Size and Compressed_Size use 10 bits (0-1023). if len(in) < 3 { println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } n := uint64(in[0]>>4) + (uint64(in[1]) << 4) + (uint64(in[2]) << 12) litRegenSize = int(n & 1023) @@ -375,7 +323,7 @@ func (b *blockDec) decodeCompressed(hist *history) error { fourStreams = true if len(in) < 4 { println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } n := uint64(in[0]>>4) + (uint64(in[1]) << 4) + (uint64(in[2]) << 12) + (uint64(in[3]) << 20) litRegenSize = int(n & 16383) @@ -385,7 +333,7 @@ func (b *blockDec) decodeCompressed(hist *history) error { fourStreams = true if len(in) < 5 { println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } n := uint64(in[0]>>4) + (uint64(in[1]) << 4) + (uint64(in[2]) << 12) + (uint64(in[3]) << 20) + (uint64(in[4]) << 28) litRegenSize = int(n & 262143) @@ -393,16 +341,18 @@ func (b *blockDec) decodeCompressed(hist *history) error { in = in[5:] } } - if debug { + if debugDecoder { println("literals type:", litType, "litRegenSize:", litRegenSize, "litCompSize:", litCompSize, "sizeFormat:", sizeFormat, "4X:", fourStreams) } - var literals []byte - var huff *huff0.Scratch + if litRegenSize > int(b.WindowSize) || litRegenSize > maxCompressedBlockSize { + return in, ErrWindowSizeExceeded + } + switch litType { case literalsBlockRaw: if len(in) < litRegenSize { println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", litRegenSize) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } literals = in[:litRegenSize] in = in[litRegenSize:] @@ -410,19 +360,13 @@ func (b *blockDec) decodeCompressed(hist *history) error { case literalsBlockRLE: if len(in) < 1 { println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", 1) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } if cap(b.literalBuf) < litRegenSize { if b.lowMem { - b.literalBuf = make([]byte, litRegenSize) + b.literalBuf = make([]byte, litRegenSize, litRegenSize+compressedBlockOverAlloc) } else { - if litRegenSize > maxCompressedLiteralSize { - // Exceptional - b.literalBuf = make([]byte, litRegenSize) - } else { - b.literalBuf = make([]byte, litRegenSize, maxCompressedLiteralSize) - - } + b.literalBuf = make([]byte, litRegenSize, maxCompressedBlockSize+compressedBlockOverAlloc) } } literals = b.literalBuf[:litRegenSize] @@ -431,45 +375,79 @@ func (b *blockDec) decodeCompressed(hist *history) error { literals[i] = v } in = in[1:] - if debug { + if debugDecoder { printf("Found %d RLE compressed literals\n", litRegenSize) } case literalsBlockTreeless: if len(in) < litCompSize { println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", litCompSize) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } // Store compressed literals, so we defer decoding until we get history. literals = in[:litCompSize] in = in[litCompSize:] - if debug { + if debugDecoder { printf("Found %d compressed literals\n", litCompSize) } + huff := hist.huffTree + if huff == nil { + return in, errors.New("literal block was treeless, but no history was defined") + } + // Ensure we have space to store it. + if cap(b.literalBuf) < litRegenSize { + if b.lowMem { + b.literalBuf = make([]byte, 0, litRegenSize+compressedBlockOverAlloc) + } else { + b.literalBuf = make([]byte, 0, maxCompressedBlockSize+compressedBlockOverAlloc) + } + } + var err error + // Use our out buffer. + huff.MaxDecodedSize = litRegenSize + if fourStreams { + literals, err = huff.Decoder().Decompress4X(b.literalBuf[:0:litRegenSize], literals) + } else { + literals, err = huff.Decoder().Decompress1X(b.literalBuf[:0:litRegenSize], literals) + } + // Make sure we don't leak our literals buffer + if err != nil { + println("decompressing literals:", err) + return in, err + } + if len(literals) != litRegenSize { + return in, fmt.Errorf("literal output size mismatch want %d, got %d", litRegenSize, len(literals)) + } + case literalsBlockCompressed: if len(in) < litCompSize { println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", litCompSize) - return ErrBlockTooSmall + return in, ErrBlockTooSmall } literals = in[:litCompSize] in = in[litCompSize:] - huff = huffDecoderPool.Get().(*huff0.Scratch) - var err error // Ensure we have space to store it. if cap(b.literalBuf) < litRegenSize { if b.lowMem { - b.literalBuf = make([]byte, 0, litRegenSize) + b.literalBuf = make([]byte, 0, litRegenSize+compressedBlockOverAlloc) } else { - b.literalBuf = make([]byte, 0, maxCompressedLiteralSize) + b.literalBuf = make([]byte, 0, maxCompressedBlockSize+compressedBlockOverAlloc) } } - if huff == nil { - huff = &huff0.Scratch{} + huff := hist.huffTree + if huff == nil || (hist.dict != nil && huff == hist.dict.litEnc) { + huff = huffDecoderPool.Get().(*huff0.Scratch) + if huff == nil { + huff = &huff0.Scratch{} + } } + var err error huff, literals, err = huff0.ReadTable(literals, huff) if err != nil { println("reading huffman table:", err) - return err + return in, err } + hist.huffTree = huff + huff.MaxDecodedSize = litRegenSize // Use our out buffer. if fourStreams { literals, err = huff.Decoder().Decompress4X(b.literalBuf[:0:litRegenSize], literals) @@ -478,27 +456,63 @@ func (b *blockDec) decodeCompressed(hist *history) error { } if err != nil { println("decoding compressed literals:", err) - return err + return in, err } // Make sure we don't leak our literals buffer if len(literals) != litRegenSize { - return fmt.Errorf("literal output size mismatch want %d, got %d", litRegenSize, len(literals)) + return in, fmt.Errorf("literal output size mismatch want %d, got %d", litRegenSize, len(literals)) } - if debug { + // Re-cap to get extra size. + literals = b.literalBuf[:len(literals)] + if debugDecoder { printf("Decompressed %d literals into %d bytes\n", litCompSize, litRegenSize) } } + hist.decoders.literals = literals + return in, nil +} +// decodeCompressed will start decompressing a block. +func (b *blockDec) decodeCompressed(hist *history) error { + in := b.data + in, err := b.decodeLiterals(in, hist) + if err != nil { + return err + } + err = b.prepareSequences(in, hist) + if err != nil { + return err + } + if hist.decoders.nSeqs == 0 { + b.dst = append(b.dst, hist.decoders.literals...) + return nil + } + before := len(hist.decoders.out) + err = hist.decoders.decodeSync(hist.b[hist.ignoreBuffer:]) + if err != nil { + return err + } + if hist.decoders.maxSyncLen > 0 { + hist.decoders.maxSyncLen += uint64(before) + hist.decoders.maxSyncLen -= uint64(len(hist.decoders.out)) + } + b.dst = hist.decoders.out + hist.recentOffsets = hist.decoders.prevOffset + return nil +} + +func (b *blockDec) prepareSequences(in []byte, hist *history) (err error) { + if debugDecoder { + printf("prepareSequences: %d byte(s) input\n", len(in)) + } // Decode Sequences // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#sequences-section if len(in) < 1 { return ErrBlockTooSmall } + var nSeqs int seqHeader := in[0] - nSeqs := 0 switch { - case seqHeader == 0: - in = in[1:] case seqHeader < 128: nSeqs = int(seqHeader) in = in[1:] @@ -515,19 +529,16 @@ func (b *blockDec) decodeCompressed(hist *history) error { nSeqs = 0x7f00 + int(in[1]) + (int(in[2]) << 8) in = in[3:] } - // Allocate sequences - if cap(b.sequenceBuf) < nSeqs { - if b.lowMem { - b.sequenceBuf = make([]seq, nSeqs) - } else { - // Allocate max - b.sequenceBuf = make([]seq, nSeqs, maxSequences) + if nSeqs == 0 && len(in) != 0 { + // When no sequences, there should not be any more data... + if debugDecoder { + printf("prepareSequences: 0 sequences, but %d byte(s) left on stream\n", len(in)) } - } else { - // Reuse buffer - b.sequenceBuf = b.sequenceBuf[:nSeqs] + return ErrUnexpectedBlockSize } - var seqs = &sequenceDecs{} + + var seqs = &hist.decoders + seqs.nSeqs = nSeqs if nSeqs > 0 { if len(in) < 1 { return ErrBlockTooSmall @@ -535,12 +546,12 @@ func (b *blockDec) decodeCompressed(hist *history) error { br := byteReader{b: in, off: 0} compMode := br.Uint8() br.advance(1) - if debug { + if debugDecoder { printf("Compression modes: 0b%b", compMode) } for i := uint(0); i < 3; i++ { mode := seqCompMode((compMode >> (6 - i*2)) & 3) - if debug { + if debugDecoder { println("Table", tableIndex(i), "is", mode) } var seq *sequenceDec @@ -556,6 +567,9 @@ func (b *blockDec) decodeCompressed(hist *history) error { } switch mode { case compModePredefined: + if seq.fse != nil && !seq.fse.preDefined { + fseDecoderPool.Put(seq.fse) + } seq.fse = &fsePredef[i] case compModeRLE: if br.remain() < 1 { @@ -563,34 +577,36 @@ func (b *blockDec) decodeCompressed(hist *history) error { } v := br.Uint8() br.advance(1) - dec := fseDecoderPool.Get().(*fseDecoder) + if seq.fse == nil || seq.fse.preDefined { + seq.fse = fseDecoderPool.Get().(*fseDecoder) + } symb, err := decSymbolValue(v, symbolTableX[i]) if err != nil { printf("RLE Transform table (%v) error: %v", tableIndex(i), err) return err } - dec.setRLE(symb) - seq.fse = dec - if debug { + seq.fse.setRLE(symb) + if debugDecoder { printf("RLE set to %+v, code: %v", symb, v) } case compModeFSE: println("Reading table for", tableIndex(i)) - dec := fseDecoderPool.Get().(*fseDecoder) - err := dec.readNCount(&br, uint16(maxTableSymbol[i])) + if seq.fse == nil || seq.fse.preDefined { + seq.fse = fseDecoderPool.Get().(*fseDecoder) + } + err := seq.fse.readNCount(&br, uint16(maxTableSymbol[i])) if err != nil { println("Read table error:", err) return err } - err = dec.transform(symbolTableX[i]) + err = seq.fse.transform(symbolTableX[i]) if err != nil { println("Transform table error:", err) return err } - if debug { - println("Read table ok", "symbolLen:", dec.symbolLen) + if debugDecoder { + println("Read table ok", "symbolLen:", seq.fse.symbolLen) } - seq.fse = dec case compModeRepeat: seq.repeat = true } @@ -600,140 +616,106 @@ func (b *blockDec) decodeCompressed(hist *history) error { } in = br.unread() } - - // Wait for history. - // All time spent after this is critical since it is strictly sequential. - if hist == nil { - hist = <-b.history - if hist.error { - return ErrDecoderClosed - } + if debugDecoder { + println("Literals:", len(seqs.literals), "hash:", xxhash.Sum64(seqs.literals), "and", seqs.nSeqs, "sequences.") } - // Decode treeless literal block. - if litType == literalsBlockTreeless { - // TODO: We could send the history early WITHOUT the stream history. - // This would allow decoding treeless literals before the byte history is available. - // Silencia stats: Treeless 4393, with: 32775, total: 37168, 11% treeless. - // So not much obvious gain here. - - if hist.huffTree == nil { - return errors.New("literal block was treeless, but no history was defined") - } - // Ensure we have space to store it. - if cap(b.literalBuf) < litRegenSize { - if b.lowMem { - b.literalBuf = make([]byte, 0, litRegenSize) - } else { - b.literalBuf = make([]byte, 0, maxCompressedLiteralSize) - } - } - var err error - // Use our out buffer. - huff = hist.huffTree - if fourStreams { - literals, err = huff.Decoder().Decompress4X(b.literalBuf[:0:litRegenSize], literals) - } else { - literals, err = huff.Decoder().Decompress1X(b.literalBuf[:0:litRegenSize], literals) - } - // Make sure we don't leak our literals buffer - if err != nil { - println("decompressing literals:", err) - return err - } - if len(literals) != litRegenSize { - return fmt.Errorf("literal output size mismatch want %d, got %d", litRegenSize, len(literals)) - } - } else { - if hist.huffTree != nil && huff != nil { - if hist.dict == nil || hist.dict.litEnc != hist.huffTree { - huffDecoderPool.Put(hist.huffTree) - } - hist.huffTree = nil + if nSeqs == 0 { + if len(b.sequence) > 0 { + b.sequence = b.sequence[:0] } + return nil } - if huff != nil { - hist.huffTree = huff + br := seqs.br + if br == nil { + br = &bitReader{} } - if debug { - println("Final literals:", len(literals), "hash:", xxhash.Sum64(literals), "and", nSeqs, "sequences.") + if err := br.init(in); err != nil { + return err } - if nSeqs == 0 { - // Decompressed content is defined entirely as Literals Section content. - b.dst = append(b.dst, literals...) - if delayedHistory { - hist.append(literals) + if err := seqs.initialize(br, hist, b.dst); err != nil { + println("initializing sequences:", err) + return err + } + // Extract blocks... + if false && hist.dict == nil { + fatalErr := func(err error) { + if err != nil { + panic(err) + } } - return nil + fn := fmt.Sprintf("n-%d-lits-%d-prev-%d-%d-%d-win-%d.blk", hist.decoders.nSeqs, len(hist.decoders.literals), hist.recentOffsets[0], hist.recentOffsets[1], hist.recentOffsets[2], hist.windowSize) + var buf bytes.Buffer + fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.litLengths.fse)) + fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.matchLengths.fse)) + fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.offsets.fse)) + buf.Write(in) + ioutil.WriteFile(filepath.Join("testdata", "seqs", fn), buf.Bytes(), os.ModePerm) } - seqs, err := seqs.mergeHistory(&hist.decoders) - if err != nil { - return err - } - if debug { - println("History merged ok") + return nil +} + +func (b *blockDec) decodeSequences(hist *history) error { + if cap(b.sequence) < hist.decoders.nSeqs { + if b.lowMem { + b.sequence = make([]seqVals, 0, hist.decoders.nSeqs) + } else { + b.sequence = make([]seqVals, 0, 0x7F00+0xffff) + } } - br := &bitReader{} - if err := br.init(in); err != nil { - return err + b.sequence = b.sequence[:hist.decoders.nSeqs] + if hist.decoders.nSeqs == 0 { + hist.decoders.seqSize = len(hist.decoders.literals) + return nil } + hist.decoders.windowSize = hist.windowSize + hist.decoders.prevOffset = hist.recentOffsets - // TODO: Investigate if sending history without decoders are faster. - // This would allow the sequences to be decoded async and only have to construct stream history. - // If only recent offsets were not transferred, this would be an obvious win. - // Also, if first 3 sequences don't reference recent offsets, all sequences can be decoded. + err := hist.decoders.decode(b.sequence) + hist.recentOffsets = hist.decoders.prevOffset + return err +} +func (b *blockDec) executeSequences(hist *history) error { hbytes := hist.b if len(hbytes) > hist.windowSize { hbytes = hbytes[len(hbytes)-hist.windowSize:] - // We do not need history any more. + // We do not need history anymore. if hist.dict != nil { hist.dict.content = nil } } - - if err := seqs.initialize(br, hist, literals, b.dst); err != nil { - println("initializing sequences:", err) - return err - } - - err = seqs.decode(nSeqs, br, hbytes) + hist.decoders.windowSize = hist.windowSize + hist.decoders.out = b.dst[:0] + err := hist.decoders.execute(b.sequence, hbytes) if err != nil { return err } - if !br.finished() { - return fmt.Errorf("%d extra bits on block, should be 0", br.remain()) - } + return b.updateHistory(hist) +} - err = br.close() - if err != nil { - printf("Closing sequences: %v, %+v\n", err, *br) - } +func (b *blockDec) updateHistory(hist *history) error { if len(b.data) > maxCompressedBlockSize { return fmt.Errorf("compressed block size too large (%d)", len(b.data)) } // Set output and release references. - b.dst = seqs.out - seqs.out, seqs.literals, seqs.hist = nil, nil, nil + b.dst = hist.decoders.out + hist.recentOffsets = hist.decoders.prevOffset - if !delayedHistory { - // If we don't have delayed history, no need to update. - hist.recentOffsets = seqs.prevOffset - return nil - } if b.Last { // if last block we don't care about history. println("Last block, no history returned") hist.b = hist.b[:0] return nil + } else { + hist.append(b.dst) + if debugDecoder { + println("Finished block with ", len(b.sequence), "sequences. Added", len(b.dst), "to history, now length", len(hist.b)) + } } - hist.append(b.dst) - hist.recentOffsets = seqs.prevOffset - if debug { - println("Finished block with literals:", len(literals), "and", nSeqs, "sequences.") - } + hist.decoders.out, hist.decoders.literals = nil, nil return nil } diff --git a/vendor/github.com/klauspost/compress/zstd/blockenc.go b/vendor/github.com/klauspost/compress/zstd/blockenc.go index 9647c64e5..12e8f6f0b 100644 --- a/vendor/github.com/klauspost/compress/zstd/blockenc.go +++ b/vendor/github.com/klauspost/compress/zstd/blockenc.go @@ -51,7 +51,7 @@ func (b *blockEnc) init() { if cap(b.literals) < maxCompressedBlockSize { b.literals = make([]byte, 0, maxCompressedBlockSize) } - const defSeqs = 200 + const defSeqs = 2000 if cap(b.sequences) < defSeqs { b.sequences = make([]seq, 0, defSeqs) } @@ -156,7 +156,7 @@ func (h *literalsHeader) setSize(regenLen int) { switch { case inBits < 5: lh |= (uint64(regenLen) << 3) | (1 << 60) - if debug { + if debugEncoder { got := int(lh>>3) & 0xff if got != regenLen { panic(fmt.Sprint("litRegenSize = ", regenLen, "(want) != ", got, "(got)")) @@ -184,7 +184,7 @@ func (h *literalsHeader) setSizes(compLen, inLen int, single bool) { lh |= 1 << 2 } lh |= (uint64(inLen) << 4) | (uint64(compLen) << (10 + 4)) | (3 << 60) - if debug { + if debugEncoder { const mmask = (1 << 24) - 1 n := (lh >> 4) & mmask if int(n&1023) != inLen { @@ -312,7 +312,7 @@ func (b *blockEnc) encodeRaw(a []byte) { bh.setType(blockTypeRaw) b.output = bh.appendTo(b.output[:0]) b.output = append(b.output, a...) - if debug { + if debugEncoder { println("Adding RAW block, length", len(a), "last:", b.last) } } @@ -325,7 +325,7 @@ func (b *blockEnc) encodeRawTo(dst, src []byte) []byte { bh.setType(blockTypeRaw) dst = bh.appendTo(dst) dst = append(dst, src...) - if debug { + if debugEncoder { println("Adding RAW block, length", len(src), "last:", b.last) } return dst @@ -339,7 +339,7 @@ func (b *blockEnc) encodeLits(lits []byte, raw bool) error { // Don't compress extremely small blocks if len(lits) < 8 || (len(lits) < 32 && b.dictLitEnc == nil) || raw { - if debug { + if debugEncoder { println("Adding RAW block, length", len(lits), "last:", b.last) } bh.setType(blockTypeRaw) @@ -371,7 +371,7 @@ func (b *blockEnc) encodeLits(lits []byte, raw bool) error { switch err { case huff0.ErrIncompressible: - if debug { + if debugEncoder { println("Adding RAW block, length", len(lits), "last:", b.last) } bh.setType(blockTypeRaw) @@ -379,16 +379,16 @@ func (b *blockEnc) encodeLits(lits []byte, raw bool) error { b.output = append(b.output, lits...) return nil case huff0.ErrUseRLE: - if debug { + if debugEncoder { println("Adding RLE block, length", len(lits)) } bh.setType(blockTypeRLE) b.output = bh.appendTo(b.output) b.output = append(b.output, lits[0]) return nil + case nil: default: return err - case nil: } // Compressed... // Now, allow reuse @@ -396,12 +396,12 @@ func (b *blockEnc) encodeLits(lits []byte, raw bool) error { bh.setType(blockTypeCompressed) var lh literalsHeader if reUsed { - if debug { + if debugEncoder { println("Reused tree, compressed to", len(out)) } lh.setType(literalsBlockTreeless) } else { - if debug { + if debugEncoder { println("New tree, compressed to", len(out), "tree size:", len(b.litEnc.OutTable)) } lh.setType(literalsBlockCompressed) @@ -426,7 +426,7 @@ func fuzzFseEncoder(data []byte) int { return 0 } enc := fseEncoder{} - hist := enc.Histogram()[:256] + hist := enc.Histogram() maxSym := uint8(0) for i, v := range data { v = v & 63 @@ -517,7 +517,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { lh.setSize(len(b.literals)) b.output = lh.appendTo(b.output) b.output = append(b.output, b.literals...) - if debug { + if debugEncoder { println("Adding literals RAW, length", len(b.literals)) } case huff0.ErrUseRLE: @@ -525,27 +525,22 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { lh.setSize(len(b.literals)) b.output = lh.appendTo(b.output) b.output = append(b.output, b.literals[0]) - if debug { + if debugEncoder { println("Adding literals RLE") } - default: - if debug { - println("Adding literals ERROR:", err) - } - return err case nil: // Compressed litLen... if reUsed { - if debug { + if debugEncoder { println("reused tree") } lh.setType(literalsBlockTreeless) } else { - if debug { + if debugEncoder { println("new tree, size:", len(b.litEnc.OutTable)) } lh.setType(literalsBlockCompressed) - if debug { + if debugEncoder { _, _, err := huff0.ReadTable(out, nil) if err != nil { panic(err) @@ -553,16 +548,21 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { } } lh.setSizes(len(out), len(b.literals), single) - if debug { + if debugEncoder { printf("Compressed %d literals to %d bytes", len(b.literals), len(out)) println("Adding literal header:", lh) } b.output = lh.appendTo(b.output) b.output = append(b.output, out...) b.litEnc.Reuse = huff0.ReusePolicyAllow - if debug { + if debugEncoder { println("Adding literals compressed") } + default: + if debugEncoder { + println("Adding literals ERROR:", err) + } + return err } // Sequence compression @@ -577,7 +577,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { n := len(b.sequences) - 0x7f00 b.output = append(b.output, 255, uint8(n), uint8(n>>8)) } - if debug { + if debugEncoder { println("Encoding", len(b.sequences), "sequences") } b.genCodes() @@ -611,17 +611,17 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { nSize = nSize + (nSize+2*8*16)>>4 switch { case predefSize <= prevSize && predefSize <= nSize || forcePreDef: - if debug { + if debugEncoder { println("Using predefined", predefSize>>3, "<=", nSize>>3) } return preDef, compModePredefined case prevSize <= nSize: - if debug { + if debugEncoder { println("Using previous", prevSize>>3, "<=", nSize>>3) } return prev, compModeRepeat default: - if debug { + if debugEncoder { println("Using new, predef", predefSize>>3, ". previous:", prevSize>>3, ">", nSize>>3, "header max:", cur.maxHeaderSize()>>3, "bytes") println("tl:", cur.actualTableLog, "symbolLen:", cur.symbolLen, "norm:", cur.norm[:cur.symbolLen], "hist", cur.count[:cur.symbolLen]) } @@ -634,7 +634,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { if llEnc.useRLE { mode |= uint8(compModeRLE) << 6 llEnc.setRLE(b.sequences[0].llCode) - if debug { + if debugEncoder { println("llEnc.useRLE") } } else { @@ -645,7 +645,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { if ofEnc.useRLE { mode |= uint8(compModeRLE) << 4 ofEnc.setRLE(b.sequences[0].ofCode) - if debug { + if debugEncoder { println("ofEnc.useRLE") } } else { @@ -657,7 +657,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { if mlEnc.useRLE { mode |= uint8(compModeRLE) << 2 mlEnc.setRLE(b.sequences[0].mlCode) - if debug { + if debugEncoder { println("mlEnc.useRLE, code: ", b.sequences[0].mlCode, "value", b.sequences[0].matchLen) } } else { @@ -666,7 +666,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { mode |= uint8(m) << 2 } b.output = append(b.output, mode) - if debug { + if debugEncoder { printf("Compression modes: 0b%b", mode) } b.output, err = llEnc.writeCount(b.output) @@ -722,52 +722,53 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { println("Encoded seq", seq, s, "codes:", s.llCode, s.mlCode, s.ofCode, "states:", ll.state, ml.state, of.state, "bits:", llB, mlB, ofB) } seq-- - if llEnc.maxBits+mlEnc.maxBits+ofEnc.maxBits <= 32 { - // No need to flush (common) - for seq >= 0 { - s = b.sequences[seq] - wr.flush32() - llB, ofB, mlB := llTT[s.llCode], ofTT[s.ofCode], mlTT[s.mlCode] - // tabelog max is 8 for all. - of.encode(ofB) - ml.encode(mlB) - ll.encode(llB) - wr.flush32() - - // We checked that all can stay within 32 bits - wr.addBits32NC(s.litLen, llB.outBits) - wr.addBits32NC(s.matchLen, mlB.outBits) - wr.addBits32NC(s.offset, ofB.outBits) - - if debugSequences { - println("Encoded seq", seq, s) - } - - seq-- - } - } else { - for seq >= 0 { - s = b.sequences[seq] - wr.flush32() - llB, ofB, mlB := llTT[s.llCode], ofTT[s.ofCode], mlTT[s.mlCode] - // tabelog max is below 8 for each. - of.encode(ofB) - ml.encode(mlB) - ll.encode(llB) - wr.flush32() - - // ml+ll = max 32 bits total - wr.addBits32NC(s.litLen, llB.outBits) - wr.addBits32NC(s.matchLen, mlB.outBits) - wr.flush32() - wr.addBits32NC(s.offset, ofB.outBits) - - if debugSequences { - println("Encoded seq", seq, s) - } - - seq-- - } + // Store sequences in reverse... + for seq >= 0 { + s = b.sequences[seq] + + ofB := ofTT[s.ofCode] + wr.flush32() // tablelog max is below 8 for each, so it will fill max 24 bits. + //of.encode(ofB) + nbBitsOut := (uint32(of.state) + ofB.deltaNbBits) >> 16 + dstState := int32(of.state>>(nbBitsOut&15)) + int32(ofB.deltaFindState) + wr.addBits16NC(of.state, uint8(nbBitsOut)) + of.state = of.stateTable[dstState] + + // Accumulate extra bits. + outBits := ofB.outBits & 31 + extraBits := uint64(s.offset & bitMask32[outBits]) + extraBitsN := outBits + + mlB := mlTT[s.mlCode] + //ml.encode(mlB) + nbBitsOut = (uint32(ml.state) + mlB.deltaNbBits) >> 16 + dstState = int32(ml.state>>(nbBitsOut&15)) + int32(mlB.deltaFindState) + wr.addBits16NC(ml.state, uint8(nbBitsOut)) + ml.state = ml.stateTable[dstState] + + outBits = mlB.outBits & 31 + extraBits = extraBits<> 16 + dstState = int32(ll.state>>(nbBitsOut&15)) + int32(llB.deltaFindState) + wr.addBits16NC(ll.state, uint8(nbBitsOut)) + ll.state = ll.stateTable[dstState] + + outBits = llB.outBits & 31 + extraBits = extraBits< math.MaxUint16 { panic("can only encode up to 64K sequences") } // No bounds checks after here: - llH := b.coders.llEnc.Histogram()[:256] - ofH := b.coders.ofEnc.Histogram()[:256] - mlH := b.coders.mlEnc.Histogram()[:256] + llH := b.coders.llEnc.Histogram() + ofH := b.coders.ofEnc.Histogram() + mlH := b.coders.mlEnc.Histogram() for i := range llH { llH[i] = 0 } @@ -820,7 +820,8 @@ func (b *blockEnc) genCodes() { } var llMax, ofMax, mlMax uint8 - for i, seq := range b.sequences { + for i := range b.sequences { + seq := &b.sequences[i] v := llCode(seq.litLen) seq.llCode = v llH[v]++ @@ -844,7 +845,6 @@ func (b *blockEnc) genCodes() { panic(fmt.Errorf("mlMax > maxMatchLengthSymbol (%d), matchlen: %d", mlMax, seq.matchLen)) } } - b.sequences[i] = seq } maxCount := func(a []uint32) int { var max uint32 diff --git a/vendor/github.com/klauspost/compress/zstd/bytebuf.go b/vendor/github.com/klauspost/compress/zstd/bytebuf.go index 658ef7838..2ad02070d 100644 --- a/vendor/github.com/klauspost/compress/zstd/bytebuf.go +++ b/vendor/github.com/klauspost/compress/zstd/bytebuf.go @@ -12,8 +12,8 @@ import ( type byteBuffer interface { // Read up to 8 bytes. - // Returns nil if no more input is available. - readSmall(n int) []byte + // Returns io.ErrUnexpectedEOF if this cannot be satisfied. + readSmall(n int) ([]byte, error) // Read >8 bytes. // MAY use the destination slice. @@ -23,23 +23,23 @@ type byteBuffer interface { readByte() (byte, error) // Skip n bytes. - skipN(n int) error + skipN(n int64) error } // in-memory buffer type byteBuf []byte -func (b *byteBuf) readSmall(n int) []byte { +func (b *byteBuf) readSmall(n int) ([]byte, error) { if debugAsserts && n > 8 { panic(fmt.Errorf("small read > 8 (%d). use readBig", n)) } bb := *b if len(bb) < n { - return nil + return nil, io.ErrUnexpectedEOF } r := bb[:n] *b = bb[n:] - return r + return r, nil } func (b *byteBuf) readBig(n int, dst []byte) ([]byte, error) { @@ -52,10 +52,6 @@ func (b *byteBuf) readBig(n int, dst []byte) ([]byte, error) { return r, nil } -func (b *byteBuf) remain() []byte { - return *b -} - func (b *byteBuf) readByte() (byte, error) { bb := *b if len(bb) < 1 { @@ -66,9 +62,12 @@ func (b *byteBuf) readByte() (byte, error) { return r, nil } -func (b *byteBuf) skipN(n int) error { +func (b *byteBuf) skipN(n int64) error { bb := *b - if len(bb) < n { + if n < 0 { + return fmt.Errorf("negative skip (%d) requested", n) + } + if int64(len(bb)) < n { return io.ErrUnexpectedEOF } *b = bb[n:] @@ -81,19 +80,22 @@ type readerWrapper struct { tmp [8]byte } -func (r *readerWrapper) readSmall(n int) []byte { +func (r *readerWrapper) readSmall(n int) ([]byte, error) { if debugAsserts && n > 8 { panic(fmt.Errorf("small read > 8 (%d). use readBig", n)) } n2, err := io.ReadFull(r.r, r.tmp[:n]) // We only really care about the actual bytes read. - if n2 != n { - if debug { + if err != nil { + if err == io.EOF { + return nil, io.ErrUnexpectedEOF + } + if debugDecoder { println("readSmall: got", n2, "want", n, "err", err) } - return nil + return nil, err } - return r.tmp[:n] + return r.tmp[:n], nil } func (r *readerWrapper) readBig(n int, dst []byte) ([]byte, error) { @@ -110,6 +112,9 @@ func (r *readerWrapper) readBig(n int, dst []byte) ([]byte, error) { func (r *readerWrapper) readByte() (byte, error) { n2, err := r.r.Read(r.tmp[:1]) if err != nil { + if err == io.EOF { + err = io.ErrUnexpectedEOF + } return 0, err } if n2 != 1 { @@ -118,9 +123,9 @@ func (r *readerWrapper) readByte() (byte, error) { return r.tmp[0], nil } -func (r *readerWrapper) skipN(n int) error { - n2, err := io.CopyN(ioutil.Discard, r.r, int64(n)) - if n2 != int64(n) { +func (r *readerWrapper) skipN(n int64) error { + n2, err := io.CopyN(ioutil.Discard, r.r, n) + if n2 != n { err = io.ErrUnexpectedEOF } return err diff --git a/vendor/github.com/klauspost/compress/zstd/bytereader.go b/vendor/github.com/klauspost/compress/zstd/bytereader.go index 2c4fca17f..0e59a242d 100644 --- a/vendor/github.com/klauspost/compress/zstd/bytereader.go +++ b/vendor/github.com/klauspost/compress/zstd/bytereader.go @@ -13,12 +13,6 @@ type byteReader struct { off int } -// init will initialize the reader and set the input. -func (b *byteReader) init(in []byte) { - b.b = in - b.off = 0 -} - // advance the stream b n bytes. func (b *byteReader) advance(n uint) { b.off += int(n) diff --git a/vendor/github.com/klauspost/compress/zstd/decodeheader.go b/vendor/github.com/klauspost/compress/zstd/decodeheader.go index 87896c5ea..5022e71c8 100644 --- a/vendor/github.com/klauspost/compress/zstd/decodeheader.go +++ b/vendor/github.com/klauspost/compress/zstd/decodeheader.go @@ -5,6 +5,7 @@ package zstd import ( "bytes" + "encoding/binary" "errors" "io" ) @@ -15,18 +16,50 @@ const HeaderMaxSize = 14 + 3 // Header contains information about the first frame and block within that. type Header struct { - // Window Size the window of data to keep while decoding. - // Will only be set if HasFCS is false. - WindowSize uint64 + // SingleSegment specifies whether the data is to be decompressed into a + // single contiguous memory segment. + // It implies that WindowSize is invalid and that FrameContentSize is valid. + SingleSegment bool - // Frame content size. - // Expected size of the entire frame. - FrameContentSize uint64 + // WindowSize is the window of data to keep while decoding. + // Will only be set if SingleSegment is false. + WindowSize uint64 // Dictionary ID. // If 0, no dictionary. DictionaryID uint32 + // HasFCS specifies whether FrameContentSize has a valid value. + HasFCS bool + + // FrameContentSize is the expected uncompressed size of the entire frame. + FrameContentSize uint64 + + // Skippable will be true if the frame is meant to be skipped. + // This implies that FirstBlock.OK is false. + Skippable bool + + // SkippableID is the user-specific ID for the skippable frame. + // Valid values are between 0 to 15, inclusive. + SkippableID int + + // SkippableSize is the length of the user data to skip following + // the header. + SkippableSize uint32 + + // HeaderSize is the raw size of the frame header. + // + // For normal frames, it includes the size of the magic number and + // the size of the header (per section 3.1.1.1). + // It does not include the size for any data blocks (section 3.1.1.2) nor + // the size for the trailing content checksum. + // + // For skippable frames, this counts the size of the magic number + // along with the size of the size field of the payload. + // It does not include the size of the skippable payload itself. + // The total frame size is the HeaderSize plus the SkippableSize. + HeaderSize int + // First block information. FirstBlock struct { // OK will be set if first block could be decoded. @@ -51,17 +84,9 @@ type Header struct { CompressedSize int } - // Skippable will be true if the frame is meant to be skipped. - // No other information will be populated. - Skippable bool - // If set there is a checksum present for the block content. + // The checksum field at the end is always 4 bytes long. HasCheckSum bool - - // If this is true FrameContentSize will have a valid value - HasFCS bool - - SingleSegment bool } // Decode the header from the beginning of the stream. @@ -71,39 +96,46 @@ type Header struct { // If there isn't enough input, io.ErrUnexpectedEOF is returned. // The FirstBlock.OK will indicate if enough information was available to decode the first block header. func (h *Header) Decode(in []byte) error { + *h = Header{} if len(in) < 4 { return io.ErrUnexpectedEOF } + h.HeaderSize += 4 b, in := in[:4], in[4:] if !bytes.Equal(b, frameMagic) { if !bytes.Equal(b[1:4], skippableFrameMagic) || b[0]&0xf0 != 0x50 { return ErrMagicMismatch } - *h = Header{Skippable: true} + if len(in) < 4 { + return io.ErrUnexpectedEOF + } + h.HeaderSize += 4 + h.Skippable = true + h.SkippableID = int(b[0] & 0xf) + h.SkippableSize = binary.LittleEndian.Uint32(in) return nil } + + // Read Window_Descriptor + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#window_descriptor if len(in) < 1 { return io.ErrUnexpectedEOF } - - // Clear output - *h = Header{} fhd, in := in[0], in[1:] + h.HeaderSize++ h.SingleSegment = fhd&(1<<5) != 0 h.HasCheckSum = fhd&(1<<2) != 0 - if fhd&(1<<3) != 0 { - return errors.New("Reserved bit set on frame header") + return errors.New("reserved bit set on frame header") } - // Read Window_Descriptor - // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#window_descriptor if !h.SingleSegment { if len(in) < 1 { return io.ErrUnexpectedEOF } var wd byte wd, in = in[0], in[1:] + h.HeaderSize++ windowLog := 10 + (wd >> 3) windowBase := uint64(1) << windowLog windowAdd := (windowBase / 8) * uint64(wd&0x7) @@ -120,9 +152,7 @@ func (h *Header) Decode(in []byte) error { return io.ErrUnexpectedEOF } b, in = in[:size], in[size:] - if b == nil { - return io.ErrUnexpectedEOF - } + h.HeaderSize += int(size) switch size { case 1: h.DictionaryID = uint32(b[0]) @@ -152,9 +182,7 @@ func (h *Header) Decode(in []byte) error { return io.ErrUnexpectedEOF } b, in = in[:fcsSize], in[fcsSize:] - if b == nil { - return io.ErrUnexpectedEOF - } + h.HeaderSize += int(fcsSize) switch fcsSize { case 1: h.FrameContentSize = uint64(b[0]) @@ -174,7 +202,7 @@ func (h *Header) Decode(in []byte) error { if len(in) < 3 { return nil } - tmp, in := in[:3], in[3:] + tmp := in[:3] bh := uint32(tmp[0]) | (uint32(tmp[1]) << 8) | (uint32(tmp[2]) << 16) h.FirstBlock.Last = bh&1 != 0 blockType := blockType((bh >> 1) & 3) diff --git a/vendor/github.com/klauspost/compress/zstd/decoder.go b/vendor/github.com/klauspost/compress/zstd/decoder.go index 1d41c25d2..d212f4737 100644 --- a/vendor/github.com/klauspost/compress/zstd/decoder.go +++ b/vendor/github.com/klauspost/compress/zstd/decoder.go @@ -5,9 +5,13 @@ package zstd import ( - "errors" + "bytes" + "context" + "encoding/binary" "io" "sync" + + "github.com/klauspost/compress/zstd/internal/xxhash" ) // Decoder provides decoding of zstandard streams. @@ -22,12 +26,19 @@ type Decoder struct { // Unreferenced decoders, ready for use. decoders chan *blockDec - // Streams ready to be decoded. - stream chan decodeStream - // Current read position used for Reader functionality. current decoderState + // sync stream decoding + syncStream struct { + decodedFrame uint64 + br readerWrapper + enabled bool + inFrame bool + } + + frame *frameDec + // Custom dictionaries. // Always uses copies. dicts map[uint32]dict @@ -46,7 +57,10 @@ type decoderState struct { output chan decodeOutput // cancel remaining output. - cancel chan struct{} + cancel context.CancelFunc + + // crc of current frame + crc *xxhash.Digest flushed bool } @@ -81,7 +95,7 @@ func NewReader(r io.Reader, opts ...DOption) (*Decoder, error) { return nil, err } } - d.current.output = make(chan decodeOutput, d.o.concurrent) + d.current.crc = xxhash.New() d.current.flushed = true if r == nil { @@ -113,9 +127,6 @@ func NewReader(r io.Reader, opts ...DOption) (*Decoder, error) { // Returns the number of bytes written and any error that occurred. // When the stream is done, io.EOF will be returned. func (d *Decoder) Read(p []byte) (int, error) { - if d.stream == nil { - return 0, ErrDecoderNilInput - } var n int for { if len(d.current.b) > 0 { @@ -133,12 +144,12 @@ func (d *Decoder) Read(p []byte) (int, error) { break } if !d.nextBlock(n == 0) { - return n, nil + return n, d.current.err } } } if len(d.current.b) > 0 { - if debug { + if debugDecoder { println("returning", n, "still bytes left:", len(d.current.b)) } // Only return error at end of block @@ -147,7 +158,7 @@ func (d *Decoder) Read(p []byte) (int, error) { if d.current.err != nil { d.drainOutput() } - if debug { + if debugDecoder { println("returning", n, d.current.err, len(d.decoders)) } return n, d.current.err @@ -165,23 +176,20 @@ func (d *Decoder) Reset(r io.Reader) error { d.drainOutput() + d.syncStream.br.r = nil if r == nil { d.current.err = ErrDecoderNilInput + if len(d.current.b) > 0 { + d.current.b = d.current.b[:0] + } d.current.flushed = true return nil } - if d.stream == nil { - d.stream = make(chan decodeStream, 1) - d.streamWg.Add(1) - go d.startStreamDecoder(d.stream) - } - - // If bytes buffer and < 1MB, do sync decoding anyway. - if bb, ok := r.(byter); ok && bb.Len() < 1<<20 { - var bb2 byter - bb2 = bb - if debug { + // If bytes buffer and < 5MB, do sync decoding anyway. + if bb, ok := r.(byter); ok && bb.Len() < 5<<20 { + bb2 := bb + if debugDecoder { println("*bytes.Buffer detected, doing sync decode, len:", bb.Len()) } b := bb2.Bytes() @@ -197,36 +205,48 @@ func (d *Decoder) Reset(r io.Reader) error { d.current.b = dst d.current.err = err d.current.flushed = true - if debug { + if debugDecoder { println("sync decode to", len(dst), "bytes, err:", err) } return nil } - // Remove current block. + d.stashDecoder() d.current.decodeOutput = decodeOutput{} d.current.err = nil - d.current.cancel = make(chan struct{}) d.current.flushed = false d.current.d = nil - d.stream <- decodeStream{ - r: r, - output: d.current.output, - cancel: d.current.cancel, + // Ensure no-one else is still running... + d.streamWg.Wait() + if d.frame == nil { + d.frame = newFrameDec(d.o) + } + + if d.o.concurrent == 1 { + return d.startSyncDecoder(r) } + + d.current.output = make(chan decodeOutput, d.o.concurrent) + ctx, cancel := context.WithCancel(context.Background()) + d.current.cancel = cancel + d.streamWg.Add(1) + go d.startStreamDecoder(ctx, r, d.current.output) + return nil } // drainOutput will drain the output until errEndOfStream is sent. func (d *Decoder) drainOutput() { if d.current.cancel != nil { - println("cancelling current") - close(d.current.cancel) + if debugDecoder { + println("cancelling current") + } + d.current.cancel() d.current.cancel = nil } if d.current.d != nil { - if debug { + if debugDecoder { printf("re-adding current decoder %p, decoders: %d", d.current.d, len(d.decoders)) } d.decoders <- d.current.d @@ -237,39 +257,31 @@ func (d *Decoder) drainOutput() { println("current already flushed") return } - for { - select { - case v := <-d.current.output: - if v.d != nil { - if debug { - printf("re-adding decoder %p", v.d) - } - d.decoders <- v.d - } - if v.err == errEndOfStream { - println("current flushed") - d.current.flushed = true - return + for v := range d.current.output { + if v.d != nil { + if debugDecoder { + printf("re-adding decoder %p", v.d) } + d.decoders <- v.d } } + d.current.output = nil + d.current.flushed = true } // WriteTo writes data to w until there's no more data to write or when an error occurs. // The return value n is the number of bytes written. // Any error encountered during the write is also returned. func (d *Decoder) WriteTo(w io.Writer) (int64, error) { - if d.stream == nil { - return 0, ErrDecoderNilInput - } var n int64 for { if len(d.current.b) > 0 { n2, err2 := w.Write(d.current.b) n += int64(n2) - if err2 != nil && d.current.err == nil { + if err2 != nil && (d.current.err == nil || d.current.err == io.EOF) { d.current.err = err2 - break + } else if n2 != len(d.current.b) { + d.current.err = io.ErrShortWrite } } if d.current.err != nil { @@ -293,7 +305,7 @@ func (d *Decoder) WriteTo(w io.Writer) (int64, error) { // DecodeAll can be used concurrently. // The Decoder concurrency limits will be respected. func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { - if d.current.err == ErrDecoderClosed { + if d.decoders == nil { return dst, ErrDecoderClosed } @@ -301,11 +313,14 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { block := <-d.decoders frame := block.localFrame defer func() { - if debug { + if debugDecoder { printf("re-adding decoder: %p", block) } frame.rawInput = nil frame.bBuf = nil + if frame.history.decoders.br != nil { + frame.history.decoders.br.in = nil + } d.decoders <- block }() frame.bBuf = input @@ -313,33 +328,42 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { for { frame.history.reset() err := frame.reset(&frame.bBuf) - if err == io.EOF { - if debug { - println("frame reset return EOF") + if err != nil { + if err == io.EOF { + if debugDecoder { + println("frame reset return EOF") + } + return dst, nil } - return dst, nil + return dst, err } if frame.DictionaryID != nil { dict, ok := d.dicts[*frame.DictionaryID] if !ok { return nil, ErrUnknownDictionary } + if debugDecoder { + println("setting dict", frame.DictionaryID) + } frame.history.setDict(&dict) } - if err != nil { - return dst, err - } - if frame.FrameContentSize > d.o.maxDecodedSize-uint64(len(dst)) { - return dst, ErrDecoderSizeExceeded + if frame.WindowSize > d.o.maxWindowSize { + if debugDecoder { + println("window size exceeded:", frame.WindowSize, ">", d.o.maxWindowSize) + } + return dst, ErrWindowSizeExceeded } - if frame.FrameContentSize > 0 && frame.FrameContentSize < 1<<30 { - // Never preallocate moe than 1 GB up front. + if frame.FrameContentSize != fcsUnknown { + if frame.FrameContentSize > d.o.maxDecodedSize-uint64(len(dst)) { + return dst, ErrDecoderSizeExceeded + } if cap(dst)-len(dst) < int(frame.FrameContentSize) { - dst2 := make([]byte, len(dst), len(dst)+int(frame.FrameContentSize)) + dst2 := make([]byte, len(dst), len(dst)+int(frame.FrameContentSize)+compressedBlockOverAlloc) copy(dst2, dst) dst = dst2 } } + if cap(dst) == 0 { // Allocate len(input) * 2 by default if nothing is provided // and we didn't get frame content size. @@ -359,7 +383,7 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { return dst, err } if len(frame.bBuf) == 0 { - if debug { + if debugDecoder { println("frame dbuf empty") } break @@ -374,33 +398,176 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { // If non-blocking mode is used the returned boolean will be false // if no data was available without blocking. func (d *Decoder) nextBlock(blocking bool) (ok bool) { - if d.current.d != nil { - if debug { - printf("re-adding current decoder %p", d.current.d) - } - d.decoders <- d.current.d - d.current.d = nil - } if d.current.err != nil { // Keep error state. - return blocking + return false } + d.current.b = d.current.b[:0] + // SYNC: + if d.syncStream.enabled { + if !blocking { + return false + } + ok = d.nextBlockSync() + if !ok { + d.stashDecoder() + } + return ok + } + + //ASYNC: + d.stashDecoder() if blocking { - d.current.decodeOutput = <-d.current.output + d.current.decodeOutput, ok = <-d.current.output } else { select { - case d.current.decodeOutput = <-d.current.output: + case d.current.decodeOutput, ok = <-d.current.output: default: return false } } - if debug { - println("got", len(d.current.b), "bytes, error:", d.current.err) + if !ok { + // This should not happen, so signal error state... + d.current.err = io.ErrUnexpectedEOF + return false + } + next := d.current.decodeOutput + if next.d != nil && next.d.async.newHist != nil { + d.current.crc.Reset() + } + if debugDecoder { + var tmp [4]byte + binary.LittleEndian.PutUint32(tmp[:], uint32(xxhash.Sum64(next.b))) + println("got", len(d.current.b), "bytes, error:", d.current.err, "data crc:", tmp) + } + + if !d.o.ignoreChecksum && len(next.b) > 0 { + n, err := d.current.crc.Write(next.b) + if err == nil { + if n != len(next.b) { + d.current.err = io.ErrShortWrite + } + } + } + if next.err == nil && next.d != nil && len(next.d.checkCRC) != 0 { + got := d.current.crc.Sum64() + var tmp [4]byte + binary.LittleEndian.PutUint32(tmp[:], uint32(got)) + if !d.o.ignoreChecksum && !bytes.Equal(tmp[:], next.d.checkCRC) { + if debugDecoder { + println("CRC Check Failed:", tmp[:], " (got) !=", next.d.checkCRC, "(on stream)") + } + d.current.err = ErrCRCMismatch + } else { + if debugDecoder { + println("CRC ok", tmp[:]) + } + } + } + + return true +} + +func (d *Decoder) nextBlockSync() (ok bool) { + if d.current.d == nil { + d.current.d = <-d.decoders + } + for len(d.current.b) == 0 { + if !d.syncStream.inFrame { + d.frame.history.reset() + d.current.err = d.frame.reset(&d.syncStream.br) + if d.current.err != nil { + return false + } + if d.frame.DictionaryID != nil { + dict, ok := d.dicts[*d.frame.DictionaryID] + if !ok { + d.current.err = ErrUnknownDictionary + return false + } else { + d.frame.history.setDict(&dict) + } + } + if d.frame.WindowSize > d.o.maxDecodedSize || d.frame.WindowSize > d.o.maxWindowSize { + d.current.err = ErrDecoderSizeExceeded + return false + } + + d.syncStream.decodedFrame = 0 + d.syncStream.inFrame = true + } + d.current.err = d.frame.next(d.current.d) + if d.current.err != nil { + return false + } + d.frame.history.ensureBlock() + if debugDecoder { + println("History trimmed:", len(d.frame.history.b), "decoded already:", d.syncStream.decodedFrame) + } + histBefore := len(d.frame.history.b) + d.current.err = d.current.d.decodeBuf(&d.frame.history) + + if d.current.err != nil { + println("error after:", d.current.err) + return false + } + d.current.b = d.frame.history.b[histBefore:] + if debugDecoder { + println("history after:", len(d.frame.history.b)) + } + + // Check frame size (before CRC) + d.syncStream.decodedFrame += uint64(len(d.current.b)) + if d.syncStream.decodedFrame > d.frame.FrameContentSize { + if debugDecoder { + printf("DecodedFrame (%d) > FrameContentSize (%d)\n", d.syncStream.decodedFrame, d.frame.FrameContentSize) + } + d.current.err = ErrFrameSizeExceeded + return false + } + + // Check FCS + if d.current.d.Last && d.frame.FrameContentSize != fcsUnknown && d.syncStream.decodedFrame != d.frame.FrameContentSize { + if debugDecoder { + printf("DecodedFrame (%d) != FrameContentSize (%d)\n", d.syncStream.decodedFrame, d.frame.FrameContentSize) + } + d.current.err = ErrFrameSizeMismatch + return false + } + + // Update/Check CRC + if d.frame.HasCheckSum { + if !d.o.ignoreChecksum { + d.frame.crc.Write(d.current.b) + } + if d.current.d.Last { + if !d.o.ignoreChecksum { + d.current.err = d.frame.checkCRC() + } else { + d.current.err = d.frame.consumeCRC() + } + if d.current.err != nil { + println("CRC error:", d.current.err) + return false + } + } + } + d.syncStream.inFrame = !d.current.d.Last } return true } +func (d *Decoder) stashDecoder() { + if d.current.d != nil { + if debugDecoder { + printf("re-adding current decoder %p", d.current.d) + } + d.decoders <- d.current.d + d.current.d = nil + } +} + // Close will release all resources. // It is NOT possible to reuse the decoder after this. func (d *Decoder) Close() { @@ -408,10 +575,10 @@ func (d *Decoder) Close() { return } d.drainOutput() - if d.stream != nil { - close(d.stream) + if d.current.cancel != nil { + d.current.cancel() d.streamWg.Wait() - d.stream = nil + d.current.cancel = nil } if d.decoders != nil { close(d.decoders) @@ -462,100 +629,296 @@ type decodeOutput struct { err error } -type decodeStream struct { - r io.Reader - - // Blocks ready to be written to output. - output chan decodeOutput - - // cancel reading from the input - cancel chan struct{} +func (d *Decoder) startSyncDecoder(r io.Reader) error { + d.frame.history.reset() + d.syncStream.br = readerWrapper{r: r} + d.syncStream.inFrame = false + d.syncStream.enabled = true + d.syncStream.decodedFrame = 0 + return nil } -// errEndOfStream indicates that everything from the stream was read. -var errEndOfStream = errors.New("end-of-stream") - // Create Decoder: -// Spawn n block decoders. These accept tasks to decode a block. -// Create goroutine that handles stream processing, this will send history to decoders as they are available. -// Decoders update the history as they decode. -// When a block is returned: -// a) history is sent to the next decoder, -// b) content written to CRC. -// c) return data to WRITER. -// d) wait for next block to return data. -// Once WRITTEN, the decoders reused by the writer frame decoder for re-use. -func (d *Decoder) startStreamDecoder(inStream chan decodeStream) { +// ASYNC: +// Spawn 3 go routines. +// 0: Read frames and decode block literals. +// 1: Decode sequences. +// 2: Execute sequences, send to output. +func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output chan decodeOutput) { defer d.streamWg.Done() - frame := newFrameDec(d.o) - for stream := range inStream { - if debug { - println("got new stream") + br := readerWrapper{r: r} + + var seqDecode = make(chan *blockDec, d.o.concurrent) + var seqExecute = make(chan *blockDec, d.o.concurrent) + + // Async 1: Decode sequences... + go func() { + var hist history + var hasErr bool + + for block := range seqDecode { + if hasErr { + if block != nil { + seqExecute <- block + } + continue + } + if block.async.newHist != nil { + if debugDecoder { + println("Async 1: new history, recent:", block.async.newHist.recentOffsets) + } + hist.decoders = block.async.newHist.decoders + hist.recentOffsets = block.async.newHist.recentOffsets + hist.windowSize = block.async.newHist.windowSize + if block.async.newHist.dict != nil { + hist.setDict(block.async.newHist.dict) + } + } + if block.err != nil || block.Type != blockTypeCompressed { + hasErr = block.err != nil + seqExecute <- block + continue + } + + hist.decoders.literals = block.async.literals + block.err = block.prepareSequences(block.async.seqData, &hist) + if debugDecoder && block.err != nil { + println("prepareSequences returned:", block.err) + } + hasErr = block.err != nil + if block.err == nil { + block.err = block.decodeSequences(&hist) + if debugDecoder && block.err != nil { + println("decodeSequences returned:", block.err) + } + hasErr = block.err != nil + // block.async.sequence = hist.decoders.seq[:hist.decoders.nSeqs] + block.async.seqSize = hist.decoders.seqSize + } + seqExecute <- block } - br := readerWrapper{r: stream.r} - decodeStream: - for { - frame.history.reset() - err := frame.reset(&br) - if debug && err != nil { - println("Frame decoder returned", err) + close(seqExecute) + }() + + var wg sync.WaitGroup + wg.Add(1) + + // Async 3: Execute sequences... + frameHistCache := d.frame.history.b + go func() { + var hist history + var decodedFrame uint64 + var fcs uint64 + var hasErr bool + for block := range seqExecute { + out := decodeOutput{err: block.err, d: block} + if block.err != nil || hasErr { + hasErr = true + output <- out + continue } - if err == nil && frame.DictionaryID != nil { - dict, ok := d.dicts[*frame.DictionaryID] - if !ok { - err = ErrUnknownDictionary + if block.async.newHist != nil { + if debugDecoder { + println("Async 2: new history") + } + hist.windowSize = block.async.newHist.windowSize + hist.allocFrameBuffer = block.async.newHist.allocFrameBuffer + if block.async.newHist.dict != nil { + hist.setDict(block.async.newHist.dict) + } + + if cap(hist.b) < hist.allocFrameBuffer { + if cap(frameHistCache) >= hist.allocFrameBuffer { + hist.b = frameHistCache + } else { + hist.b = make([]byte, 0, hist.allocFrameBuffer) + println("Alloc history sized", hist.allocFrameBuffer) + } + } + hist.b = hist.b[:0] + fcs = block.async.fcs + decodedFrame = 0 + } + do := decodeOutput{err: block.err, d: block} + switch block.Type { + case blockTypeRLE: + if debugDecoder { + println("add rle block length:", block.RLESize) + } + + if cap(block.dst) < int(block.RLESize) { + if block.lowMem { + block.dst = make([]byte, block.RLESize) + } else { + block.dst = make([]byte, maxBlockSize) + } + } + block.dst = block.dst[:block.RLESize] + v := block.data[0] + for i := range block.dst { + block.dst[i] = v + } + hist.append(block.dst) + do.b = block.dst + case blockTypeRaw: + if debugDecoder { + println("add raw block length:", len(block.data)) + } + hist.append(block.data) + do.b = block.data + case blockTypeCompressed: + if debugDecoder { + println("execute with history length:", len(hist.b), "window:", hist.windowSize) + } + hist.decoders.seqSize = block.async.seqSize + hist.decoders.literals = block.async.literals + do.err = block.executeSequences(&hist) + hasErr = do.err != nil + if debugDecoder && hasErr { + println("executeSequences returned:", do.err) + } + do.b = block.dst + } + if !hasErr { + decodedFrame += uint64(len(do.b)) + if decodedFrame > fcs { + println("fcs exceeded", block.Last, fcs, decodedFrame) + do.err = ErrFrameSizeExceeded + hasErr = true + } else if block.Last && fcs != fcsUnknown && decodedFrame != fcs { + do.err = ErrFrameSizeMismatch + hasErr = true } else { - frame.history.setDict(&dict) + if debugDecoder { + println("fcs ok", block.Last, fcs, decodedFrame) + } } } - if err != nil { - stream.output <- decodeOutput{ - err: err, + output <- do + } + close(output) + frameHistCache = hist.b + wg.Done() + if debugDecoder { + println("decoder goroutines finished") + } + }() + +decodeStream: + for { + var hist history + var hasErr bool + + decodeBlock := func(block *blockDec) { + if hasErr { + if block != nil { + seqDecode <- block } - break + return } - if debug { - println("starting frame decoder") + if block.err != nil || block.Type != blockTypeCompressed { + hasErr = block.err != nil + seqDecode <- block + return } - // This goroutine will forward history between frames. - frame.frameDone.Add(1) - frame.initAsync() + remain, err := block.decodeLiterals(block.data, &hist) + block.err = err + hasErr = block.err != nil + if err == nil { + block.async.literals = hist.decoders.literals + block.async.seqData = remain + } else if debugDecoder { + println("decodeLiterals error:", err) + } + seqDecode <- block + } + frame := d.frame + if debugDecoder { + println("New frame...") + } + var historySent bool + frame.history.reset() + err := frame.reset(&br) + if debugDecoder && err != nil { + println("Frame decoder returned", err) + } + if err == nil && frame.DictionaryID != nil { + dict, ok := d.dicts[*frame.DictionaryID] + if !ok { + err = ErrUnknownDictionary + } else { + frame.history.setDict(&dict) + } + } + if err == nil && d.frame.WindowSize > d.o.maxWindowSize { + err = ErrDecoderSizeExceeded + } + if err != nil { + select { + case <-ctx.Done(): + case dec := <-d.decoders: + dec.sendErr(err) + decodeBlock(dec) + } + break decodeStream + } - go frame.startDecoder(stream.output) - decodeFrame: - // Go through all blocks of the frame. - for { - dec := <-d.decoders - select { - case <-stream.cancel: - if !frame.sendErr(dec, io.EOF) { - // To not let the decoder dangle, send it back. - stream.output <- decodeOutput{d: dec} - } - break decodeStream - default: + // Go through all blocks of the frame. + for { + var dec *blockDec + select { + case <-ctx.Done(): + break decodeStream + case dec = <-d.decoders: + // Once we have a decoder, we MUST return it. + } + err := frame.next(dec) + if !historySent { + h := frame.history + if debugDecoder { + println("Alloc History:", h.allocFrameBuffer) } - err := frame.next(dec) - switch err { - case io.EOF: - // End of current frame, no error - println("EOF on next block") - break decodeFrame - case nil: - continue - default: - println("block decoder returned", err) - break decodeStream + hist.reset() + if h.dict != nil { + hist.setDict(h.dict) + } + dec.async.newHist = &h + dec.async.fcs = frame.FrameContentSize + historySent = true + } else { + dec.async.newHist = nil + } + if debugDecoder && err != nil { + println("next block returned error:", err) + } + dec.err = err + dec.checkCRC = nil + if dec.Last && frame.HasCheckSum && err == nil { + crc, err := frame.rawInput.readSmall(4) + if err != nil { + println("CRC missing?", err) + dec.err = err } + var tmp [4]byte + copy(tmp[:], crc) + dec.checkCRC = tmp[:] + if debugDecoder { + println("found crc to check:", dec.checkCRC) + } + } + err = dec.err + last := dec.Last + decodeBlock(dec) + if err != nil { + break decodeStream + } + if last { + break } - // All blocks have started decoding, check if there are more frames. - println("waiting for done") - frame.frameDone.Wait() - println("done waiting...") } - frame.frameDone.Wait() - println("Sending EOS") - stream.output <- decodeOutput{err: errEndOfStream} } + close(seqDecode) + wg.Wait() + d.frame.history.b = frameHistCache } diff --git a/vendor/github.com/klauspost/compress/zstd/decoder_options.go b/vendor/github.com/klauspost/compress/zstd/decoder_options.go index 284d38449..c70e6fa0f 100644 --- a/vendor/github.com/klauspost/compress/zstd/decoder_options.go +++ b/vendor/github.com/klauspost/compress/zstd/decoder_options.go @@ -6,7 +6,6 @@ package zstd import ( "errors" - "fmt" "runtime" ) @@ -18,16 +17,22 @@ type decoderOptions struct { lowMem bool concurrent int maxDecodedSize uint64 + maxWindowSize uint64 dicts []dict + ignoreChecksum bool } func (o *decoderOptions) setDefault() { *o = decoderOptions{ // use less ram: true for now, but may change. - lowMem: true, - concurrent: runtime.GOMAXPROCS(0), + lowMem: true, + concurrent: runtime.GOMAXPROCS(0), + maxWindowSize: MaxWindowSize, } - o.maxDecodedSize = 1 << 63 + if o.concurrent > 4 { + o.concurrent = 4 + } + o.maxDecodedSize = 64 << 30 } // WithDecoderLowmem will set whether to use a lower amount of memory, @@ -36,16 +41,25 @@ func WithDecoderLowmem(b bool) DOption { return func(o *decoderOptions) error { o.lowMem = b; return nil } } -// WithDecoderConcurrency will set the concurrency, -// meaning the maximum number of decoders to run concurrently. -// The value supplied must be at least 1. -// By default this will be set to GOMAXPROCS. +// WithDecoderConcurrency sets the number of created decoders. +// When decoding block with DecodeAll, this will limit the number +// of possible concurrently running decodes. +// When decoding streams, this will limit the number of +// inflight blocks. +// When decoding streams and setting maximum to 1, +// no async decoding will be done. +// When a value of 0 is provided GOMAXPROCS will be used. +// By default this will be set to 4 or GOMAXPROCS, whatever is lower. func WithDecoderConcurrency(n int) DOption { return func(o *decoderOptions) error { - if n <= 0 { - return fmt.Errorf("Concurrency must be at least 1") + if n < 0 { + return errors.New("concurrency must be at least 1") + } + if n == 0 { + o.concurrent = runtime.GOMAXPROCS(0) + } else { + o.concurrent = n } - o.concurrent = n return nil } } @@ -53,15 +67,14 @@ func WithDecoderConcurrency(n int) DOption { // WithDecoderMaxMemory allows to set a maximum decoded size for in-memory // non-streaming operations or maximum window size for streaming operations. // This can be used to control memory usage of potentially hostile content. -// For streaming operations, the maximum window size is capped at 1<<30 bytes. -// Maximum and default is 1 << 63 bytes. +// Maximum is 1 << 63 bytes. Default is 64GiB. func WithDecoderMaxMemory(n uint64) DOption { return func(o *decoderOptions) error { if n == 0 { return errors.New("WithDecoderMaxMemory must be at least 1") } if n > 1<<63 { - return fmt.Errorf("WithDecoderMaxmemory must be less than 1 << 63") + return errors.New("WithDecoderMaxmemory must be less than 1 << 63") } o.maxDecodedSize = n return nil @@ -82,3 +95,29 @@ func WithDecoderDicts(dicts ...[]byte) DOption { return nil } } + +// WithDecoderMaxWindow allows to set a maximum window size for decodes. +// This allows rejecting packets that will cause big memory usage. +// The Decoder will likely allocate more memory based on the WithDecoderLowmem setting. +// If WithDecoderMaxMemory is set to a lower value, that will be used. +// Default is 512MB, Maximum is ~3.75 TB as per zstandard spec. +func WithDecoderMaxWindow(size uint64) DOption { + return func(o *decoderOptions) error { + if size < MinWindowSize { + return errors.New("WithMaxWindowSize must be at least 1KB, 1024 bytes") + } + if size > (1<<41)+7*(1<<38) { + return errors.New("WithMaxWindowSize must be less than (1<<41) + 7*(1<<38) ~ 3.75TB") + } + o.maxWindowSize = size + return nil + } +} + +// IgnoreChecksum allows to forcibly ignore checksum checking. +func IgnoreChecksum(b bool) DOption { + return func(o *decoderOptions) error { + o.ignoreChecksum = b + return nil + } +} diff --git a/vendor/github.com/klauspost/compress/zstd/dict.go b/vendor/github.com/klauspost/compress/zstd/dict.go index fa25a18d8..a36ae83ef 100644 --- a/vendor/github.com/klauspost/compress/zstd/dict.go +++ b/vendor/github.com/klauspost/compress/zstd/dict.go @@ -82,7 +82,7 @@ func loadDict(b []byte) (*dict, error) { println("Transform table error:", err) return err } - if debug { + if debugDecoder || debugEncoder { println("Read table ok", "symbolLen:", dec.symbolLen) } // Set decoders as predefined so they aren't reused. diff --git a/vendor/github.com/klauspost/compress/zstd/enc_base.go b/vendor/github.com/klauspost/compress/zstd/enc_base.go index 2d4d893eb..15ae8ee80 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_base.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_base.go @@ -38,8 +38,8 @@ func (e *fastBase) AppendCRC(dst []byte) []byte { // WindowSize returns the window size of the encoder, // or a window size small enough to contain the input size, if > 0. -func (e *fastBase) WindowSize(size int) int32 { - if size > 0 && size < int(e.maxMatchOff) { +func (e *fastBase) WindowSize(size int64) int32 { + if size > 0 && size < int64(e.maxMatchOff) { b := int32(1) << uint(bits.Len(uint(size))) // Keep minimum window. if b < 1024 { @@ -108,11 +108,6 @@ func (e *fastBase) UseBlock(enc *blockEnc) { e.blk = enc } -func (e *fastBase) matchlenNoHist(s, t int32, src []byte) int32 { - // Extend the match to be as long as possible. - return int32(matchLen(src[s:], src[t:])) -} - func (e *fastBase) matchlen(s, t int32, src []byte) int32 { if debugAsserts { if s < 0 { @@ -131,9 +126,24 @@ func (e *fastBase) matchlen(s, t int32, src []byte) int32 { panic(fmt.Sprintf("len(src)-s (%d) > maxCompressedBlockSize (%d)", len(src)-int(s), maxCompressedBlockSize)) } } + a := src[s:] + b := src[t:] + b = b[:len(a)] + end := int32((len(a) >> 3) << 3) + for i := int32(0); i < end; i += 8 { + if diff := load6432(a, i) ^ load6432(b, i); diff != 0 { + return i + int32(bits.TrailingZeros64(diff)>>3) + } + } - // Extend the match to be as long as possible. - return int32(matchLen(src[s:], src[t:])) + a = a[end:] + b = b[end:] + for i := range a { + if a[i] != b[i] { + return int32(i) + end + } + } + return int32(len(a)) + end } // Reset the encoding table. @@ -150,14 +160,15 @@ func (e *fastBase) resetBase(d *dict, singleBlock bool) { } else { e.crc.Reset() } - if (!singleBlock || d.DictContentSize() > 0) && cap(e.hist) < int(e.maxMatchOff*2)+d.DictContentSize() { - l := e.maxMatchOff*2 + int32(d.DictContentSize()) - // Make it at least 1MB. - if l < 1<<20 { - l = 1 << 20 + if d != nil { + low := e.lowMem + if singleBlock { + e.lowMem = true } - e.hist = make([]byte, 0, l) + e.ensureHist(d.DictContentSize() + maxCompressedBlockSize) + e.lowMem = low } + // We offset current position so everything will be out of reach. // If above reset line, history will be purged. if e.cur < bufferReset { diff --git a/vendor/github.com/klauspost/compress/zstd/enc_best.go b/vendor/github.com/klauspost/compress/zstd/enc_best.go index fe3625c5f..96028ecd8 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_best.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_best.go @@ -5,22 +5,61 @@ package zstd import ( + "bytes" "fmt" - "math/bits" + + "github.com/klauspost/compress" ) const ( - bestLongTableBits = 20 // Bits used in the long match table + bestLongTableBits = 22 // Bits used in the long match table bestLongTableSize = 1 << bestLongTableBits // Size of the table + bestLongLen = 8 // Bytes used for table hash // Note: Increasing the short table bits or making the hash shorter // can actually lead to compression degradation since it will 'steal' more from the // long match table and match offsets are quite big. // This greatly depends on the type of input. - bestShortTableBits = 16 // Bits used in the short match table + bestShortTableBits = 18 // Bits used in the short match table bestShortTableSize = 1 << bestShortTableBits // Size of the table + bestShortLen = 4 // Bytes used for table hash + ) +type match struct { + offset int32 + s int32 + length int32 + rep int32 + est int32 +} + +const highScore = 25000 + +// estBits will estimate output bits from predefined tables. +func (m *match) estBits(bitsPerByte int32) { + mlc := mlCode(uint32(m.length - zstdMinMatch)) + var ofc uint8 + if m.rep < 0 { + ofc = ofCode(uint32(m.s-m.offset) + 3) + } else { + ofc = ofCode(uint32(m.rep)) + } + // Cost, excluding + ofTT, mlTT := fsePredefEnc[tableOffsets].ct.symbolTT[ofc], fsePredefEnc[tableMatchLengths].ct.symbolTT[mlc] + + // Add cost of match encoding... + m.est = int32(ofTT.outBits + mlTT.outBits) + m.est += int32(ofTT.deltaNbBits>>16 + mlTT.deltaNbBits>>16) + // Subtract savings compared to literal encoding... + m.est -= (m.length * bitsPerByte) >> 10 + if m.est > 0 { + // Unlikely gain.. + m.length = 0 + m.est = highScore + } +} + // bestFastEncoder uses 2 tables, one for short matches (5 bytes) and one for long matches. // The long match table contains the previous entry with the same hash, // effectively making it a "chain" of length 2. @@ -109,6 +148,14 @@ func (e *bestFastEncoder) Encode(blk *blockEnc, src []byte) { return } + // Use this to estimate literal cost. + // Scaled by 10 bits. + bitsPerByte := int32((compress.ShannonEntropyBits(src) * 1024) / len(src)) + // Huffman can never go < 1 bit/byte + if bitsPerByte < 1024 { + bitsPerByte = 1024 + } + // Override src src = e.hist sLimit := int32(len(src)) - inputMargin @@ -132,7 +179,7 @@ func (e *bestFastEncoder) Encode(blk *blockEnc, src []byte) { } _ = addLiterals - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -145,51 +192,49 @@ encodeLoop: panic("offset0 was 0") } - type match struct { - offset int32 - s int32 - length int32 - rep int32 - } - matchAt := func(offset int32, s int32, first uint32, rep int32) match { - if s-offset >= e.maxMatchOff || load3232(src, offset) != first { - return match{offset: offset, s: s} - } - return match{offset: offset, s: s, length: 4 + e.matchlen(s+4, offset+4, src), rep: rep} - } - bestOf := func(a, b match) match { - aScore := b.s - a.s + a.length - bScore := a.s - b.s + b.length - if a.rep < 0 { - aScore = aScore - int32(bits.Len32(uint32(a.offset)))/8 - } - if b.rep < 0 { - bScore = bScore - int32(bits.Len32(uint32(b.offset)))/8 - } - if aScore >= bScore { + if a.est+(a.s-b.s)*bitsPerByte>>10 < b.est+(b.s-a.s)*bitsPerByte>>10 { return a } return b } const goodEnough = 100 - nextHashL := hash8(cv, bestLongTableBits) - nextHashS := hash4x64(cv, bestShortTableBits) + nextHashL := hashLen(cv, bestLongTableBits, bestLongLen) + nextHashS := hashLen(cv, bestShortTableBits, bestShortLen) candidateL := e.longTable[nextHashL] candidateS := e.table[nextHashS] + matchAt := func(offset int32, s int32, first uint32, rep int32) match { + if s-offset >= e.maxMatchOff || load3232(src, offset) != first { + return match{s: s, est: highScore} + } + if debugAsserts { + if !bytes.Equal(src[s:s+4], src[offset:offset+4]) { + panic(fmt.Sprintf("first match mismatch: %v != %v, first: %08x", src[s:s+4], src[offset:offset+4], first)) + } + } + m := match{offset: offset, s: s, length: 4 + e.matchlen(s+4, offset+4, src), rep: rep} + m.estBits(bitsPerByte) + return m + } + best := bestOf(matchAt(candidateL.offset-e.cur, s, uint32(cv), -1), matchAt(candidateL.prev-e.cur, s, uint32(cv), -1)) best = bestOf(best, matchAt(candidateS.offset-e.cur, s, uint32(cv), -1)) best = bestOf(best, matchAt(candidateS.prev-e.cur, s, uint32(cv), -1)) + if canRepeat && best.length < goodEnough { - best = bestOf(best, matchAt(s-offset1+1, s+1, uint32(cv>>8), 1)) - best = bestOf(best, matchAt(s-offset2+1, s+1, uint32(cv>>8), 2)) - best = bestOf(best, matchAt(s-offset3+1, s+1, uint32(cv>>8), 3)) + cv32 := uint32(cv >> 8) + spp := s + 1 + best = bestOf(best, matchAt(spp-offset1, spp, cv32, 1)) + best = bestOf(best, matchAt(spp-offset2, spp, cv32, 2)) + best = bestOf(best, matchAt(spp-offset3, spp, cv32, 3)) if best.length > 0 { - best = bestOf(best, matchAt(s-offset1+3, s+3, uint32(cv>>24), 1)) - best = bestOf(best, matchAt(s-offset2+3, s+3, uint32(cv>>24), 2)) - best = bestOf(best, matchAt(s-offset3+3, s+3, uint32(cv>>24), 3)) + cv32 = uint32(cv >> 24) + spp += 2 + best = bestOf(best, matchAt(spp-offset1, spp, cv32, 1)) + best = bestOf(best, matchAt(spp-offset2, spp, cv32, 2)) + best = bestOf(best, matchAt(spp-offset3, spp, cv32, 3)) } } // Load next and check... @@ -209,17 +254,43 @@ encodeLoop: } s++ - candidateS = e.table[hash4x64(cv>>8, bestShortTableBits)] + candidateS = e.table[hashLen(cv>>8, bestShortTableBits, bestShortLen)] cv = load6432(src, s) cv2 := load6432(src, s+1) - candidateL = e.longTable[hash8(cv, bestLongTableBits)] - candidateL2 := e.longTable[hash8(cv2, bestLongTableBits)] + candidateL = e.longTable[hashLen(cv, bestLongTableBits, bestLongLen)] + candidateL2 := e.longTable[hashLen(cv2, bestLongTableBits, bestLongLen)] + // Short at s+1 best = bestOf(best, matchAt(candidateS.offset-e.cur, s, uint32(cv), -1)) + // Long at s+1, s+2 best = bestOf(best, matchAt(candidateL.offset-e.cur, s, uint32(cv), -1)) best = bestOf(best, matchAt(candidateL.prev-e.cur, s, uint32(cv), -1)) best = bestOf(best, matchAt(candidateL2.offset-e.cur, s+1, uint32(cv2), -1)) best = bestOf(best, matchAt(candidateL2.prev-e.cur, s+1, uint32(cv2), -1)) + if false { + // Short at s+3. + // Too often worse... + best = bestOf(best, matchAt(e.table[hashLen(cv2>>8, bestShortTableBits, bestShortLen)].offset-e.cur, s+2, uint32(cv2>>8), -1)) + } + // See if we can find a better match by checking where the current best ends. + // Use that offset to see if we can find a better full match. + if sAt := best.s + best.length; sAt < sLimit { + nextHashL := hashLen(load6432(src, sAt), bestLongTableBits, bestLongLen) + candidateEnd := e.longTable[nextHashL] + if pos := candidateEnd.offset - e.cur - best.length; pos >= 0 { + bestEnd := bestOf(best, matchAt(pos, best.s, load3232(src, best.s), -1)) + if pos := candidateEnd.prev - e.cur - best.length; pos >= 0 { + bestEnd = bestOf(bestEnd, matchAt(pos, best.s, load3232(src, best.s), -1)) + } + best = bestEnd + } + } + } + + if debugAsserts { + if !bytes.Equal(src[best.s:best.s+best.length], src[best.offset:best.offset+best.length]) { + panic(fmt.Sprintf("match mismatch: %v != %v", src[best.s:best.s+best.length], src[best.offset:best.offset+best.length])) + } } // We have a match, we can store the forward value @@ -260,7 +331,7 @@ encodeLoop: nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, best.length) } @@ -270,8 +341,8 @@ encodeLoop: off := index0 + e.cur for index0 < s-1 { cv0 := load6432(src, index0) - h0 := hash8(cv0, bestLongTableBits) - h1 := hash4x64(cv0, bestShortTableBits) + h0 := hashLen(cv0, bestLongTableBits, bestLongLen) + h1 := hashLen(cv0, bestShortTableBits, bestShortLen) e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.table[h1] = prevEntry{offset: off, prev: e.table[h1].offset} off++ @@ -297,7 +368,7 @@ encodeLoop: panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) } - if debugAsserts && canRepeat && int(offset1) > len(src) { + if debugAsserts && int(offset1) > len(src) { panic("invalid offset") } @@ -338,8 +409,8 @@ encodeLoop: // every entry for index0 < s-1 { cv0 := load6432(src, index0) - h0 := hash8(cv0, bestLongTableBits) - h1 := hash4x64(cv0, bestShortTableBits) + h0 := hashLen(cv0, bestLongTableBits, bestLongLen) + h1 := hashLen(cv0, bestShortTableBits, bestShortLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.table[h1] = prevEntry{offset: off, prev: e.table[h1].offset} @@ -360,8 +431,8 @@ encodeLoop: } // Store this, since we have it. - nextHashS := hash4x64(cv, bestShortTableBits) - nextHashL := hash8(cv, bestLongTableBits) + nextHashS := hashLen(cv, bestShortTableBits, bestShortLen) + nextHashL := hashLen(cv, bestLongTableBits, bestLongLen) // We have at least 4 byte match. // No need to check backwards. We come straight from a match @@ -398,7 +469,7 @@ encodeLoop: blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) blk.recentOffsets[2] = uint32(offset3) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } } @@ -411,7 +482,7 @@ func (e *bestFastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { e.Encode(blk, src) } -// ResetDict will reset and set a dictionary if not nil +// Reset will reset and set a dictionary if not nil func (e *bestFastEncoder) Reset(d *dict, singleBlock bool) { e.resetBase(d, singleBlock) if d == nil { @@ -427,10 +498,10 @@ func (e *bestFastEncoder) Reset(d *dict, singleBlock bool) { const hashLog = bestShortTableBits cv := load6432(d.content, i-e.maxMatchOff) - nextHash := hash4x64(cv, hashLog) // 0 -> 4 - nextHash1 := hash4x64(cv>>8, hashLog) // 1 -> 5 - nextHash2 := hash4x64(cv>>16, hashLog) // 2 -> 6 - nextHash3 := hash4x64(cv>>24, hashLog) // 3 -> 7 + nextHash := hashLen(cv, hashLog, bestShortLen) // 0 -> 4 + nextHash1 := hashLen(cv>>8, hashLog, bestShortLen) // 1 -> 5 + nextHash2 := hashLen(cv>>16, hashLog, bestShortLen) // 2 -> 6 + nextHash3 := hashLen(cv>>24, hashLog, bestShortLen) // 3 -> 7 e.dictTable[nextHash] = prevEntry{ prev: e.dictTable[nextHash].offset, offset: i, @@ -458,7 +529,7 @@ func (e *bestFastEncoder) Reset(d *dict, singleBlock bool) { } if len(d.content) >= 8 { cv := load6432(d.content, 0) - h := hash8(cv, bestLongTableBits) + h := hashLen(cv, bestLongTableBits, bestLongLen) e.dictLongTable[h] = prevEntry{ offset: e.maxMatchOff, prev: e.dictLongTable[h].offset, @@ -468,7 +539,7 @@ func (e *bestFastEncoder) Reset(d *dict, singleBlock bool) { off := 8 // First to read for i := e.maxMatchOff + 1; i < end; i++ { cv = cv>>8 | (uint64(d.content[off]) << 56) - h := hash8(cv, bestLongTableBits) + h := hashLen(cv, bestLongTableBits, bestLongLen) e.dictLongTable[h] = prevEntry{ offset: i, prev: e.dictLongTable[h].offset, diff --git a/vendor/github.com/klauspost/compress/zstd/enc_better.go b/vendor/github.com/klauspost/compress/zstd/enc_better.go index c2ce4a2ba..c769f6941 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_better.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_better.go @@ -9,6 +9,7 @@ import "fmt" const ( betterLongTableBits = 19 // Bits used in the long match table betterLongTableSize = 1 << betterLongTableBits // Size of the table + betterLongLen = 8 // Bytes used for table hash // Note: Increasing the short table bits or making the hash shorter // can actually lead to compression degradation since it will 'steal' more from the @@ -16,6 +17,7 @@ const ( // This greatly depends on the type of input. betterShortTableBits = 13 // Bits used in the short match table betterShortTableSize = 1 << betterShortTableBits // Size of the table + betterShortLen = 5 // Bytes used for table hash betterLongTableShardCnt = 1 << (betterLongTableBits - dictShardBits) // Number of shards in the table betterLongTableShardSize = betterLongTableSize / betterLongTableShardCnt // Size of an individual shard @@ -138,7 +140,7 @@ func (e *betterFastEncoder) Encode(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -154,8 +156,8 @@ encodeLoop: panic("offset0 was 0") } - nextHashS := hash5(cv, betterShortTableBits) - nextHashL := hash8(cv, betterLongTableBits) + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) candidateL := e.longTable[nextHashL] candidateS := e.table[nextHashS] @@ -204,7 +206,7 @@ encodeLoop: nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, lenght) } @@ -214,10 +216,10 @@ encodeLoop: for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 - h0 := hash8(cv0, betterLongTableBits) + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} - e.table[hash5(cv1, betterShortTableBits)] = tableEntry{offset: off + 1, val: uint32(cv1)} + e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} index0 += 2 } cv = load6432(src, s) @@ -264,7 +266,7 @@ encodeLoop: s += lenght + repOff2 nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, lenght) } @@ -275,10 +277,10 @@ encodeLoop: for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 - h0 := hash8(cv0, betterLongTableBits) + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} - e.table[hash5(cv1, betterShortTableBits)] = tableEntry{offset: off + 1, val: uint32(cv1)} + e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} index0 += 2 } cv = load6432(src, s) @@ -353,7 +355,7 @@ encodeLoop: // See if we can find a long match at s+1 const checkAt = 1 cv := load6432(src, s+checkAt) - nextHashL = hash8(cv, betterLongTableBits) + nextHashL = hashLen(cv, betterLongTableBits, betterLongLen) candidateL = e.longTable[nextHashL] coffsetL = candidateL.offset - e.cur @@ -412,8 +414,41 @@ encodeLoop: cv = load6432(src, s) } - // A 4-byte match has been found. Update recent offsets. - // We'll later see if more than 4 bytes. + // Try to find a better match by searching for a long match at the end of the current best match + if s+matched < sLimit { + nextHashL := hashLen(load6432(src, s+matched), betterLongTableBits, betterLongLen) + cv := load3232(src, s) + candidateL := e.longTable[nextHashL] + coffsetL := candidateL.offset - e.cur - matched + if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + matched = matchedNext + if debugMatches { + println("long match at end-of-match") + } + } + } + + // Check prev long... + if true { + coffsetL = candidateL.prev - e.cur - matched + if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + matched = matchedNext + if debugMatches { + println("prev long match at end-of-match") + } + } + } + } + } + // A match has been found. Update recent offsets. offset2 = offset1 offset1 = s - t @@ -462,10 +497,10 @@ encodeLoop: for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 - h0 := hash8(cv0, betterLongTableBits) + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} - e.table[hash5(cv1, betterShortTableBits)] = tableEntry{offset: off + 1, val: uint32(cv1)} + e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} index0 += 2 } @@ -483,8 +518,8 @@ encodeLoop: } // Store this, since we have it. - nextHashS := hash5(cv, betterShortTableBits) - nextHashL := hash8(cv, betterLongTableBits) + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) // We have at least 4 byte match. // No need to check backwards. We come straight from a match @@ -520,7 +555,7 @@ encodeLoop: } blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } } @@ -623,7 +658,7 @@ func (e *betterFastEncoderDict) Encode(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -639,8 +674,8 @@ encodeLoop: panic("offset0 was 0") } - nextHashS := hash5(cv, betterShortTableBits) - nextHashL := hash8(cv, betterLongTableBits) + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) candidateL := e.longTable[nextHashL] candidateS := e.table[nextHashS] @@ -691,7 +726,7 @@ encodeLoop: nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, lenght) } @@ -701,11 +736,11 @@ encodeLoop: for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 - h0 := hash8(cv0, betterLongTableBits) + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.markLongShardDirty(h0) - h1 := hash5(cv1, betterShortTableBits) + h1 := hashLen(cv1, betterShortTableBits, betterShortLen) e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} e.markShortShardDirty(h1) index0 += 2 @@ -754,7 +789,7 @@ encodeLoop: s += lenght + repOff2 nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, lenght) } @@ -765,11 +800,11 @@ encodeLoop: for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 - h0 := hash8(cv0, betterLongTableBits) + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.markLongShardDirty(h0) - h1 := hash5(cv1, betterShortTableBits) + h1 := hashLen(cv1, betterShortTableBits, betterShortLen) e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} e.markShortShardDirty(h1) index0 += 2 @@ -846,7 +881,7 @@ encodeLoop: // See if we can find a long match at s+1 const checkAt = 1 cv := load6432(src, s+checkAt) - nextHashL = hash8(cv, betterLongTableBits) + nextHashL = hashLen(cv, betterLongTableBits, betterLongLen) candidateL = e.longTable[nextHashL] coffsetL = candidateL.offset - e.cur @@ -905,9 +940,41 @@ encodeLoop: } cv = load6432(src, s) } + // Try to find a better match by searching for a long match at the end of the current best match + if s+matched < sLimit { + nextHashL := hashLen(load6432(src, s+matched), betterLongTableBits, betterLongLen) + cv := load3232(src, s) + candidateL := e.longTable[nextHashL] + coffsetL := candidateL.offset - e.cur - matched + if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + matched = matchedNext + if debugMatches { + println("long match at end-of-match") + } + } + } - // A 4-byte match has been found. Update recent offsets. - // We'll later see if more than 4 bytes. + // Check prev long... + if true { + coffsetL = candidateL.prev - e.cur - matched + if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + matched = matchedNext + if debugMatches { + println("prev long match at end-of-match") + } + } + } + } + } + // A match has been found. Update recent offsets. offset2 = offset1 offset1 = s - t @@ -956,11 +1023,11 @@ encodeLoop: for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 - h0 := hash8(cv0, betterLongTableBits) + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.markLongShardDirty(h0) - h1 := hash5(cv1, betterShortTableBits) + h1 := hashLen(cv1, betterShortTableBits, betterShortLen) e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} e.markShortShardDirty(h1) index0 += 2 @@ -980,8 +1047,8 @@ encodeLoop: } // Store this, since we have it. - nextHashS := hash5(cv, betterShortTableBits) - nextHashL := hash8(cv, betterLongTableBits) + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) // We have at least 4 byte match. // No need to check backwards. We come straight from a match @@ -1019,7 +1086,7 @@ encodeLoop: } blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } } @@ -1048,10 +1115,10 @@ func (e *betterFastEncoderDict) Reset(d *dict, singleBlock bool) { const hashLog = betterShortTableBits cv := load6432(d.content, i-e.maxMatchOff) - nextHash := hash5(cv, hashLog) // 0 -> 4 - nextHash1 := hash5(cv>>8, hashLog) // 1 -> 5 - nextHash2 := hash5(cv>>16, hashLog) // 2 -> 6 - nextHash3 := hash5(cv>>24, hashLog) // 3 -> 7 + nextHash := hashLen(cv, hashLog, betterShortLen) // 0 -> 4 + nextHash1 := hashLen(cv>>8, hashLog, betterShortLen) // 1 -> 5 + nextHash2 := hashLen(cv>>16, hashLog, betterShortLen) // 2 -> 6 + nextHash3 := hashLen(cv>>24, hashLog, betterShortLen) // 3 -> 7 e.dictTable[nextHash] = tableEntry{ val: uint32(cv), offset: i, @@ -1080,7 +1147,7 @@ func (e *betterFastEncoderDict) Reset(d *dict, singleBlock bool) { } if len(d.content) >= 8 { cv := load6432(d.content, 0) - h := hash8(cv, betterLongTableBits) + h := hashLen(cv, betterLongTableBits, betterLongLen) e.dictLongTable[h] = prevEntry{ offset: e.maxMatchOff, prev: e.dictLongTable[h].offset, @@ -1090,7 +1157,7 @@ func (e *betterFastEncoderDict) Reset(d *dict, singleBlock bool) { off := 8 // First to read for i := e.maxMatchOff + 1; i < end; i++ { cv = cv>>8 | (uint64(d.content[off]) << 56) - h := hash8(cv, betterLongTableBits) + h := hashLen(cv, betterLongTableBits, betterLongLen) e.dictLongTable[h] = prevEntry{ offset: i, prev: e.dictLongTable[h].offset, diff --git a/vendor/github.com/klauspost/compress/zstd/enc_dfast.go b/vendor/github.com/klauspost/compress/zstd/enc_dfast.go index 8629d43d8..7ff0c64fa 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_dfast.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_dfast.go @@ -10,6 +10,7 @@ const ( dFastLongTableBits = 17 // Bits used in the long match table dFastLongTableSize = 1 << dFastLongTableBits // Size of the table dFastLongTableMask = dFastLongTableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. + dFastLongLen = 8 // Bytes used for table hash dLongTableShardCnt = 1 << (dFastLongTableBits - dictShardBits) // Number of shards in the table dLongTableShardSize = dFastLongTableSize / tableShardCnt // Size of an individual shard @@ -17,6 +18,8 @@ const ( dFastShortTableBits = tableBits // Bits used in the short match table dFastShortTableSize = 1 << dFastShortTableBits // Size of the table dFastShortTableMask = dFastShortTableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. + dFastShortLen = 5 // Bytes used for table hash + ) type doubleFastEncoder struct { @@ -109,7 +112,7 @@ func (e *doubleFastEncoder) Encode(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -124,8 +127,8 @@ encodeLoop: panic("offset0 was 0") } - nextHashS := hash5(cv, dFastShortTableBits) - nextHashL := hash8(cv, dFastLongTableBits) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) candidateL := e.longTable[nextHashL] candidateS := e.table[nextHashS] @@ -170,7 +173,7 @@ encodeLoop: s += lenght + repOff nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, lenght) } @@ -208,7 +211,7 @@ encodeLoop: // See if we can find a long match at s+1 const checkAt = 1 cv := load6432(src, s+checkAt) - nextHashL = hash8(cv, dFastLongTableBits) + nextHashL = hashLen(cv, dFastLongTableBits, dFastLongLen) candidateL = e.longTable[nextHashL] coffsetL = s - (candidateL.offset - e.cur) + checkAt @@ -304,16 +307,16 @@ encodeLoop: cv1 := load6432(src, index1) te0 := tableEntry{offset: index0 + e.cur, val: uint32(cv0)} te1 := tableEntry{offset: index1 + e.cur, val: uint32(cv1)} - e.longTable[hash8(cv0, dFastLongTableBits)] = te0 - e.longTable[hash8(cv1, dFastLongTableBits)] = te1 + e.longTable[hashLen(cv0, dFastLongTableBits, dFastLongLen)] = te0 + e.longTable[hashLen(cv1, dFastLongTableBits, dFastLongLen)] = te1 cv0 >>= 8 cv1 >>= 8 te0.offset++ te1.offset++ te0.val = uint32(cv0) te1.val = uint32(cv1) - e.table[hash5(cv0, dFastShortTableBits)] = te0 - e.table[hash5(cv1, dFastShortTableBits)] = te1 + e.table[hashLen(cv0, dFastShortTableBits, dFastShortLen)] = te0 + e.table[hashLen(cv1, dFastShortTableBits, dFastShortLen)] = te1 cv = load6432(src, s) @@ -330,8 +333,8 @@ encodeLoop: } // Store this, since we have it. - nextHashS := hash5(cv, dFastShortTableBits) - nextHashL := hash8(cv, dFastLongTableBits) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) // We have at least 4 byte match. // No need to check backwards. We come straight from a match @@ -368,7 +371,7 @@ encodeLoop: } blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } } @@ -427,7 +430,7 @@ func (e *doubleFastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -436,8 +439,8 @@ encodeLoop: var t int32 for { - nextHashS := hash5(cv, dFastShortTableBits) - nextHashL := hash8(cv, dFastLongTableBits) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) candidateL := e.longTable[nextHashL] candidateS := e.table[nextHashS] @@ -483,7 +486,7 @@ encodeLoop: s += length + repOff nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, length) } @@ -521,7 +524,7 @@ encodeLoop: // See if we can find a long match at s+1 const checkAt = 1 cv := load6432(src, s+checkAt) - nextHashL = hash8(cv, dFastLongTableBits) + nextHashL = hashLen(cv, dFastLongTableBits, dFastLongLen) candidateL = e.longTable[nextHashL] coffsetL = s - (candidateL.offset - e.cur) + checkAt @@ -614,16 +617,16 @@ encodeLoop: cv1 := load6432(src, index1) te0 := tableEntry{offset: index0 + e.cur, val: uint32(cv0)} te1 := tableEntry{offset: index1 + e.cur, val: uint32(cv1)} - e.longTable[hash8(cv0, dFastLongTableBits)] = te0 - e.longTable[hash8(cv1, dFastLongTableBits)] = te1 + e.longTable[hashLen(cv0, dFastLongTableBits, dFastLongLen)] = te0 + e.longTable[hashLen(cv1, dFastLongTableBits, dFastLongLen)] = te1 cv0 >>= 8 cv1 >>= 8 te0.offset++ te1.offset++ te0.val = uint32(cv0) te1.val = uint32(cv1) - e.table[hash5(cv0, dFastShortTableBits)] = te0 - e.table[hash5(cv1, dFastShortTableBits)] = te1 + e.table[hashLen(cv0, dFastShortTableBits, dFastShortLen)] = te0 + e.table[hashLen(cv1, dFastShortTableBits, dFastShortLen)] = te1 cv = load6432(src, s) @@ -640,8 +643,8 @@ encodeLoop: } // Store this, since we have it. - nextHashS := hash5(cv1>>8, dFastShortTableBits) - nextHashL := hash8(cv, dFastLongTableBits) + nextHashS := hashLen(cv1>>8, dFastShortTableBits, dFastShortLen) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) // We have at least 4 byte match. // No need to check backwards. We come straight from a match @@ -677,7 +680,7 @@ encodeLoop: blk.literals = append(blk.literals, src[nextEmit:]...) blk.extraLits = len(src) - int(nextEmit) } - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } @@ -767,7 +770,7 @@ func (e *doubleFastEncoderDict) Encode(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -782,8 +785,8 @@ encodeLoop: panic("offset0 was 0") } - nextHashS := hash5(cv, dFastShortTableBits) - nextHashL := hash8(cv, dFastLongTableBits) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) candidateL := e.longTable[nextHashL] candidateS := e.table[nextHashS] @@ -830,7 +833,7 @@ encodeLoop: s += lenght + repOff nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, lenght) } @@ -868,7 +871,7 @@ encodeLoop: // See if we can find a long match at s+1 const checkAt = 1 cv := load6432(src, s+checkAt) - nextHashL = hash8(cv, dFastLongTableBits) + nextHashL = hashLen(cv, dFastLongTableBits, dFastLongLen) candidateL = e.longTable[nextHashL] coffsetL = s - (candidateL.offset - e.cur) + checkAt @@ -965,8 +968,8 @@ encodeLoop: cv1 := load6432(src, index1) te0 := tableEntry{offset: index0 + e.cur, val: uint32(cv0)} te1 := tableEntry{offset: index1 + e.cur, val: uint32(cv1)} - longHash1 := hash8(cv0, dFastLongTableBits) - longHash2 := hash8(cv0, dFastLongTableBits) + longHash1 := hashLen(cv0, dFastLongTableBits, dFastLongLen) + longHash2 := hashLen(cv1, dFastLongTableBits, dFastLongLen) e.longTable[longHash1] = te0 e.longTable[longHash2] = te1 e.markLongShardDirty(longHash1) @@ -977,8 +980,8 @@ encodeLoop: te1.offset++ te0.val = uint32(cv0) te1.val = uint32(cv1) - hashVal1 := hash5(cv0, dFastShortTableBits) - hashVal2 := hash5(cv1, dFastShortTableBits) + hashVal1 := hashLen(cv0, dFastShortTableBits, dFastShortLen) + hashVal2 := hashLen(cv1, dFastShortTableBits, dFastShortLen) e.table[hashVal1] = te0 e.markShardDirty(hashVal1) e.table[hashVal2] = te1 @@ -999,8 +1002,8 @@ encodeLoop: } // Store this, since we have it. - nextHashS := hash5(cv, dFastShortTableBits) - nextHashL := hash8(cv, dFastLongTableBits) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) // We have at least 4 byte match. // No need to check backwards. We come straight from a match @@ -1039,7 +1042,7 @@ encodeLoop: } blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } // If we encoded more than 64K mark all dirty. @@ -1071,14 +1074,14 @@ func (e *doubleFastEncoderDict) Reset(d *dict, singleBlock bool) { } if len(d.content) >= 8 { cv := load6432(d.content, 0) - e.dictLongTable[hash8(cv, dFastLongTableBits)] = tableEntry{ + e.dictLongTable[hashLen(cv, dFastLongTableBits, dFastLongLen)] = tableEntry{ val: uint32(cv), offset: e.maxMatchOff, } end := int32(len(d.content)) - 8 + e.maxMatchOff for i := e.maxMatchOff + 1; i < end; i++ { cv = cv>>8 | (uint64(d.content[i-e.maxMatchOff+7]) << 56) - e.dictLongTable[hash8(cv, dFastLongTableBits)] = tableEntry{ + e.dictLongTable[hashLen(cv, dFastLongTableBits, dFastLongLen)] = tableEntry{ val: uint32(cv), offset: i, } diff --git a/vendor/github.com/klauspost/compress/zstd/enc_fast.go b/vendor/github.com/klauspost/compress/zstd/enc_fast.go index ba4a17e10..f51ab529a 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_fast.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_fast.go @@ -6,17 +6,16 @@ package zstd import ( "fmt" - "math" - "math/bits" ) const ( - tableBits = 15 // Bits used in the table - tableSize = 1 << tableBits // Size of the table - tableShardCnt = 1 << (tableBits - dictShardBits) // Number of shards in the table - tableShardSize = tableSize / tableShardCnt // Size of an individual shard - tableMask = tableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. - maxMatchLength = 131074 + tableBits = 15 // Bits used in the table + tableSize = 1 << tableBits // Size of the table + tableShardCnt = 1 << (tableBits - dictShardBits) // Number of shards in the table + tableShardSize = tableSize / tableShardCnt // Size of an individual shard + tableFastHashLen = 6 + tableMask = tableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. + maxMatchLength = 131074 ) type tableEntry struct { @@ -86,7 +85,7 @@ func (e *fastEncoder) Encode(blk *blockEnc, src []byte) { // TEMPLATE const hashLog = tableBits // seems global, but would be nice to tweak. - const kSearchStrength = 7 + const kSearchStrength = 6 // nextEmit is where in src the next emitLiteral should start from. nextEmit := s @@ -103,7 +102,7 @@ func (e *fastEncoder) Encode(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -122,8 +121,8 @@ encodeLoop: panic("offset0 was 0") } - nextHash := hash6(cv, hashLog) - nextHash2 := hash6(cv>>8, hashLog) + nextHash := hashLen(cv, hashLog, tableFastHashLen) + nextHash2 := hashLen(cv>>8, hashLog, tableFastHashLen) candidate := e.table[nextHash] candidate2 := e.table[nextHash2] repIndex := s - offset1 + 2 @@ -135,20 +134,7 @@ encodeLoop: // Consider history as well. var seq seq var length int32 - // length = 4 + e.matchlen(s+6, repIndex+4, src) - { - a := src[s+6:] - b := src[repIndex+4:] - endI := len(a) & (math.MaxInt32 - 7) - length = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - length = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } - + length = 4 + e.matchlen(s+6, repIndex+4, src) seq.matchLen = uint32(length - zstdMinMatch) // We might be able to match backwards. @@ -178,7 +164,7 @@ encodeLoop: s += length + 2 nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, length) } @@ -235,20 +221,7 @@ encodeLoop: } // Extend the 4-byte match as long as possible. - //l := e.matchlen(s+4, t+4, src) + 4 - var l int32 - { - a := src[s+4:] - b := src[t+4:] - endI := len(a) & (math.MaxInt32 - 7) - l = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - l = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + l := e.matchlen(s+4, t+4, src) + 4 // Extend backwards tMin := s - e.maxMatchOff @@ -285,23 +258,10 @@ encodeLoop: if o2 := s - offset2; canRepeat && load3232(src, o2) == uint32(cv) { // We have at least 4 byte match. // No need to check backwards. We come straight from a match - //l := 4 + e.matchlen(s+4, o2+4, src) - var l int32 - { - a := src[s+4:] - b := src[o2+4:] - endI := len(a) & (math.MaxInt32 - 7) - l = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - l = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + l := 4 + e.matchlen(s+4, o2+4, src) // Store this, since we have it. - nextHash := hash6(cv, hashLog) + nextHash := hashLen(cv, hashLog, tableFastHashLen) e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} seq.matchLen = uint32(l) - zstdMinMatch seq.litLen = 0 @@ -330,7 +290,7 @@ encodeLoop: } blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } } @@ -343,7 +303,7 @@ func (e *fastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { inputMargin = 8 minNonLiteralBlockSize = 1 + 1 + inputMargin ) - if debug { + if debugEncoder { if len(src) > maxBlockSize { panic("src too big") } @@ -374,7 +334,7 @@ func (e *fastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { // TEMPLATE const hashLog = tableBits // seems global, but would be nice to tweak. - const kSearchStrength = 8 + const kSearchStrength = 6 // nextEmit is where in src the next emitLiteral should start from. nextEmit := s @@ -391,7 +351,7 @@ func (e *fastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -405,8 +365,8 @@ encodeLoop: // By not using them for the first 3 matches for { - nextHash := hash6(cv, hashLog) - nextHash2 := hash6(cv>>8, hashLog) + nextHash := hashLen(cv, hashLog, tableFastHashLen) + nextHash2 := hashLen(cv>>8, hashLog, tableFastHashLen) candidate := e.table[nextHash] candidate2 := e.table[nextHash2] repIndex := s - offset1 + 2 @@ -417,21 +377,7 @@ encodeLoop: if len(blk.sequences) > 2 && load3232(src, repIndex) == uint32(cv>>16) { // Consider history as well. var seq seq - // length := 4 + e.matchlen(s+6, repIndex+4, src) - // length := 4 + int32(matchLen(src[s+6:], src[repIndex+4:])) - var length int32 - { - a := src[s+6:] - b := src[repIndex+4:] - endI := len(a) & (math.MaxInt32 - 7) - length = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - length = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + length := 4 + e.matchlen(s+6, repIndex+4, src) seq.matchLen = uint32(length - zstdMinMatch) @@ -462,7 +408,7 @@ encodeLoop: s += length + 2 nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, length) } @@ -521,21 +467,7 @@ encodeLoop: panic(fmt.Sprintf("t (%d) < 0 ", t)) } // Extend the 4-byte match as long as possible. - //l := e.matchlenNoHist(s+4, t+4, src) + 4 - // l := int32(matchLen(src[s+4:], src[t+4:])) + 4 - var l int32 - { - a := src[s+4:] - b := src[t+4:] - endI := len(a) & (math.MaxInt32 - 7) - l = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - l = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + l := e.matchlen(s+4, t+4, src) + 4 // Extend backwards tMin := s - e.maxMatchOff @@ -572,24 +504,10 @@ encodeLoop: if o2 := s - offset2; len(blk.sequences) > 2 && load3232(src, o2) == uint32(cv) { // We have at least 4 byte match. // No need to check backwards. We come straight from a match - //l := 4 + e.matchlenNoHist(s+4, o2+4, src) - // l := 4 + int32(matchLen(src[s+4:], src[o2+4:])) - var l int32 - { - a := src[s+4:] - b := src[o2+4:] - endI := len(a) & (math.MaxInt32 - 7) - l = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - l = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + l := 4 + e.matchlen(s+4, o2+4, src) // Store this, since we have it. - nextHash := hash6(cv, hashLog) + nextHash := hashLen(cv, hashLog, tableFastHashLen) e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} seq.matchLen = uint32(l) - zstdMinMatch seq.litLen = 0 @@ -616,7 +534,7 @@ encodeLoop: blk.literals = append(blk.literals, src[nextEmit:]...) blk.extraLits = len(src) - int(nextEmit) } - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } // We do not store history, so we must offset e.cur to avoid false matches for next user. @@ -696,7 +614,7 @@ func (e *fastEncoderDict) Encode(blk *blockEnc, src []byte) { blk.literals = append(blk.literals, src[nextEmit:until]...) s.litLen = uint32(until - nextEmit) } - if debug { + if debugEncoder { println("recent offsets:", blk.recentOffsets) } @@ -715,8 +633,8 @@ encodeLoop: panic("offset0 was 0") } - nextHash := hash6(cv, hashLog) - nextHash2 := hash6(cv>>8, hashLog) + nextHash := hashLen(cv, hashLog, tableFastHashLen) + nextHash2 := hashLen(cv>>8, hashLog, tableFastHashLen) candidate := e.table[nextHash] candidate2 := e.table[nextHash2] repIndex := s - offset1 + 2 @@ -730,19 +648,7 @@ encodeLoop: // Consider history as well. var seq seq var length int32 - // length = 4 + e.matchlen(s+6, repIndex+4, src) - { - a := src[s+6:] - b := src[repIndex+4:] - endI := len(a) & (math.MaxInt32 - 7) - length = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - length = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + length = 4 + e.matchlen(s+6, repIndex+4, src) seq.matchLen = uint32(length - zstdMinMatch) @@ -773,7 +679,7 @@ encodeLoop: s += length + 2 nextEmit = s if s >= sLimit { - if debug { + if debugEncoder { println("repeat ended", s, length) } @@ -830,20 +736,7 @@ encodeLoop: } // Extend the 4-byte match as long as possible. - //l := e.matchlen(s+4, t+4, src) + 4 - var l int32 - { - a := src[s+4:] - b := src[t+4:] - endI := len(a) & (math.MaxInt32 - 7) - l = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - l = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + l := e.matchlen(s+4, t+4, src) + 4 // Extend backwards tMin := s - e.maxMatchOff @@ -880,23 +773,10 @@ encodeLoop: if o2 := s - offset2; canRepeat && load3232(src, o2) == uint32(cv) { // We have at least 4 byte match. // No need to check backwards. We come straight from a match - //l := 4 + e.matchlen(s+4, o2+4, src) - var l int32 - { - a := src[s+4:] - b := src[o2+4:] - endI := len(a) & (math.MaxInt32 - 7) - l = int32(endI) + 4 - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - l = int32(i+bits.TrailingZeros64(diff)>>3) + 4 - break - } - } - } + l := 4 + e.matchlen(s+4, o2+4, src) // Store this, since we have it. - nextHash := hash6(cv, hashLog) + nextHash := hashLen(cv, hashLog, tableFastHashLen) e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} e.markShardDirty(nextHash) seq.matchLen = uint32(l) - zstdMinMatch @@ -926,7 +806,7 @@ encodeLoop: } blk.recentOffsets[0] = uint32(offset1) blk.recentOffsets[1] = uint32(offset2) - if debug { + if debugEncoder { println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } } @@ -957,9 +837,9 @@ func (e *fastEncoderDict) Reset(d *dict, singleBlock bool) { const hashLog = tableBits cv := load6432(d.content, i-e.maxMatchOff) - nextHash := hash6(cv, hashLog) // 0 -> 5 - nextHash1 := hash6(cv>>8, hashLog) // 1 -> 6 - nextHash2 := hash6(cv>>16, hashLog) // 2 -> 7 + nextHash := hashLen(cv, hashLog, tableFastHashLen) // 0 -> 5 + nextHash1 := hashLen(cv>>8, hashLog, tableFastHashLen) // 1 -> 6 + nextHash2 := hashLen(cv>>16, hashLog, tableFastHashLen) // 2 -> 7 e.dictTable[nextHash] = tableEntry{ val: uint32(cv), offset: i, diff --git a/vendor/github.com/klauspost/compress/zstd/encoder.go b/vendor/github.com/klauspost/compress/zstd/encoder.go index 6f0265099..7aaaedb23 100644 --- a/vendor/github.com/klauspost/compress/zstd/encoder.go +++ b/vendor/github.com/klauspost/compress/zstd/encoder.go @@ -33,7 +33,7 @@ type encoder interface { Block() *blockEnc CRC() *xxhash.Digest AppendCRC([]byte) []byte - WindowSize(size int) int32 + WindowSize(size int64) int32 UseBlock(*blockEnc) Reset(d *dict, singleBlock bool) } @@ -48,6 +48,8 @@ type encoderState struct { err error writeErr error nWritten int64 + nInput int64 + frameContentSize int64 headerWritten bool eofWritten bool fullFrameWritten bool @@ -96,23 +98,25 @@ func (e *Encoder) Reset(w io.Writer) { if cap(s.filling) == 0 { s.filling = make([]byte, 0, e.o.blockSize) } - if cap(s.current) == 0 { - s.current = make([]byte, 0, e.o.blockSize) - } - if cap(s.previous) == 0 { - s.previous = make([]byte, 0, e.o.blockSize) + if e.o.concurrent > 1 { + if cap(s.current) == 0 { + s.current = make([]byte, 0, e.o.blockSize) + } + if cap(s.previous) == 0 { + s.previous = make([]byte, 0, e.o.blockSize) + } + s.current = s.current[:0] + s.previous = s.previous[:0] + if s.writing == nil { + s.writing = &blockEnc{lowMem: e.o.lowMem} + s.writing.init() + } + s.writing.initNewEncode() } if s.encoder == nil { s.encoder = e.o.encoder() } - if s.writing == nil { - s.writing = &blockEnc{lowMem: e.o.lowMem} - s.writing.init() - } - s.writing.initNewEncode() s.filling = s.filling[:0] - s.current = s.current[:0] - s.previous = s.previous[:0] s.encoder.Reset(e.o.dict, false) s.headerWritten = false s.eofWritten = false @@ -120,7 +124,21 @@ func (e *Encoder) Reset(w io.Writer) { s.w = w s.err = nil s.nWritten = 0 + s.nInput = 0 s.writeErr = nil + s.frameContentSize = 0 +} + +// ResetContentSize will reset and set a content size for the next stream. +// If the bytes written does not match the size given an error will be returned +// when calling Close(). +// This is removed when Reset is called. +// Sizes <= 0 results in no content size set. +func (e *Encoder) ResetContentSize(w io.Writer, size int64) { + e.Reset(w) + if size >= 0 { + e.state.frameContentSize = size + } } // Write data to the encoder. @@ -190,6 +208,7 @@ func (e *Encoder) nextBlock(final bool) error { return s.err } s.nWritten += int64(n2) + s.nInput += int64(len(s.filling)) s.current = s.current[:0] s.filling = s.filling[:0] s.headerWritten = true @@ -200,8 +219,8 @@ func (e *Encoder) nextBlock(final bool) error { var tmp [maxHeaderSize]byte fh := frameHeader{ - ContentSize: 0, - WindowSize: uint32(s.encoder.WindowSize(0)), + ContentSize: uint64(s.frameContentSize), + WindowSize: uint32(s.encoder.WindowSize(s.frameContentSize)), SingleSegment: false, Checksum: e.o.crc, DictID: e.o.dict.ID(), @@ -241,11 +260,52 @@ func (e *Encoder) nextBlock(final bool) error { return s.err } + // SYNC: + if e.o.concurrent == 1 { + src := s.filling + s.nInput += int64(len(s.filling)) + if debugEncoder { + println("Adding sync block,", len(src), "bytes, final:", final) + } + enc := s.encoder + blk := enc.Block() + blk.reset(nil) + enc.Encode(blk, src) + blk.last = final + if final { + s.eofWritten = true + } + + err := errIncompressible + // If we got the exact same number of literals as input, + // assume the literals cannot be compressed. + if len(src) != len(blk.literals) || len(src) != e.o.blockSize { + err = blk.encode(src, e.o.noEntropy, !e.o.allLitEntropy) + } + switch err { + case errIncompressible: + if debugEncoder { + println("Storing incompressible block as raw") + } + blk.encodeRaw(src) + // In fast mode, we do not transfer offsets, so we don't have to deal with changing the. + case nil: + default: + s.err = err + return err + } + _, s.err = s.w.Write(blk.output) + s.nWritten += int64(len(blk.output)) + s.filling = s.filling[:0] + return s.err + } + // Move blocks forward. s.filling, s.current, s.previous = s.previous[:0], s.filling, s.current + s.nInput += int64(len(s.current)) s.wg.Add(1) go func(src []byte) { - if debug { + if debugEncoder { println("Adding block,", len(src), "bytes, final:", final) } defer func() { @@ -290,7 +350,7 @@ func (e *Encoder) nextBlock(final bool) error { } switch err { case errIncompressible: - if debug { + if debugEncoder { println("Storing incompressible block as raw") } blk.encodeRaw(src) @@ -313,7 +373,7 @@ func (e *Encoder) nextBlock(final bool) error { // // The Copy function uses ReaderFrom if available. func (e *Encoder) ReadFrom(r io.Reader) (n int64, err error) { - if debug { + if debugEncoder { println("Using ReadFrom") } @@ -336,20 +396,20 @@ func (e *Encoder) ReadFrom(r io.Reader) (n int64, err error) { switch err { case io.EOF: e.state.filling = e.state.filling[:len(e.state.filling)-len(src)] - if debug { + if debugEncoder { println("ReadFrom: got EOF final block:", len(e.state.filling)) } return n, nil + case nil: default: - if debug { + if debugEncoder { println("ReadFrom: got error:", err) } e.state.err = err return n, err - case nil: } if len(src) > 0 { - if debug { + if debugEncoder { println("ReadFrom: got space left in source:", len(src)) } continue @@ -394,6 +454,11 @@ func (e *Encoder) Close() error { if err != nil { return err } + if s.frameContentSize > 0 { + if s.nInput != s.frameContentSize { + return fmt.Errorf("frame content size %d given, but %d bytes was written", s.frameContentSize, s.nInput) + } + } if e.state.fullFrameWritten { return s.err } @@ -463,14 +528,14 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte { // If a non-single block is needed the encoder will reset again. e.encoders <- enc }() - // Use single segments when above minimum window and below 1MB. - single := len(src) < 1<<20 && len(src) > MinWindowSize + // Use single segments when above minimum window and below window size. + single := len(src) <= e.o.windowSize && len(src) > MinWindowSize if e.o.single != nil { single = *e.o.single } fh := frameHeader{ ContentSize: uint64(len(src)), - WindowSize: uint32(enc.WindowSize(len(src))), + WindowSize: uint32(enc.WindowSize(int64(len(src)))), SingleSegment: single, Checksum: e.o.crc, DictID: e.o.dict.ID(), @@ -486,7 +551,7 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte { } // If we can do everything in one block, prefer that. - if len(src) <= maxCompressedBlockSize { + if len(src) <= e.o.blockSize { enc.Reset(e.o.dict, true) // Slightly faster with no history and everything in one block. if e.o.crc { @@ -512,7 +577,7 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte { switch err { case errIncompressible: - if debug { + if debugEncoder { println("Storing incompressible block as raw") } dst = blk.encodeRawTo(dst, src) @@ -548,7 +613,7 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte { switch err { case errIncompressible: - if debug { + if debugEncoder { println("Storing incompressible block as raw") } dst = blk.encodeRawTo(dst, todo) diff --git a/vendor/github.com/klauspost/compress/zstd/encoder_options.go b/vendor/github.com/klauspost/compress/zstd/encoder_options.go index 18a47eb03..a7c5e1aac 100644 --- a/vendor/github.com/klauspost/compress/zstd/encoder_options.go +++ b/vendor/github.com/klauspost/compress/zstd/encoder_options.go @@ -24,6 +24,7 @@ type encoderOptions struct { allLitEntropy bool customWindow bool customALEntropy bool + customBlockSize bool lowMem bool dict *dict } @@ -33,7 +34,7 @@ func (o *encoderOptions) setDefault() { concurrent: runtime.GOMAXPROCS(0), crc: true, single: nil, - blockSize: 1 << 16, + blockSize: maxCompressedBlockSize, windowSize: 8 << 20, level: SpeedDefault, allLitEntropy: true, @@ -73,8 +74,9 @@ func WithEncoderCRC(b bool) EOption { } // WithEncoderConcurrency will set the concurrency, -// meaning the maximum number of decoders to run concurrently. +// meaning the maximum number of encoders to run concurrently. // The value supplied must be at least 1. +// For streams, setting a value of 1 will disable async compression. // By default this will be set to GOMAXPROCS. func WithEncoderConcurrency(n int) EOption { return func(o *encoderOptions) error { @@ -106,6 +108,7 @@ func WithWindowSize(n int) EOption { o.customWindow = true if o.blockSize > o.windowSize { o.blockSize = o.windowSize + o.customBlockSize = true } return nil } @@ -188,10 +191,9 @@ func EncoderLevelFromZstd(level int) EncoderLevel { return SpeedDefault case level >= 6 && level < 10: return SpeedBetterCompression - case level >= 10: - return SpeedBetterCompression + default: + return SpeedBestCompression } - return SpeedDefault } // String provides a string representation of the compression level. @@ -222,6 +224,9 @@ func WithEncoderLevel(l EncoderLevel) EOption { switch o.level { case SpeedFastest: o.windowSize = 4 << 20 + if !o.customBlockSize { + o.blockSize = 1 << 16 + } case SpeedDefault: o.windowSize = 8 << 20 case SpeedBetterCompression: @@ -278,7 +283,7 @@ func WithNoEntropyCompression(b bool) EOption { // a decoder is allowed to reject a compressed frame which requests a memory size beyond decoder's authorized range. // For broader compatibility, decoders are recommended to support memory sizes of at least 8 MB. // This is only a recommendation, each decoder is free to support higher or lower limits, depending on local limitations. -// If this is not specified, block encodes will automatically choose this based on the input size. +// If this is not specified, block encodes will automatically choose this based on the input size and the window size. // This setting has no effect on streamed encodes. func WithSingleSegment(b bool) EOption { return func(o *encoderOptions) error { diff --git a/vendor/github.com/klauspost/compress/zstd/framedec.go b/vendor/github.com/klauspost/compress/zstd/framedec.go index fc4a566d3..9568a4ba3 100644 --- a/vendor/github.com/klauspost/compress/zstd/framedec.go +++ b/vendor/github.com/klauspost/compress/zstd/framedec.go @@ -8,27 +8,17 @@ import ( "bytes" "encoding/hex" "errors" - "hash" "io" - "sync" "github.com/klauspost/compress/zstd/internal/xxhash" ) type frameDec struct { - o decoderOptions - crc hash.Hash64 - offset int64 + o decoderOptions + crc *xxhash.Digest WindowSize uint64 - // maxWindowSize is the maximum windows size to support. - // should never be bigger than max-int. - maxWindowSize uint64 - - // In order queue of blocks being decoded. - decoding chan *blockDec - // Frame history passed between blocks history history @@ -38,20 +28,18 @@ type frameDec struct { bBuf byteBuf FrameContentSize uint64 - frameDone sync.WaitGroup DictionaryID *uint32 HasCheckSum bool SingleSegment bool - - // asyncRunning indicates whether the async routine processes input on 'decoding'. - asyncRunningMu sync.Mutex - asyncRunning bool } const ( - // The minimum Window_Size is 1 KB. + // MinWindowSize is the minimum Window Size, which is 1 KB. MinWindowSize = 1 << 10 + + // MaxWindowSize is the maximum encoder window size + // and the default decoder maximum window size. MaxWindowSize = 1 << 29 ) @@ -61,12 +49,11 @@ var ( ) func newFrameDec(o decoderOptions) *frameDec { - d := frameDec{ - o: o, - maxWindowSize: MaxWindowSize, + if o.maxWindowSize > o.maxDecodedSize { + o.maxWindowSize = o.maxDecodedSize } - if d.maxWindowSize > o.maxDecodedSize { - d.maxWindowSize = o.maxDecodedSize + d := frameDec{ + o: o, } return &d } @@ -78,50 +65,74 @@ func newFrameDec(o decoderOptions) *frameDec { func (d *frameDec) reset(br byteBuffer) error { d.HasCheckSum = false d.WindowSize = 0 - var b []byte + var signature [4]byte for { - b = br.readSmall(4) - if b == nil { + var err error + // Check if we can read more... + b, err := br.readSmall(1) + switch err { + case io.EOF, io.ErrUnexpectedEOF: return io.EOF + default: + return err + case nil: + signature[0] = b[0] + } + // Read the rest, don't allow io.ErrUnexpectedEOF + b, err = br.readSmall(3) + switch err { + case io.EOF: + return io.EOF + default: + return err + case nil: + copy(signature[1:], b) } - if !bytes.Equal(b[1:4], skippableFrameMagic) || b[0]&0xf0 != 0x50 { - if debug { - println("Not skippable", hex.EncodeToString(b), hex.EncodeToString(skippableFrameMagic)) + + if !bytes.Equal(signature[1:4], skippableFrameMagic) || signature[0]&0xf0 != 0x50 { + if debugDecoder { + println("Not skippable", hex.EncodeToString(signature[:]), hex.EncodeToString(skippableFrameMagic)) } // Break if not skippable frame. break } // Read size to skip - b = br.readSmall(4) - if b == nil { - println("Reading Frame Size EOF") - return io.ErrUnexpectedEOF + b, err = br.readSmall(4) + if err != nil { + if debugDecoder { + println("Reading Frame Size", err) + } + return err } n := uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) println("Skipping frame with", n, "bytes.") - err := br.skipN(int(n)) + err = br.skipN(int64(n)) if err != nil { - if debug { + if debugDecoder { println("Reading discarded frame", err) } return err } } - if !bytes.Equal(b, frameMagic) { - println("Got magic numbers: ", b, "want:", frameMagic) + if !bytes.Equal(signature[:], frameMagic) { + if debugDecoder { + println("Got magic numbers: ", signature, "want:", frameMagic) + } return ErrMagicMismatch } // Read Frame_Header_Descriptor fhd, err := br.readByte() if err != nil { - println("Reading Frame_Header_Descriptor", err) + if debugDecoder { + println("Reading Frame_Header_Descriptor", err) + } return err } d.SingleSegment = fhd&(1<<5) != 0 if fhd&(1<<3) != 0 { - return errors.New("Reserved bit set on frame header") + return errors.New("reserved bit set on frame header") } // Read Window_Descriptor @@ -130,7 +141,9 @@ func (d *frameDec) reset(br byteBuffer) error { if !d.SingleSegment { wd, err := br.readByte() if err != nil { - println("Reading Window_Descriptor", err) + if debugDecoder { + println("Reading Window_Descriptor", err) + } return err } printf("raw: %x, mantissa: %d, exponent: %d\n", wd, wd&7, wd>>3) @@ -147,12 +160,11 @@ func (d *frameDec) reset(br byteBuffer) error { if size == 3 { size = 4 } - b = br.readSmall(int(size)) - if b == nil { - if debug { - println("Reading Dictionary_ID", io.ErrUnexpectedEOF) - } - return io.ErrUnexpectedEOF + + b, err := br.readSmall(int(size)) + if err != nil { + println("Reading Dictionary_ID", err) + return err } var id uint32 switch size { @@ -163,7 +175,7 @@ func (d *frameDec) reset(br byteBuffer) error { case 4: id = uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) } - if debug { + if debugDecoder { println("Dict size", size, "ID:", id) } if id > 0 { @@ -185,12 +197,12 @@ func (d *frameDec) reset(br byteBuffer) error { default: fcsSize = 1 << v } - d.FrameContentSize = 0 + d.FrameContentSize = fcsUnknown if fcsSize > 0 { - b := br.readSmall(fcsSize) - if b == nil { - println("Reading Frame content", io.ErrUnexpectedEOF) - return io.ErrUnexpectedEOF + b, err := br.readSmall(fcsSize) + if err != nil { + println("Reading Frame content", err) + return err } switch fcsSize { case 1: @@ -205,10 +217,11 @@ func (d *frameDec) reset(br byteBuffer) error { d2 := uint32(b[4]) | (uint32(b[5]) << 8) | (uint32(b[6]) << 16) | (uint32(b[7]) << 24) d.FrameContentSize = uint64(d1) | (uint64(d2) << 32) } - if debug { - println("field size bits:", v, "fcsSize:", fcsSize, "FrameContentSize:", d.FrameContentSize, hex.EncodeToString(b[:fcsSize]), "singleseg:", d.SingleSegment, "window:", d.WindowSize) + if debugDecoder { + println("Read FCS:", d.FrameContentSize) } } + // Move this to shared. d.HasCheckSum = fhd&(1<<2) != 0 if d.HasCheckSum { @@ -218,29 +231,47 @@ func (d *frameDec) reset(br byteBuffer) error { d.crc.Reset() } + if d.WindowSize > d.o.maxWindowSize { + if debugDecoder { + printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) + } + return ErrWindowSizeExceeded + } + if d.WindowSize == 0 && d.SingleSegment { // We may not need window in this case. d.WindowSize = d.FrameContentSize if d.WindowSize < MinWindowSize { d.WindowSize = MinWindowSize } + if d.WindowSize > d.o.maxDecodedSize { + if debugDecoder { + printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) + } + return ErrDecoderSizeExceeded + } } - if d.WindowSize > d.maxWindowSize { - printf("window size %d > max %d\n", d.WindowSize, d.maxWindowSize) - return ErrWindowSizeExceeded - } // The minimum Window_Size is 1 KB. if d.WindowSize < MinWindowSize { - println("got window size: ", d.WindowSize) + if debugDecoder { + println("got window size: ", d.WindowSize) + } return ErrWindowSizeTooSmall } d.history.windowSize = int(d.WindowSize) - if d.o.lowMem && d.history.windowSize < maxBlockSize { - d.history.maxSize = d.history.windowSize * 2 + if !d.o.lowMem || d.history.windowSize < maxBlockSize { + // Alloc 2x window size if not low-mem, or very small window size. + d.history.allocFrameBuffer = d.history.windowSize * 2 } else { - d.history.maxSize = d.history.windowSize + maxBlockSize + // Alloc with one additional block + d.history.allocFrameBuffer = d.history.windowSize + maxBlockSize + } + + if debugDecoder { + println("Frame: Dict:", d.DictionaryID, "FrameContentSize:", d.FrameContentSize, "singleseg:", d.SingleSegment, "window:", d.WindowSize, "crc:", d.HasCheckSum) } + // history contains input - maybe we do something d.rawInput = br return nil @@ -248,56 +279,37 @@ func (d *frameDec) reset(br byteBuffer) error { // next will start decoding the next block from stream. func (d *frameDec) next(block *blockDec) error { - if debug { - printf("decoding new block %p:%p", block, block.data) + if debugDecoder { + println("decoding new block") } err := block.reset(d.rawInput, d.WindowSize) if err != nil { println("block error:", err) // Signal the frame decoder we have a problem. - d.sendErr(block, err) + block.sendErr(err) return err } - block.input <- struct{}{} - if debug { - println("next block:", block) - } - d.asyncRunningMu.Lock() - defer d.asyncRunningMu.Unlock() - if !d.asyncRunning { - return nil - } - if block.Last { - // We indicate the frame is done by sending io.EOF - d.decoding <- block - return io.EOF - } - d.decoding <- block return nil } -// sendEOF will queue an error block on the frame. -// This will cause the frame decoder to return when it encounters the block. -// Returns true if the decoder was added. -func (d *frameDec) sendErr(block *blockDec, err error) bool { - d.asyncRunningMu.Lock() - defer d.asyncRunningMu.Unlock() - if !d.asyncRunning { - return false - } - - println("sending error", err.Error()) - block.sendErr(err) - d.decoding <- block - return true -} - // checkCRC will check the checksum if the frame has one. // Will return ErrCRCMismatch if crc check failed, otherwise nil. func (d *frameDec) checkCRC() error { if !d.HasCheckSum { return nil } + + // We can overwrite upper tmp now + want, err := d.rawInput.readSmall(4) + if err != nil { + println("CRC missing?", err) + return err + } + + if d.o.ignoreChecksum { + return nil + } + var tmp [4]byte got := d.crc.Sum64() // Flip to match file order. @@ -306,142 +318,29 @@ func (d *frameDec) checkCRC() error { tmp[2] = byte(got >> 16) tmp[3] = byte(got >> 24) - // We can overwrite upper tmp now - want := d.rawInput.readSmall(4) - if want == nil { - println("CRC missing?") - return io.ErrUnexpectedEOF - } - if !bytes.Equal(tmp[:], want) { - if debug { + if debugDecoder { println("CRC Check Failed:", tmp[:], "!=", want) } return ErrCRCMismatch } - if debug { + if debugDecoder { println("CRC ok", tmp[:]) } return nil } -func (d *frameDec) initAsync() { - if !d.o.lowMem && !d.SingleSegment { - // set max extra size history to 10MB. - d.history.maxSize = d.history.windowSize + maxBlockSize*5 - } - // re-alloc if more than one extra block size. - if d.o.lowMem && cap(d.history.b) > d.history.maxSize+maxBlockSize { - d.history.b = make([]byte, 0, d.history.maxSize) - } - if cap(d.history.b) < d.history.maxSize { - d.history.b = make([]byte, 0, d.history.maxSize) - } - if cap(d.decoding) < d.o.concurrent { - d.decoding = make(chan *blockDec, d.o.concurrent) - } - if debug { - h := d.history - printf("history init. len: %d, cap: %d", len(h.b), cap(h.b)) - } - d.asyncRunningMu.Lock() - d.asyncRunning = true - d.asyncRunningMu.Unlock() -} - -// startDecoder will start decoding blocks and write them to the writer. -// The decoder will stop as soon as an error occurs or at end of frame. -// When the frame has finished decoding the *bufio.Reader -// containing the remaining input will be sent on frameDec.frameDone. -func (d *frameDec) startDecoder(output chan decodeOutput) { - written := int64(0) - - defer func() { - d.asyncRunningMu.Lock() - d.asyncRunning = false - d.asyncRunningMu.Unlock() - - // Drain the currently decoding. - d.history.error = true - flushdone: - for { - select { - case b := <-d.decoding: - b.history <- &d.history - output <- <-b.result - default: - break flushdone - } - } - println("frame decoder done, signalling done") - d.frameDone.Done() - }() - // Get decoder for first block. - block := <-d.decoding - block.history <- &d.history - for { - var next *blockDec - // Get result - r := <-block.result - if r.err != nil { - println("Result contained error", r.err) - output <- r - return - } - if debug { - println("got result, from ", d.offset, "to", d.offset+int64(len(r.b))) - d.offset += int64(len(r.b)) - } - if !block.Last { - // Send history to next block - select { - case next = <-d.decoding: - if debug { - println("Sending ", len(d.history.b), "bytes as history") - } - next.history <- &d.history - default: - // Wait until we have sent the block, so - // other decoders can potentially get the decoder. - next = nil - } - } - - // Add checksum, async to decoding. - if d.HasCheckSum { - n, err := d.crc.Write(r.b) - if err != nil { - r.err = err - if n != len(r.b) { - r.err = io.ErrShortWrite - } - output <- r - return - } - } - written += int64(len(r.b)) - if d.SingleSegment && uint64(written) > d.FrameContentSize { - println("runDecoder: single segment and", uint64(written), ">", d.FrameContentSize) - r.err = ErrFrameSizeExceeded - output <- r - return - } - if block.Last { - r.err = d.checkCRC() - output <- r - return - } - output <- r - if next == nil { - // There was no decoder available, we wait for one now that we have sent to the writer. - if debug { - println("Sending ", len(d.history.b), " bytes as history") - } - next = <-d.decoding - next.history <- &d.history +// consumeCRC reads the checksum data if the frame has one. +func (d *frameDec) consumeCRC() error { + if d.HasCheckSum { + _, err := d.rawInput.readSmall(4) + if err != nil { + println("CRC missing?", err) + return err } - block = next } + + return nil } // runDecoder will create a sync decoder that will decode a block of data. @@ -450,41 +349,67 @@ func (d *frameDec) runDecoder(dst []byte, dec *blockDec) ([]byte, error) { // We use the history for output to avoid copying it. d.history.b = dst + d.history.ignoreBuffer = len(dst) // Store input length, so we only check new data. crcStart := len(dst) + d.history.decoders.maxSyncLen = 0 + if d.FrameContentSize != fcsUnknown { + d.history.decoders.maxSyncLen = d.FrameContentSize + uint64(len(dst)) + if d.history.decoders.maxSyncLen > d.o.maxDecodedSize { + return dst, ErrDecoderSizeExceeded + } + if uint64(cap(dst)) < d.history.decoders.maxSyncLen { + // Alloc for output + dst2 := make([]byte, len(dst), d.history.decoders.maxSyncLen+compressedBlockOverAlloc) + copy(dst2, dst) + dst = dst2 + } + } var err error for { err = dec.reset(d.rawInput, d.WindowSize) if err != nil { break } - if debug { + if debugDecoder { println("next block:", dec) } err = dec.decodeBuf(&d.history) - if err != nil || dec.Last { + if err != nil { break } if uint64(len(d.history.b)) > d.o.maxDecodedSize { err = ErrDecoderSizeExceeded break } - if d.SingleSegment && uint64(len(d.history.b)) > d.o.maxDecodedSize { - println("runDecoder: single segment and", uint64(len(d.history.b)), ">", d.o.maxDecodedSize) + if uint64(len(d.history.b)-crcStart) > d.FrameContentSize { + println("runDecoder: FrameContentSize exceeded", uint64(len(d.history.b)-crcStart), ">", d.FrameContentSize) err = ErrFrameSizeExceeded break } + if dec.Last { + break + } + if debugDecoder { + println("runDecoder: FrameContentSize", uint64(len(d.history.b)-crcStart), "<=", d.FrameContentSize) + } } dst = d.history.b if err == nil { - if d.HasCheckSum { - var n int - n, err = d.crc.Write(dst[crcStart:]) - if err == nil { - if n != len(dst)-crcStart { - err = io.ErrShortWrite - } else { - err = d.checkCRC() + if d.FrameContentSize != fcsUnknown && uint64(len(d.history.b)-crcStart) != d.FrameContentSize { + err = ErrFrameSizeMismatch + } else if d.HasCheckSum { + if d.o.ignoreChecksum { + err = d.consumeCRC() + } else { + var n int + n, err = d.crc.Write(dst[crcStart:]) + if err == nil { + if n != len(dst)-crcStart { + err = io.ErrShortWrite + } else { + err = d.checkCRC() + } } } } diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder.go index e6d3d49b3..2f8860a72 100644 --- a/vendor/github.com/klauspost/compress/zstd/fse_decoder.go +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder.go @@ -5,8 +5,10 @@ package zstd import ( + "encoding/binary" "errors" "fmt" + "io" ) const ( @@ -178,10 +180,32 @@ func (s *fseDecoder) readNCount(b *byteReader, maxSymbol uint16) error { return fmt.Errorf("corruption detected (total %d != %d)", gotTotal, 1<> 3) - // println(s.norm[:s.symbolLen], s.symbolLen) return s.buildDtable() } +func (s *fseDecoder) mustReadFrom(r io.Reader) { + fatalErr := func(err error) { + if err != nil { + panic(err) + } + } + // dt [maxTablesize]decSymbol // Decompression table. + // symbolLen uint16 // Length of active part of the symbol table. + // actualTableLog uint8 // Selected tablelog. + // maxBits uint8 // Maximum number of additional bits + // // used for table creation to avoid allocations. + // stateTable [256]uint16 + // norm [maxSymbolValue + 1]int16 + // preDefined bool + fatalErr(binary.Read(r, binary.LittleEndian, &s.dt)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.symbolLen)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.actualTableLog)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.maxBits)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.stateTable)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.norm)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.preDefined)) +} + // decSymbol contains information about a state entry, // Including the state offset base, the output symbol and // the number of bits to read for the low part of the destination state. @@ -204,18 +228,10 @@ func (d decSymbol) newState() uint16 { return uint16(d >> 16) } -func (d decSymbol) baseline() uint32 { - return uint32(d >> 32) -} - func (d decSymbol) baselineInt() int { return int(d >> 32) } -func (d *decSymbol) set(nbits, addBits uint8, newState uint16, baseline uint32) { - *d = decSymbol(nbits) | (decSymbol(addBits) << 8) | (decSymbol(newState) << 16) | (decSymbol(baseline) << 32) -} - func (d *decSymbol) setNBits(nBits uint8) { const mask = 0xffffffffffffff00 *d = (*d & mask) | decSymbol(nBits) @@ -231,11 +247,6 @@ func (d *decSymbol) setNewState(state uint16) { *d = (*d & mask) | decSymbol(state)<<16 } -func (d *decSymbol) setBaseline(baseline uint32) { - const mask = 0xffffffff - *d = (*d & mask) | decSymbol(baseline)<<32 -} - func (d *decSymbol) setExt(addBits uint8, baseline uint32) { const mask = 0xffff00ff *d = (*d & mask) | (decSymbol(addBits) << 8) | (decSymbol(baseline) << 32) @@ -257,68 +268,6 @@ func (s *fseDecoder) setRLE(symbol decSymbol) { s.dt[0] = symbol } -// buildDtable will build the decoding table. -func (s *fseDecoder) buildDtable() error { - tableSize := uint32(1 << s.actualTableLog) - highThreshold := tableSize - 1 - symbolNext := s.stateTable[:256] - - // Init, lay down lowprob symbols - { - for i, v := range s.norm[:s.symbolLen] { - if v == -1 { - s.dt[highThreshold].setAddBits(uint8(i)) - highThreshold-- - symbolNext[i] = 1 - } else { - symbolNext[i] = uint16(v) - } - } - } - // Spread symbols - { - tableMask := tableSize - 1 - step := tableStep(tableSize) - position := uint32(0) - for ss, v := range s.norm[:s.symbolLen] { - for i := 0; i < int(v); i++ { - s.dt[position].setAddBits(uint8(ss)) - position = (position + step) & tableMask - for position > highThreshold { - // lowprob area - position = (position + step) & tableMask - } - } - } - if position != 0 { - // position must reach all cells once, otherwise normalizedCounter is incorrect - return errors.New("corrupted input (position != 0)") - } - } - - // Build Decoding table - { - tableSize := uint16(1 << s.actualTableLog) - for u, v := range s.dt[:tableSize] { - symbol := v.addBits() - nextState := symbolNext[symbol] - symbolNext[symbol] = nextState + 1 - nBits := s.actualTableLog - byte(highBits(uint32(nextState))) - s.dt[u&maxTableMask].setNBits(nBits) - newState := (nextState << nBits) - tableSize - if newState > tableSize { - return fmt.Errorf("newState (%d) outside table size (%d)", newState, tableSize) - } - if newState == uint16(u) && nBits == 0 { - // Seems weird that this is possible with nbits > 0. - return fmt.Errorf("newState (%d) == oldState (%d) and no bits", newState, u) - } - s.dt[u&maxTableMask].setNewState(newState) - } - } - return nil -} - // transform will transform the decoder table into a table usable for // decoding without having to apply the transformation while decoding. // The state will contain the base value and the number of bits to read. @@ -352,34 +301,7 @@ func (s *fseState) init(br *bitReader, tableLog uint8, dt []decSymbol) { s.state = dt[br.getBits(tableLog)] } -// next returns the current symbol and sets the next state. -// At least tablelog bits must be available in the bit reader. -func (s *fseState) next(br *bitReader) { - lowBits := uint16(br.getBits(s.state.nbBits())) - s.state = s.dt[s.state.newState()+lowBits] -} - -// finished returns true if all bits have been read from the bitstream -// and the next state would require reading bits from the input. -func (s *fseState) finished(br *bitReader) bool { - return br.finished() && s.state.nbBits() > 0 -} - -// final returns the current state symbol without decoding the next. -func (s *fseState) final() (int, uint8) { - return s.state.baselineInt(), s.state.addBits() -} - // final returns the current state symbol without decoding the next. func (s decSymbol) final() (int, uint8) { return s.baselineInt(), s.addBits() } - -// nextFast returns the next symbol and sets the next state. -// This can only be used if no symbols are 0 bits. -// At least tablelog bits must be available in the bit reader. -func (s *fseState) nextFast(br *bitReader) (uint32, uint8) { - lowBits := uint16(br.getBitsFast(s.state.nbBits())) - s.state = s.dt[s.state.newState()+lowBits] - return s.state.baseline(), s.state.addBits() -} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go new file mode 100644 index 000000000..c881d28d8 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go @@ -0,0 +1,64 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +package zstd + +import ( + "fmt" +) + +type buildDtableAsmContext struct { + // inputs + stateTable *uint16 + norm *int16 + dt *uint64 + + // outputs --- set by the procedure in the case of error; + // for interpretation please see the error handling part below + errParam1 uint64 + errParam2 uint64 +} + +// buildDtable_asm is an x86 assembly implementation of fseDecoder.buildDtable. +// Function returns non-zero exit code on error. +// go:noescape +func buildDtable_asm(s *fseDecoder, ctx *buildDtableAsmContext) int + +// please keep in sync with _generate/gen_fse.go +const ( + errorCorruptedNormalizedCounter = 1 + errorNewStateTooBig = 2 + errorNewStateNoBits = 3 +) + +// buildDtable will build the decoding table. +func (s *fseDecoder) buildDtable() error { + ctx := buildDtableAsmContext{ + stateTable: &s.stateTable[0], + norm: &s.norm[0], + dt: (*uint64)(&s.dt[0]), + } + code := buildDtable_asm(s, &ctx) + + if code != 0 { + switch code { + case errorCorruptedNormalizedCounter: + position := ctx.errParam1 + return fmt.Errorf("corrupted input (position=%d, expected 0)", position) + + case errorNewStateTooBig: + newState := decSymbol(ctx.errParam1) + size := ctx.errParam2 + return fmt.Errorf("newState (%d) outside table size (%d)", newState, size) + + case errorNewStateNoBits: + newState := decSymbol(ctx.errParam1) + oldState := decSymbol(ctx.errParam2) + return fmt.Errorf("newState (%d) == oldState (%d) and no bits", newState, oldState) + + default: + return fmt.Errorf("buildDtable_asm returned unhandled nonzero code = %d", code) + } + } + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s new file mode 100644 index 000000000..da32b4420 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s @@ -0,0 +1,127 @@ +// Code generated by command: go run gen_fse.go -out ../fse_decoder_amd64.s -pkg=zstd. DO NOT EDIT. + +//go:build !appengine && !noasm && gc && !noasm +// +build !appengine,!noasm,gc,!noasm + +// func buildDtable_asm(s *fseDecoder, ctx *buildDtableAsmContext) int +TEXT ·buildDtable_asm(SB), $0-24 + MOVQ ctx+8(FP), CX + MOVQ s+0(FP), DI + + // Load values + MOVBQZX 4098(DI), DX + XORQ AX, AX + BTSQ DX, AX + MOVQ (CX), BX + MOVQ 16(CX), SI + LEAQ -1(AX), R8 + MOVQ 8(CX), CX + MOVWQZX 4096(DI), DI + + // End load values + // Init, lay down lowprob symbols + XORQ R9, R9 + JMP init_main_loop_condition + +init_main_loop: + MOVWQSX (CX)(R9*2), R10 + CMPW R10, $-1 + JNE do_not_update_high_threshold + MOVB R9, 1(SI)(R8*8) + DECQ R8 + MOVQ $0x0000000000000001, R10 + +do_not_update_high_threshold: + MOVW R10, (BX)(R9*2) + INCQ R9 + +init_main_loop_condition: + CMPQ R9, DI + JL init_main_loop + + // Spread symbols + // Calculate table step + MOVQ AX, R9 + SHRQ $0x01, R9 + MOVQ AX, R10 + SHRQ $0x03, R10 + LEAQ 3(R9)(R10*1), R9 + + // Fill add bits values + LEAQ -1(AX), R10 + XORQ R11, R11 + XORQ R12, R12 + JMP spread_main_loop_condition + +spread_main_loop: + XORQ R13, R13 + MOVWQSX (CX)(R12*2), R14 + JMP spread_inner_loop_condition + +spread_inner_loop: + MOVB R12, 1(SI)(R11*8) + +adjust_position: + ADDQ R9, R11 + ANDQ R10, R11 + CMPQ R11, R8 + JG adjust_position + INCQ R13 + +spread_inner_loop_condition: + CMPQ R13, R14 + JL spread_inner_loop + INCQ R12 + +spread_main_loop_condition: + CMPQ R12, DI + JL spread_main_loop + TESTQ R11, R11 + JZ spread_check_ok + MOVQ ctx+8(FP), AX + MOVQ R11, 24(AX) + MOVQ $+1, ret+16(FP) + RET + +spread_check_ok: + // Build Decoding table + XORQ DI, DI + +build_table_main_table: + MOVBQZX 1(SI)(DI*8), CX + MOVWQZX (BX)(CX*2), R8 + LEAQ 1(R8), R9 + MOVW R9, (BX)(CX*2) + MOVQ R8, R9 + BSRQ R9, R9 + MOVQ DX, CX + SUBQ R9, CX + SHLQ CL, R8 + SUBQ AX, R8 + MOVB CL, (SI)(DI*8) + MOVW R8, 2(SI)(DI*8) + CMPQ R8, AX + JLE build_table_check1_ok + MOVQ ctx+8(FP), CX + MOVQ R8, 24(CX) + MOVQ AX, 32(CX) + MOVQ $+2, ret+16(FP) + RET + +build_table_check1_ok: + TESTB CL, CL + JNZ build_table_check2_ok + CMPW R8, DI + JNE build_table_check2_ok + MOVQ ctx+8(FP), AX + MOVQ R8, 24(AX) + MOVQ DI, 32(AX) + MOVQ $+3, ret+16(FP) + RET + +build_table_check2_ok: + INCQ DI + CMPQ DI, AX + JL build_table_main_table + MOVQ $+0, ret+16(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go new file mode 100644 index 000000000..332e51fe4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go @@ -0,0 +1,72 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +package zstd + +import ( + "errors" + "fmt" +) + +// buildDtable will build the decoding table. +func (s *fseDecoder) buildDtable() error { + tableSize := uint32(1 << s.actualTableLog) + highThreshold := tableSize - 1 + symbolNext := s.stateTable[:256] + + // Init, lay down lowprob symbols + { + for i, v := range s.norm[:s.symbolLen] { + if v == -1 { + s.dt[highThreshold].setAddBits(uint8(i)) + highThreshold-- + symbolNext[i] = 1 + } else { + symbolNext[i] = uint16(v) + } + } + } + + // Spread symbols + { + tableMask := tableSize - 1 + step := tableStep(tableSize) + position := uint32(0) + for ss, v := range s.norm[:s.symbolLen] { + for i := 0; i < int(v); i++ { + s.dt[position].setAddBits(uint8(ss)) + position = (position + step) & tableMask + for position > highThreshold { + // lowprob area + position = (position + step) & tableMask + } + } + } + if position != 0 { + // position must reach all cells once, otherwise normalizedCounter is incorrect + return errors.New("corrupted input (position != 0)") + } + } + + // Build Decoding table + { + tableSize := uint16(1 << s.actualTableLog) + for u, v := range s.dt[:tableSize] { + symbol := v.addBits() + nextState := symbolNext[symbol] + symbolNext[symbol] = nextState + 1 + nBits := s.actualTableLog - byte(highBits(uint32(nextState))) + s.dt[u&maxTableMask].setNBits(nBits) + newState := (nextState << nBits) - tableSize + if newState > tableSize { + return fmt.Errorf("newState (%d) outside table size (%d)", newState, tableSize) + } + if newState == uint16(u) && nBits == 0 { + // Seems weird that this is possible with nbits > 0. + return fmt.Errorf("newState (%d) == oldState (%d) and no bits", newState, u) + } + s.dt[u&maxTableMask].setNewState(newState) + } + } + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_encoder.go b/vendor/github.com/klauspost/compress/zstd/fse_encoder.go index b80709d5e..ab26326a8 100644 --- a/vendor/github.com/klauspost/compress/zstd/fse_encoder.go +++ b/vendor/github.com/klauspost/compress/zstd/fse_encoder.go @@ -62,9 +62,8 @@ func (s symbolTransform) String() string { // To indicate that you have populated the histogram call HistogramFinished // with the value of the highest populated symbol, as well as the number of entries // in the most populated entry. These are accepted at face value. -// The returned slice will always be length 256. -func (s *fseEncoder) Histogram() []uint32 { - return s.count[:] +func (s *fseEncoder) Histogram() *[256]uint32 { + return &s.count } // HistogramFinished can be called to indicate that the histogram has been populated. @@ -77,21 +76,6 @@ func (s *fseEncoder) HistogramFinished(maxSymbol uint8, maxCount int) { s.clearCount = maxCount != 0 } -// prepare will prepare and allocate scratch tables used for both compression and decompression. -func (s *fseEncoder) prepare() (*fseEncoder, error) { - if s == nil { - s = &fseEncoder{} - } - s.useRLE = false - if s.clearCount && s.maxCount == 0 { - for i := range s.count { - s.count[i] = 0 - } - s.clearCount = false - } - return s, nil -} - // allocCtable will allocate tables needed for compression. // If existing tables a re big enough, they are simply re-used. func (s *fseEncoder) allocCtable() { @@ -229,7 +213,7 @@ func (s *fseEncoder) setRLE(val byte) { deltaFindState: 0, deltaNbBits: 0, } - if debug { + if debugEncoder { println("setRLE: val", val, "symbolTT", s.ct.symbolTT[val]) } s.rleVal = val @@ -708,15 +692,6 @@ func (c *cState) init(bw *bitWriter, ct *cTable, first symbolTransform) { im := int32((nbBitsOut << 16) - first.deltaNbBits) lu := (im >> nbBitsOut) + int32(first.deltaFindState) c.state = c.stateTable[lu] - return -} - -// encode the output symbol provided and write it to the bitstream. -func (c *cState) encode(symbolTT symbolTransform) { - nbBitsOut := (uint32(c.state) + symbolTT.deltaNbBits) >> 16 - dstState := int32(c.state>>(nbBitsOut&15)) + int32(symbolTT.deltaFindState) - c.bw.addBits16NC(c.state, uint8(nbBitsOut)) - c.state = c.stateTable[dstState] } // flush will write the tablelog to the output and flush the remaining full bytes. diff --git a/vendor/github.com/klauspost/compress/zstd/fse_predefined.go b/vendor/github.com/klauspost/compress/zstd/fse_predefined.go index 6c17dc17f..474cb77d2 100644 --- a/vendor/github.com/klauspost/compress/zstd/fse_predefined.go +++ b/vendor/github.com/klauspost/compress/zstd/fse_predefined.go @@ -59,7 +59,7 @@ func fillBase(dst []baseOffset, base uint32, bits ...uint8) { } for i, bit := range bits { if base > math.MaxInt32 { - panic(fmt.Sprintf("invalid decoding table, base overflows int32")) + panic("invalid decoding table, base overflows int32") } dst[i] = baseOffset{ diff --git a/vendor/github.com/klauspost/compress/zstd/hash.go b/vendor/github.com/klauspost/compress/zstd/hash.go index 4a752067f..5d73c21eb 100644 --- a/vendor/github.com/klauspost/compress/zstd/hash.go +++ b/vendor/github.com/klauspost/compress/zstd/hash.go @@ -13,65 +13,23 @@ const ( prime8bytes = 0xcf1bbcdcb7a56463 ) -// hashLen returns a hash of the lowest l bytes of u for a size size of h bytes. -// l must be >=4 and <=8. Any other value will return hash for 4 bytes. -// h should always be <32. -// Preferably h and l should be a constant. -// FIXME: This does NOT get resolved, if 'mls' is constant, -// so this cannot be used. -func hashLen(u uint64, hashLog, mls uint8) uint32 { +// hashLen returns a hash of the lowest mls bytes of with length output bits. +// mls must be >=3 and <=8. Any other value will return hash for 4 bytes. +// length should always be < 32. +// Preferably length and mls should be a constant for inlining. +func hashLen(u uint64, length, mls uint8) uint32 { switch mls { + case 3: + return (uint32(u<<8) * prime3bytes) >> (32 - length) case 5: - return hash5(u, hashLog) + return uint32(((u << (64 - 40)) * prime5bytes) >> (64 - length)) case 6: - return hash6(u, hashLog) + return uint32(((u << (64 - 48)) * prime6bytes) >> (64 - length)) case 7: - return hash7(u, hashLog) + return uint32(((u << (64 - 56)) * prime7bytes) >> (64 - length)) case 8: - return hash8(u, hashLog) + return uint32((u * prime8bytes) >> (64 - length)) default: - return hash4x64(u, hashLog) + return (uint32(u) * prime4bytes) >> (32 - length) } } - -// hash3 returns the hash of the lower 3 bytes of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <32. -func hash3(u uint32, h uint8) uint32 { - return ((u << (32 - 24)) * prime3bytes) >> ((32 - h) & 31) -} - -// hash4 returns the hash of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <32. -func hash4(u uint32, h uint8) uint32 { - return (u * prime4bytes) >> ((32 - h) & 31) -} - -// hash4x64 returns the hash of the lowest 4 bytes of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <32. -func hash4x64(u uint64, h uint8) uint32 { - return (uint32(u) * prime4bytes) >> ((32 - h) & 31) -} - -// hash5 returns the hash of the lowest 5 bytes of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <64. -func hash5(u uint64, h uint8) uint32 { - return uint32(((u << (64 - 40)) * prime5bytes) >> ((64 - h) & 63)) -} - -// hash6 returns the hash of the lowest 6 bytes of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <64. -func hash6(u uint64, h uint8) uint32 { - return uint32(((u << (64 - 48)) * prime6bytes) >> ((64 - h) & 63)) -} - -// hash7 returns the hash of the lowest 7 bytes of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <64. -func hash7(u uint64, h uint8) uint32 { - return uint32(((u << (64 - 56)) * prime7bytes) >> ((64 - h) & 63)) -} - -// hash8 returns the hash of u to fit in a hash table with h bits. -// Preferably h should be a constant and should always be <64. -func hash8(u uint64, h uint8) uint32 { - return uint32((u * prime8bytes) >> ((64 - h) & 63)) -} diff --git a/vendor/github.com/klauspost/compress/zstd/history.go b/vendor/github.com/klauspost/compress/zstd/history.go index f783e32d2..28b40153c 100644 --- a/vendor/github.com/klauspost/compress/zstd/history.go +++ b/vendor/github.com/klauspost/compress/zstd/history.go @@ -10,20 +10,31 @@ import ( // history contains the information transferred between blocks. type history struct { - b []byte - huffTree *huff0.Scratch - recentOffsets [3]int + // Literal decompression + huffTree *huff0.Scratch + + // Sequence decompression decoders sequenceDecs - windowSize int - maxSize int - error bool - dict *dict + recentOffsets [3]int + + // History buffer... + b []byte + + // ignoreBuffer is meant to ignore a number of bytes + // when checking for matches in history + ignoreBuffer int + + windowSize int + allocFrameBuffer int // needed? + error bool + dict *dict } // reset will reset the history to initial state of a frame. // The history must already have been initialized to the desired size. func (h *history) reset() { h.b = h.b[:0] + h.ignoreBuffer = 0 h.error = false h.recentOffsets = [3]int{1, 4, 8} if f := h.decoders.litLengths.fse; f != nil && !f.preDefined { @@ -35,7 +46,7 @@ func (h *history) reset() { if f := h.decoders.matchLengths.fse; f != nil && !f.preDefined { fseDecoderPool.Put(f) } - h.decoders = sequenceDecs{} + h.decoders = sequenceDecs{br: h.decoders.br} if h.huffTree != nil { if h.dict == nil || h.dict.litEnc != h.huffTree { huffDecoderPool.Put(h.huffTree) @@ -54,6 +65,7 @@ func (h *history) setDict(dict *dict) { h.decoders.litLengths = dict.llDec h.decoders.offsets = dict.ofDec h.decoders.matchLengths = dict.mlDec + h.decoders.dict = dict.content h.recentOffsets = dict.offsets h.huffTree = dict.litEnc } @@ -83,6 +95,24 @@ func (h *history) append(b []byte) { copy(h.b[h.windowSize-len(b):], b) } +// ensureBlock will ensure there is space for at least one block... +func (h *history) ensureBlock() { + if cap(h.b) < h.allocFrameBuffer { + h.b = make([]byte, 0, h.allocFrameBuffer) + return + } + + avail := cap(h.b) - len(h.b) + if avail >= h.windowSize || avail > maxCompressedBlockSize { + return + } + // Move data down so we only have window size left. + // We know we have less than window size in b at this point. + discard := len(h.b) - h.windowSize + copy(h.b, h.b[discard:]) + h.b = h.b[:h.windowSize] +} + // append bytes to history without ever discarding anything. func (h *history) appendKeep(b []byte) { h.b = append(h.b, b...) diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go index 426b9cac7..2c112a0ab 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go @@ -195,7 +195,6 @@ func (d *Digest) UnmarshalBinary(b []byte) error { b, d.v4 = consumeUint64(b) b, d.total = consumeUint64(b) copy(d.mem[:], b) - b = b[len(d.mem):] d.n = int(d.total % uint64(len(d.mem))) return nil } diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s index 2c9c5357a..cea178561 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s @@ -1,12 +1,13 @@ // +build !appengine // +build gc // +build !purego +// +build !noasm #include "textflag.h" // Register allocation: // AX h -// CX pointer to advance through b +// SI pointer to advance through b // DX n // BX loop end // R8 v1, k1 @@ -16,39 +17,39 @@ // R12 tmp // R13 prime1v // R14 prime2v -// R15 prime4v +// DI prime4v -// round reads from and advances the buffer pointer in CX. +// round reads from and advances the buffer pointer in SI. // It assumes that R13 has prime1v and R14 has prime2v. #define round(r) \ - MOVQ (CX), R12 \ - ADDQ $8, CX \ + MOVQ (SI), R12 \ + ADDQ $8, SI \ IMULQ R14, R12 \ ADDQ R12, r \ ROLQ $31, r \ IMULQ R13, r // mergeRound applies a merge round on the two registers acc and val. -// It assumes that R13 has prime1v, R14 has prime2v, and R15 has prime4v. +// It assumes that R13 has prime1v, R14 has prime2v, and DI has prime4v. #define mergeRound(acc, val) \ IMULQ R14, val \ ROLQ $31, val \ IMULQ R13, val \ XORQ val, acc \ IMULQ R13, acc \ - ADDQ R15, acc + ADDQ DI, acc // func Sum64(b []byte) uint64 TEXT ·Sum64(SB), NOSPLIT, $0-32 // Load fixed primes. MOVQ ·prime1v(SB), R13 MOVQ ·prime2v(SB), R14 - MOVQ ·prime4v(SB), R15 + MOVQ ·prime4v(SB), DI // Load slice. - MOVQ b_base+0(FP), CX + MOVQ b_base+0(FP), SI MOVQ b_len+8(FP), DX - LEAQ (CX)(DX*1), BX + LEAQ (SI)(DX*1), BX // The first loop limit will be len(b)-32. SUBQ $32, BX @@ -65,14 +66,14 @@ TEXT ·Sum64(SB), NOSPLIT, $0-32 XORQ R11, R11 SUBQ R13, R11 - // Loop until CX > BX. + // Loop until SI > BX. blockLoop: round(R8) round(R9) round(R10) round(R11) - CMPQ CX, BX + CMPQ SI, BX JLE blockLoop MOVQ R8, AX @@ -100,16 +101,16 @@ noBlocks: afterBlocks: ADDQ DX, AX - // Right now BX has len(b)-32, and we want to loop until CX > len(b)-8. + // Right now BX has len(b)-32, and we want to loop until SI > len(b)-8. ADDQ $24, BX - CMPQ CX, BX + CMPQ SI, BX JG fourByte wordLoop: // Calculate k1. - MOVQ (CX), R8 - ADDQ $8, CX + MOVQ (SI), R8 + ADDQ $8, SI IMULQ R14, R8 ROLQ $31, R8 IMULQ R13, R8 @@ -117,18 +118,18 @@ wordLoop: XORQ R8, AX ROLQ $27, AX IMULQ R13, AX - ADDQ R15, AX + ADDQ DI, AX - CMPQ CX, BX + CMPQ SI, BX JLE wordLoop fourByte: ADDQ $4, BX - CMPQ CX, BX + CMPQ SI, BX JG singles - MOVL (CX), R8 - ADDQ $4, CX + MOVL (SI), R8 + ADDQ $4, SI IMULQ R13, R8 XORQ R8, AX @@ -138,19 +139,19 @@ fourByte: singles: ADDQ $4, BX - CMPQ CX, BX + CMPQ SI, BX JGE finalize singlesLoop: - MOVBQZX (CX), R12 - ADDQ $1, CX + MOVBQZX (SI), R12 + ADDQ $1, SI IMULQ ·prime5v(SB), R12 XORQ R12, AX ROLQ $11, AX IMULQ R13, AX - CMPQ CX, BX + CMPQ SI, BX JL singlesLoop finalize: @@ -179,13 +180,13 @@ TEXT ·writeBlocks(SB), NOSPLIT, $0-40 MOVQ ·prime2v(SB), R14 // Load slice. - MOVQ arg1_base+8(FP), CX - MOVQ arg1_len+16(FP), DX - LEAQ (CX)(DX*1), BX + MOVQ b_base+8(FP), SI + MOVQ b_len+16(FP), DX + LEAQ (SI)(DX*1), BX SUBQ $32, BX // Load vN from d. - MOVQ arg+0(FP), AX + MOVQ d+0(FP), AX MOVQ 0(AX), R8 // v1 MOVQ 8(AX), R9 // v2 MOVQ 16(AX), R10 // v3 @@ -199,7 +200,7 @@ blockLoop: round(R10) round(R11) - CMPQ CX, BX + CMPQ SI, BX JLE blockLoop // Copy vN back to d. @@ -208,8 +209,8 @@ blockLoop: MOVQ R10, 16(AX) MOVQ R11, 24(AX) - // The number of bytes written is CX minus the old base pointer. - SUBQ arg1_base+8(FP), CX - MOVQ CX, ret+32(FP) + // The number of bytes written is SI minus the old base pointer. + SUBQ b_base+8(FP), SI + MOVQ SI, ret+32(FP) RET diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s new file mode 100644 index 000000000..4d64a17d6 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s @@ -0,0 +1,186 @@ +// +build gc,!purego,!noasm + +#include "textflag.h" + +// Register allocation. +#define digest R1 +#define h R2 // Return value. +#define p R3 // Input pointer. +#define len R4 +#define nblocks R5 // len / 32. +#define prime1 R7 +#define prime2 R8 +#define prime3 R9 +#define prime4 R10 +#define prime5 R11 +#define v1 R12 +#define v2 R13 +#define v3 R14 +#define v4 R15 +#define x1 R20 +#define x2 R21 +#define x3 R22 +#define x4 R23 + +#define round(acc, x) \ + MADD prime2, acc, x, acc \ + ROR $64-31, acc \ + MUL prime1, acc \ + +// x = round(0, x). +#define round0(x) \ + MUL prime2, x \ + ROR $64-31, x \ + MUL prime1, x \ + +#define mergeRound(x) \ + round0(x) \ + EOR x, h \ + MADD h, prime4, prime1, h \ + +// Update v[1-4] with 32-byte blocks. Assumes len >= 32. +#define blocksLoop() \ + LSR $5, len, nblocks \ + PCALIGN $16 \ + loop: \ + LDP.P 32(p), (x1, x2) \ + round(v1, x1) \ + LDP -16(p), (x3, x4) \ + round(v2, x2) \ + SUB $1, nblocks \ + round(v3, x3) \ + round(v4, x4) \ + CBNZ nblocks, loop \ + +// The primes are repeated here to ensure that they're stored +// in a contiguous array, so we can load them with LDP. +DATA primes<> +0(SB)/8, $11400714785074694791 +DATA primes<> +8(SB)/8, $14029467366897019727 +DATA primes<>+16(SB)/8, $1609587929392839161 +DATA primes<>+24(SB)/8, $9650029242287828579 +DATA primes<>+32(SB)/8, $2870177450012600261 +GLOBL primes<>(SB), NOPTR+RODATA, $40 + +// func Sum64(b []byte) uint64 +TEXT ·Sum64(SB), NOFRAME+NOSPLIT, $0-32 + LDP b_base+0(FP), (p, len) + + LDP primes<> +0(SB), (prime1, prime2) + LDP primes<>+16(SB), (prime3, prime4) + MOVD primes<>+32(SB), prime5 + + CMP $32, len + CSEL LO, prime5, ZR, h // if len < 32 { h = prime5 } else { h = 0 } + BLO afterLoop + + ADD prime1, prime2, v1 + MOVD prime2, v2 + MOVD $0, v3 + NEG prime1, v4 + + blocksLoop() + + ROR $64-1, v1, x1 + ROR $64-7, v2, x2 + ADD x1, x2 + ROR $64-12, v3, x3 + ROR $64-18, v4, x4 + ADD x3, x4 + ADD x2, x4, h + + mergeRound(v1) + mergeRound(v2) + mergeRound(v3) + mergeRound(v4) + +afterLoop: + ADD len, h + + TBZ $4, len, try8 + LDP.P 16(p), (x1, x2) + + round0(x1) + ROR $64-27, h + EOR x1 @> 64-27, h, h + MADD h, prime4, prime1, h + + round0(x2) + ROR $64-27, h + EOR x2 @> 64-27, h + MADD h, prime4, prime1, h + +try8: + TBZ $3, len, try4 + MOVD.P 8(p), x1 + + round0(x1) + ROR $64-27, h + EOR x1 @> 64-27, h + MADD h, prime4, prime1, h + +try4: + TBZ $2, len, try2 + MOVWU.P 4(p), x2 + + MUL prime1, x2 + ROR $64-23, h + EOR x2 @> 64-23, h + MADD h, prime3, prime2, h + +try2: + TBZ $1, len, try1 + MOVHU.P 2(p), x3 + AND $255, x3, x1 + LSR $8, x3, x2 + + MUL prime5, x1 + ROR $64-11, h + EOR x1 @> 64-11, h + MUL prime1, h + + MUL prime5, x2 + ROR $64-11, h + EOR x2 @> 64-11, h + MUL prime1, h + +try1: + TBZ $0, len, end + MOVBU (p), x4 + + MUL prime5, x4 + ROR $64-11, h + EOR x4 @> 64-11, h + MUL prime1, h + +end: + EOR h >> 33, h + MUL prime2, h + EOR h >> 29, h + MUL prime3, h + EOR h >> 32, h + + MOVD h, ret+24(FP) + RET + +// func writeBlocks(d *Digest, b []byte) int +// +// Assumes len(b) >= 32. +TEXT ·writeBlocks(SB), NOFRAME+NOSPLIT, $0-40 + LDP primes<>(SB), (prime1, prime2) + + // Load state. Assume v[1-4] are stored contiguously. + MOVD d+0(FP), digest + LDP 0(digest), (v1, v2) + LDP 16(digest), (v3, v4) + + LDP b_base+8(FP), (p, len) + + blocksLoop() + + // Store updated state. + STP (v1, v2), 0(digest) + STP (v3, v4), 16(digest) + + BIC $31, len + MOVD len, ret+32(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go similarity index 54% rename from vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.go rename to vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go index 35318d7c4..1a1fac9c2 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.go +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go @@ -1,6 +1,9 @@ +//go:build (amd64 || arm64) && !appengine && gc && !purego && !noasm +// +build amd64 arm64 // +build !appengine // +build gc // +build !purego +// +build !noasm package xxhash @@ -10,4 +13,4 @@ package xxhash func Sum64(b []byte) uint64 //go:noescape -func writeBlocks(*Digest, []byte) int +func writeBlocks(d *Digest, b []byte) int diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go index 4a5a82160..209cb4a99 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go @@ -1,4 +1,5 @@ -// +build !amd64 appengine !gc purego +//go:build (!amd64 && !arm64) || appengine || !gc || purego || noasm +// +build !amd64,!arm64 appengine !gc purego noasm package xxhash diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec.go b/vendor/github.com/klauspost/compress/zstd/seqdec.go index 1dd39e63b..df0447203 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec.go +++ b/vendor/github.com/klauspost/compress/zstd/seqdec.go @@ -20,6 +20,10 @@ type seq struct { llCode, mlCode, ofCode uint8 } +type seqVals struct { + ll, ml, mo int +} + func (s seq) String() string { if s.offset <= 3 { if s.offset == 0 { @@ -61,16 +65,19 @@ type sequenceDecs struct { offsets sequenceDec matchLengths sequenceDec prevOffset [3]int - hist []byte dict []byte literals []byte out []byte + nSeqs int + br *bitReader + seqSize int windowSize int maxBits uint8 + maxSyncLen uint64 } // initialize all 3 decoders from the stream input. -func (s *sequenceDecs) initialize(br *bitReader, hist *history, literals, out []byte) error { +func (s *sequenceDecs) initialize(br *bitReader, hist *history, out []byte) error { if err := s.litLengths.init(br); err != nil { return errors.New("litLengths:" + err.Error()) } @@ -80,8 +87,7 @@ func (s *sequenceDecs) initialize(br *bitReader, hist *history, literals, out [] if err := s.matchLengths.init(br); err != nil { return errors.New("matchLengths:" + err.Error()) } - s.literals = literals - s.hist = hist.b + s.br = br s.prevOffset = hist.recentOffsets s.maxBits = s.litLengths.fse.maxBits + s.offsets.fse.maxBits + s.matchLengths.fse.maxBits s.windowSize = hist.windowSize @@ -93,12 +99,127 @@ func (s *sequenceDecs) initialize(br *bitReader, hist *history, literals, out [] return nil } +// execute will execute the decoded sequence with the provided history. +// The sequence must be evaluated before being sent. +func (s *sequenceDecs) execute(seqs []seqVals, hist []byte) error { + if len(s.dict) == 0 { + return s.executeSimple(seqs, hist) + } + + // Ensure we have enough output size... + if len(s.out)+s.seqSize > cap(s.out) { + addBytes := s.seqSize + len(s.out) + s.out = append(s.out, make([]byte, addBytes)...) + s.out = s.out[:len(s.out)-addBytes] + } + + if debugDecoder { + printf("Execute %d seqs with hist %d, dict %d, literals: %d into %d bytes\n", len(seqs), len(hist), len(s.dict), len(s.literals), s.seqSize) + } + + var t = len(s.out) + out := s.out[:t+s.seqSize] + + for _, seq := range seqs { + // Add literals + copy(out[t:], s.literals[:seq.ll]) + t += seq.ll + s.literals = s.literals[seq.ll:] + + // Copy from dictionary... + if seq.mo > t+len(hist) || seq.mo > s.windowSize { + if len(s.dict) == 0 { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", seq.mo, t+len(hist)) + } + + // we may be in dictionary. + dictO := len(s.dict) - (seq.mo - (t + len(hist))) + if dictO < 0 || dictO >= len(s.dict) { + return fmt.Errorf("match offset (%d) bigger than current history+dict (%d)", seq.mo, t+len(hist)+len(s.dict)) + } + end := dictO + seq.ml + if end > len(s.dict) { + n := len(s.dict) - dictO + copy(out[t:], s.dict[dictO:]) + t += n + seq.ml -= n + } else { + copy(out[t:], s.dict[dictO:end]) + t += end - dictO + continue + } + } + + // Copy from history. + if v := seq.mo - t; v > 0 { + // v is the start position in history from end. + start := len(hist) - v + if seq.ml > v { + // Some goes into current block. + // Copy remainder of history + copy(out[t:], hist[start:]) + t += v + seq.ml -= v + } else { + copy(out[t:], hist[start:start+seq.ml]) + t += seq.ml + continue + } + } + // We must be in current buffer now + if seq.ml > 0 { + start := t - seq.mo + if seq.ml <= t-start { + // No overlap + copy(out[t:], out[start:start+seq.ml]) + t += seq.ml + continue + } else { + // Overlapping copy + // Extend destination slice and copy one byte at the time. + src := out[start : start+seq.ml] + dst := out[t:] + dst = dst[:len(src)] + t += len(src) + // Destination is the space we just added. + for i := range src { + dst[i] = src[i] + } + } + } + } + + // Add final literals + copy(out[t:], s.literals) + if debugDecoder { + t += len(s.literals) + if t != len(out) { + panic(fmt.Errorf("length mismatch, want %d, got %d, ss: %d", len(out), t, s.seqSize)) + } + } + s.out = out + + return nil +} + // decode sequences from the stream with the provided history. -func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { +func (s *sequenceDecs) decodeSync(hist []byte) error { + supported, err := s.decodeSyncSimple(hist) + if supported { + return err + } + + br := s.br + seqs := s.nSeqs startSize := len(s.out) // Grab full sizes tables, to avoid bounds checks. llTable, mlTable, ofTable := s.litLengths.fse.dt[:maxTablesize], s.matchLengths.fse.dt[:maxTablesize], s.offsets.fse.dt[:maxTablesize] llState, mlState, ofState := s.litLengths.state.state, s.matchLengths.state.state, s.offsets.state.state + out := s.out + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } for i := seqs - 1; i >= 0; i-- { if br.overread() { @@ -151,7 +272,7 @@ func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { if temp == 0 { // 0 is not valid; input is corrupted; force offset to 1 - println("temp was 0") + println("WARNING: temp was 0") temp = 1 } @@ -176,51 +297,49 @@ func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { if ll > len(s.literals) { return fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", ll, len(s.literals)) } - size := ll + ml + len(s.out) + size := ll + ml + len(out) if size-startSize > maxBlockSize { - return fmt.Errorf("output (%d) bigger than max block size", size) + return fmt.Errorf("output (%d) bigger than max block size (%d)", size-startSize, maxBlockSize) } - if size > cap(s.out) { + if size > cap(out) { // Not enough size, which can happen under high volume block streaming conditions // but could be if destination slice is too small for sync operations. // over-allocating here can create a large amount of GC pressure so we try to keep // it as contained as possible - used := len(s.out) - startSize + used := len(out) - startSize addBytes := 256 + ll + ml + used>>2 // Clamp to max block size. if used+addBytes > maxBlockSize { addBytes = maxBlockSize - used } - s.out = append(s.out, make([]byte, addBytes)...) - s.out = s.out[:len(s.out)-addBytes] + out = append(out, make([]byte, addBytes)...) + out = out[:len(out)-addBytes] } if ml > maxMatchLen { return fmt.Errorf("match len (%d) bigger than max allowed length", ml) } // Add literals - s.out = append(s.out, s.literals[:ll]...) + out = append(out, s.literals[:ll]...) s.literals = s.literals[ll:] - out := s.out if mo == 0 && ml > 0 { return fmt.Errorf("zero matchoff and matchlen (%d) > 0", ml) } - if mo > len(s.out)+len(hist) || mo > s.windowSize { + if mo > len(out)+len(hist) || mo > s.windowSize { if len(s.dict) == 0 { - return fmt.Errorf("match offset (%d) bigger than current history (%d)", mo, len(s.out)+len(hist)) + return fmt.Errorf("match offset (%d) bigger than current history (%d)", mo, len(out)+len(hist)-startSize) } // we may be in dictionary. - dictO := len(s.dict) - (mo - (len(s.out) + len(hist))) + dictO := len(s.dict) - (mo - (len(out) + len(hist))) if dictO < 0 || dictO >= len(s.dict) { - return fmt.Errorf("match offset (%d) bigger than current history (%d)", mo, len(s.out)+len(hist)) + return fmt.Errorf("match offset (%d) bigger than current history (%d)", mo, len(out)+len(hist)-startSize) } end := dictO + ml if end > len(s.dict) { out = append(out, s.dict[dictO:]...) - mo -= len(s.dict) - dictO ml -= len(s.dict) - dictO } else { out = append(out, s.dict[dictO:end]...) @@ -231,26 +350,25 @@ func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { // Copy from history. // TODO: Blocks without history could be made to ignore this completely. - if v := mo - len(s.out); v > 0 { + if v := mo - len(out); v > 0 { // v is the start position in history from end. - start := len(s.hist) - v + start := len(hist) - v if ml > v { // Some goes into current block. // Copy remainder of history - out = append(out, s.hist[start:]...) - mo -= v + out = append(out, hist[start:]...) ml -= v } else { - out = append(out, s.hist[start:start+ml]...) + out = append(out, hist[start:start+ml]...) ml = 0 } } // We must be in current buffer now if ml > 0 { - start := len(s.out) - mo - if ml <= len(s.out)-start { + start := len(out) - mo + if ml <= len(out)-start { // No overlap - out = append(out, s.out[start:start+ml]...) + out = append(out, out[start:start+ml]...) } else { // Overlapping copy // Extend destination slice and copy one byte at the time. @@ -264,7 +382,6 @@ func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { } } } - s.out = out if i == 0 { // This is the last sequence, so we shouldn't update state. break @@ -278,7 +395,8 @@ func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { mlState = mlTable[mlState.newState()&maxTableMask] ofState = ofTable[ofState.newState()&maxTableMask] } else { - bits := br.getBitsFast(nBits) + bits := br.get32BitsFast(nBits) + lowBits := uint16(bits >> ((ofState.nbBits() + mlState.nbBits()) & 31)) llState = llTable[(llState.newState()+lowBits)&maxTableMask] @@ -291,19 +409,14 @@ func (s *sequenceDecs) decode(seqs int, br *bitReader, hist []byte) error { } } - // Add final literals - s.out = append(s.out, s.literals...) - return nil -} + // Check if space for literals + if size := len(s.literals) + len(s.out) - startSize; size > maxBlockSize { + return fmt.Errorf("output (%d) bigger than max block size (%d)", size, maxBlockSize) + } -// update states, at least 27 bits must be available. -func (s *sequenceDecs) update(br *bitReader) { - // Max 8 bits - s.litLengths.state.next(br) - // Max 9 bits - s.matchLengths.state.next(br) - // Max 8 bits - s.offsets.state.next(br) + // Add final literals + s.out = append(out, s.literals...) + return br.close() } var bitMask [16]uint16 @@ -314,87 +427,6 @@ func init() { } } -// update states, at least 27 bits must be available. -func (s *sequenceDecs) updateAlt(br *bitReader) { - // Update all 3 states at once. Approx 20% faster. - a, b, c := s.litLengths.state.state, s.matchLengths.state.state, s.offsets.state.state - - nBits := a.nbBits() + b.nbBits() + c.nbBits() - if nBits == 0 { - s.litLengths.state.state = s.litLengths.state.dt[a.newState()] - s.matchLengths.state.state = s.matchLengths.state.dt[b.newState()] - s.offsets.state.state = s.offsets.state.dt[c.newState()] - return - } - bits := br.getBitsFast(nBits) - lowBits := uint16(bits >> ((c.nbBits() + b.nbBits()) & 31)) - s.litLengths.state.state = s.litLengths.state.dt[a.newState()+lowBits] - - lowBits = uint16(bits >> (c.nbBits() & 31)) - lowBits &= bitMask[b.nbBits()&15] - s.matchLengths.state.state = s.matchLengths.state.dt[b.newState()+lowBits] - - lowBits = uint16(bits) & bitMask[c.nbBits()&15] - s.offsets.state.state = s.offsets.state.dt[c.newState()+lowBits] -} - -// nextFast will return new states when there are at least 4 unused bytes left on the stream when done. -func (s *sequenceDecs) nextFast(br *bitReader, llState, mlState, ofState decSymbol) (ll, mo, ml int) { - // Final will not read from stream. - ll, llB := llState.final() - ml, mlB := mlState.final() - mo, moB := ofState.final() - - // extra bits are stored in reverse order. - br.fillFast() - mo += br.getBits(moB) - if s.maxBits > 32 { - br.fillFast() - } - ml += br.getBits(mlB) - ll += br.getBits(llB) - - if moB > 1 { - s.prevOffset[2] = s.prevOffset[1] - s.prevOffset[1] = s.prevOffset[0] - s.prevOffset[0] = mo - return - } - // mo = s.adjustOffset(mo, ll, moB) - // Inlined for rather big speedup - if ll == 0 { - // There is an exception though, when current sequence's literals_length = 0. - // In this case, repeated offsets are shifted by one, so an offset_value of 1 means Repeated_Offset2, - // an offset_value of 2 means Repeated_Offset3, and an offset_value of 3 means Repeated_Offset1 - 1_byte. - mo++ - } - - if mo == 0 { - mo = s.prevOffset[0] - return - } - var temp int - if mo == 3 { - temp = s.prevOffset[0] - 1 - } else { - temp = s.prevOffset[mo] - } - - if temp == 0 { - // 0 is not valid; input is corrupted; force offset to 1 - println("temp was 0") - temp = 1 - } - - if mo != 1 { - s.prevOffset[2] = s.prevOffset[1] - } - s.prevOffset[1] = s.prevOffset[0] - s.prevOffset[0] = temp - mo = temp - return -} - func (s *sequenceDecs) next(br *bitReader, llState, mlState, ofState decSymbol) (ll, mo, ml int) { // Final will not read from stream. ll, llB := llState.final() @@ -457,36 +489,3 @@ func (s *sequenceDecs) adjustOffset(offset, litLen int, offsetB uint8) int { s.prevOffset[0] = temp return temp } - -// mergeHistory will merge history. -func (s *sequenceDecs) mergeHistory(hist *sequenceDecs) (*sequenceDecs, error) { - for i := uint(0); i < 3; i++ { - var sNew, sHist *sequenceDec - switch i { - default: - // same as "case 0": - sNew = &s.litLengths - sHist = &hist.litLengths - case 1: - sNew = &s.offsets - sHist = &hist.offsets - case 2: - sNew = &s.matchLengths - sHist = &hist.matchLengths - } - if sNew.repeat { - if sHist.fse == nil { - return nil, fmt.Errorf("sequence stream %d, repeat requested, but no history", i) - } - continue - } - if sNew.fse == nil { - return nil, fmt.Errorf("sequence stream %d, no fse found", i) - } - if sHist.fse != nil && !sHist.fse.preDefined { - fseDecoderPool.Put(sHist.fse) - } - sHist.fse = sNew.fse - } - return hist, nil -} diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go new file mode 100644 index 000000000..7598c1018 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go @@ -0,0 +1,368 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +package zstd + +import ( + "fmt" + + "github.com/klauspost/compress/internal/cpuinfo" +) + +type decodeSyncAsmContext struct { + llTable []decSymbol + mlTable []decSymbol + ofTable []decSymbol + llState uint64 + mlState uint64 + ofState uint64 + iteration int + litRemain int + out []byte + outPosition int + literals []byte + litPosition int + history []byte + windowSize int + ll int // set on error (not for all errors, please refer to _generate/gen.go) + ml int // set on error (not for all errors, please refer to _generate/gen.go) + mo int // set on error (not for all errors, please refer to _generate/gen.go) +} + +// sequenceDecs_decodeSync_amd64 implements the main loop of sequenceDecs.decodeSync in x86 asm. +// +// Please refer to seqdec_generic.go for the reference implementation. +//go:noescape +func sequenceDecs_decodeSync_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// sequenceDecs_decodeSync_bmi2 implements the main loop of sequenceDecs.decodeSync in x86 asm with BMI2 extensions. +//go:noescape +func sequenceDecs_decodeSync_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// sequenceDecs_decodeSync_safe_amd64 does the same as above, but does not write more than output buffer. +//go:noescape +func sequenceDecs_decodeSync_safe_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// sequenceDecs_decodeSync_safe_bmi2 does the same as above, but does not write more than output buffer. +//go:noescape +func sequenceDecs_decodeSync_safe_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// decode sequences from the stream with the provided history but without a dictionary. +func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { + if len(s.dict) > 0 { + return false, nil + } + if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSize { + return false, nil + } + + // FIXME: Using unsafe memory copies leads to rare, random crashes + // with fuzz testing. It is therefore disabled for now. + const useSafe = true + /* + useSafe := false + if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSizeAlloc { + useSafe = true + } + if s.maxSyncLen > 0 && cap(s.out)-len(s.out)-compressedBlockOverAlloc < int(s.maxSyncLen) { + useSafe = true + } + if cap(s.literals) < len(s.literals)+compressedBlockOverAlloc { + useSafe = true + } + */ + + br := s.br + + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + + ctx := decodeSyncAsmContext{ + llTable: s.litLengths.fse.dt[:maxTablesize], + mlTable: s.matchLengths.fse.dt[:maxTablesize], + ofTable: s.offsets.fse.dt[:maxTablesize], + llState: uint64(s.litLengths.state.state), + mlState: uint64(s.matchLengths.state.state), + ofState: uint64(s.offsets.state.state), + iteration: s.nSeqs - 1, + litRemain: len(s.literals), + out: s.out, + outPosition: len(s.out), + literals: s.literals, + windowSize: s.windowSize, + history: hist, + } + + s.seqSize = 0 + startSize := len(s.out) + + var errCode int + if cpuinfo.HasBMI2() { + if useSafe { + errCode = sequenceDecs_decodeSync_safe_bmi2(s, br, &ctx) + } else { + errCode = sequenceDecs_decodeSync_bmi2(s, br, &ctx) + } + } else { + if useSafe { + errCode = sequenceDecs_decodeSync_safe_amd64(s, br, &ctx) + } else { + errCode = sequenceDecs_decodeSync_amd64(s, br, &ctx) + } + } + switch errCode { + case noError: + break + + case errorMatchLenOfsMismatch: + return true, fmt.Errorf("zero matchoff and matchlen (%d) > 0", ctx.ml) + + case errorMatchLenTooBig: + return true, fmt.Errorf("match len (%d) bigger than max allowed length", ctx.ml) + + case errorMatchOffTooBig: + return true, fmt.Errorf("match offset (%d) bigger than current history (%d)", + ctx.mo, ctx.outPosition+len(hist)-startSize) + + case errorNotEnoughLiterals: + return true, fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", + ctx.ll, ctx.litRemain+ctx.ll) + + case errorNotEnoughSpace: + size := ctx.outPosition + ctx.ll + ctx.ml + if debugDecoder { + println("msl:", s.maxSyncLen, "cap", cap(s.out), "bef:", startSize, "sz:", size-startSize, "mbs:", maxBlockSize, "outsz:", cap(s.out)-startSize) + } + return true, fmt.Errorf("output (%d) bigger than max block size (%d)", size-startSize, maxBlockSize) + + default: + return true, fmt.Errorf("sequenceDecs_decode returned erronous code %d", errCode) + } + + s.seqSize += ctx.litRemain + if s.seqSize > maxBlockSize { + return true, fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + } + err := br.close() + if err != nil { + printf("Closing sequences: %v, %+v\n", err, *br) + return true, err + } + + s.literals = s.literals[ctx.litPosition:] + t := ctx.outPosition + s.out = s.out[:t] + + // Add final literals + s.out = append(s.out, s.literals...) + if debugDecoder { + t += len(s.literals) + if t != len(s.out) { + panic(fmt.Errorf("length mismatch, want %d, got %d", len(s.out), t)) + } + } + + return true, nil +} + +// -------------------------------------------------------------------------------- + +type decodeAsmContext struct { + llTable []decSymbol + mlTable []decSymbol + ofTable []decSymbol + llState uint64 + mlState uint64 + ofState uint64 + iteration int + seqs []seqVals + litRemain int +} + +const noError = 0 + +// error reported when mo == 0 && ml > 0 +const errorMatchLenOfsMismatch = 1 + +// error reported when ml > maxMatchLen +const errorMatchLenTooBig = 2 + +// error reported when mo > available history or mo > s.windowSize +const errorMatchOffTooBig = 3 + +// error reported when the sum of literal lengths exeeceds the literal buffer size +const errorNotEnoughLiterals = 4 + +// error reported when capacity of `out` is too small +const errorNotEnoughSpace = 5 + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm. +// +// Please refer to seqdec_generic.go for the reference implementation. +//go:noescape +func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm. +// +// Please refer to seqdec_generic.go for the reference implementation. +//go:noescape +func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm with BMI2 extensions. +//go:noescape +func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm with BMI2 extensions. +//go:noescape +func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// decode sequences from the stream without the provided history. +func (s *sequenceDecs) decode(seqs []seqVals) error { + br := s.br + + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + + ctx := decodeAsmContext{ + llTable: s.litLengths.fse.dt[:maxTablesize], + mlTable: s.matchLengths.fse.dt[:maxTablesize], + ofTable: s.offsets.fse.dt[:maxTablesize], + llState: uint64(s.litLengths.state.state), + mlState: uint64(s.matchLengths.state.state), + ofState: uint64(s.offsets.state.state), + seqs: seqs, + iteration: len(seqs) - 1, + litRemain: len(s.literals), + } + + s.seqSize = 0 + lte56bits := s.maxBits+s.offsets.fse.actualTableLog+s.matchLengths.fse.actualTableLog+s.litLengths.fse.actualTableLog <= 56 + var errCode int + if cpuinfo.HasBMI2() { + if lte56bits { + errCode = sequenceDecs_decode_56_bmi2(s, br, &ctx) + } else { + errCode = sequenceDecs_decode_bmi2(s, br, &ctx) + } + } else { + if lte56bits { + errCode = sequenceDecs_decode_56_amd64(s, br, &ctx) + } else { + errCode = sequenceDecs_decode_amd64(s, br, &ctx) + } + } + if errCode != 0 { + i := len(seqs) - ctx.iteration - 1 + switch errCode { + case errorMatchLenOfsMismatch: + ml := ctx.seqs[i].ml + return fmt.Errorf("zero matchoff and matchlen (%d) > 0", ml) + + case errorMatchLenTooBig: + ml := ctx.seqs[i].ml + return fmt.Errorf("match len (%d) bigger than max allowed length", ml) + + case errorNotEnoughLiterals: + ll := ctx.seqs[i].ll + return fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", ll, ctx.litRemain+ll) + } + + return fmt.Errorf("sequenceDecs_decode_amd64 returned erronous code %d", errCode) + } + + if ctx.litRemain < 0 { + return fmt.Errorf("literal count is too big: total available %d, total requested %d", + len(s.literals), len(s.literals)-ctx.litRemain) + } + + s.seqSize += ctx.litRemain + if s.seqSize > maxBlockSize { + return fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + } + err := br.close() + if err != nil { + printf("Closing sequences: %v, %+v\n", err, *br) + } + return err +} + +// -------------------------------------------------------------------------------- + +type executeAsmContext struct { + seqs []seqVals + seqIndex int + out []byte + history []byte + literals []byte + outPosition int + litPosition int + windowSize int +} + +// sequenceDecs_executeSimple_amd64 implements the main loop of sequenceDecs.executeSimple in x86 asm. +// +// Returns false if a match offset is too big. +// +// Please refer to seqdec_generic.go for the reference implementation. +//go:noescape +func sequenceDecs_executeSimple_amd64(ctx *executeAsmContext) bool + +// Same as above, but with safe memcopies +//go:noescape +func sequenceDecs_executeSimple_safe_amd64(ctx *executeAsmContext) bool + +// executeSimple handles cases when dictionary is not used. +func (s *sequenceDecs) executeSimple(seqs []seqVals, hist []byte) error { + // Ensure we have enough output size... + if len(s.out)+s.seqSize+compressedBlockOverAlloc > cap(s.out) { + addBytes := s.seqSize + len(s.out) + compressedBlockOverAlloc + s.out = append(s.out, make([]byte, addBytes)...) + s.out = s.out[:len(s.out)-addBytes] + } + + if debugDecoder { + printf("Execute %d seqs with literals: %d into %d bytes\n", len(seqs), len(s.literals), s.seqSize) + } + + var t = len(s.out) + out := s.out[:t+s.seqSize] + + ctx := executeAsmContext{ + seqs: seqs, + seqIndex: 0, + out: out, + history: hist, + outPosition: t, + litPosition: 0, + literals: s.literals, + windowSize: s.windowSize, + } + var ok bool + if cap(s.literals) < len(s.literals)+compressedBlockOverAlloc { + ok = sequenceDecs_executeSimple_safe_amd64(&ctx) + } else { + ok = sequenceDecs_executeSimple_amd64(&ctx) + } + if !ok { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", + seqs[ctx.seqIndex].mo, ctx.outPosition+len(hist)) + } + s.literals = s.literals[ctx.litPosition:] + t = ctx.outPosition + + // Add final literals + copy(out[t:], s.literals) + if debugDecoder { + t += len(s.literals) + if t != len(out) { + panic(fmt.Errorf("length mismatch, want %d, got %d, ss: %d", len(out), t, s.seqSize)) + } + } + s.out = out + + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s new file mode 100644 index 000000000..27e76774c --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s @@ -0,0 +1,4100 @@ +// Code generated by command: go run gen.go -out ../seqdec_amd64.s -pkg=zstd. DO NOT EDIT. + +//go:build !appengine && !noasm && gc && !noasm +// +build !appengine,!noasm,gc,!noasm + +// func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: CMOV +TEXT ·sequenceDecs_decode_amd64(SB), $8-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + MOVQ 104(AX), R10 + MOVQ s+0(FP), AX + MOVQ 144(AX), R11 + MOVQ 152(AX), R12 + MOVQ 160(AX), R13 + +sequenceDecs_decode_amd64_main_loop: + MOVQ (SP), R14 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decode_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R14 + MOVQ (R14), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decode_amd64_fill_end + +sequenceDecs_decode_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decode_amd64_fill_end + CMPQ BX, $0x07 + JLE sequenceDecs_decode_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R14 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R14), AX + ORQ AX, DX + JMP sequenceDecs_decode_amd64_fill_byte_by_byte + +sequenceDecs_decode_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_of_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_of_update_zero: + MOVQ AX, 16(R10) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_ml_update_zero: + MOVQ AX, 8(R10) + + // Fill bitreader to have enough for the remaining + CMPQ SI, $0x08 + JL sequenceDecs_decode_amd64_fill_2_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R14 + MOVQ (R14), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decode_amd64_fill_2_end + +sequenceDecs_decode_amd64_fill_2_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decode_amd64_fill_2_end + CMPQ BX, $0x07 + JLE sequenceDecs_decode_amd64_fill_2_end + SHLQ $0x08, DX + SUBQ $0x01, R14 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R14), AX + ORQ AX, DX + JMP sequenceDecs_decode_amd64_fill_2_byte_by_byte + +sequenceDecs_decode_amd64_fill_2_end: + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_ll_update_zero: + MOVQ AX, (R10) + + // Fill bitreader for state updates + MOVQ R14, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R14 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R14 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R14 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decode_amd64_skip_update: + // Adjust offset + MOVQ 16(R10), CX + CMPQ AX, $0x01 + JBE sequenceDecs_decode_amd64_adjust_offsetB_1_or_0 + MOVQ R12, R13 + MOVQ R11, R12 + MOVQ CX, R11 + JMP sequenceDecs_decode_amd64_after_adjust + +sequenceDecs_decode_amd64_adjust_offsetB_1_or_0: + CMPQ (R10), $0x00000000 + JNE sequenceDecs_decode_amd64_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_amd64_adjust_offset_nonzero + +sequenceDecs_decode_amd64_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_amd64_adjust_offset_nonzero + MOVQ R11, CX + JMP sequenceDecs_decode_amd64_after_adjust + +sequenceDecs_decode_amd64_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_amd64_adjust_zero + JEQ sequenceDecs_decode_amd64_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_amd64_adjust_three + JMP sequenceDecs_decode_amd64_adjust_two + +sequenceDecs_decode_amd64_adjust_zero: + MOVQ R11, AX + JMP sequenceDecs_decode_amd64_adjust_test_temp_valid + +sequenceDecs_decode_amd64_adjust_one: + MOVQ R12, AX + JMP sequenceDecs_decode_amd64_adjust_test_temp_valid + +sequenceDecs_decode_amd64_adjust_two: + MOVQ R13, AX + JMP sequenceDecs_decode_amd64_adjust_test_temp_valid + +sequenceDecs_decode_amd64_adjust_three: + LEAQ -1(R11), AX + +sequenceDecs_decode_amd64_adjust_test_temp_valid: + TESTQ AX, AX + JNZ sequenceDecs_decode_amd64_adjust_temp_valid + MOVQ $0x00000001, AX + +sequenceDecs_decode_amd64_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R12, R13 + MOVQ R11, R12 + MOVQ AX, R11 + MOVQ AX, CX + +sequenceDecs_decode_amd64_after_adjust: + MOVQ CX, 16(R10) + + // Check values + MOVQ 8(R10), AX + MOVQ (R10), R14 + LEAQ (AX)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decode_amd64_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decode_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decode_amd64_match_len_ofs_ok: + ADDQ $0x18, R10 + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decode_amd64_main_loop + MOVQ s+0(FP), AX + MOVQ R11, 144(AX) + MOVQ R12, 152(AX) + MOVQ R13, 160(AX) + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_amd64_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_amd64_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: CMOV +TEXT ·sequenceDecs_decode_56_amd64(SB), $8-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + MOVQ 104(AX), R10 + MOVQ s+0(FP), AX + MOVQ 144(AX), R11 + MOVQ 152(AX), R12 + MOVQ 160(AX), R13 + +sequenceDecs_decode_56_amd64_main_loop: + MOVQ (SP), R14 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decode_56_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R14 + MOVQ (R14), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decode_56_amd64_fill_end + +sequenceDecs_decode_56_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decode_56_amd64_fill_end + CMPQ BX, $0x07 + JLE sequenceDecs_decode_56_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R14 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R14), AX + ORQ AX, DX + JMP sequenceDecs_decode_56_amd64_fill_byte_by_byte + +sequenceDecs_decode_56_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_of_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_of_update_zero: + MOVQ AX, 16(R10) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_ml_update_zero: + MOVQ AX, 8(R10) + + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_ll_update_zero: + MOVQ AX, (R10) + + // Fill bitreader for state updates + MOVQ R14, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_56_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R14 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R14 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R14 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decode_56_amd64_skip_update: + // Adjust offset + MOVQ 16(R10), CX + CMPQ AX, $0x01 + JBE sequenceDecs_decode_56_amd64_adjust_offsetB_1_or_0 + MOVQ R12, R13 + MOVQ R11, R12 + MOVQ CX, R11 + JMP sequenceDecs_decode_56_amd64_after_adjust + +sequenceDecs_decode_56_amd64_adjust_offsetB_1_or_0: + CMPQ (R10), $0x00000000 + JNE sequenceDecs_decode_56_amd64_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_56_amd64_adjust_offset_nonzero + +sequenceDecs_decode_56_amd64_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_56_amd64_adjust_offset_nonzero + MOVQ R11, CX + JMP sequenceDecs_decode_56_amd64_after_adjust + +sequenceDecs_decode_56_amd64_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_56_amd64_adjust_zero + JEQ sequenceDecs_decode_56_amd64_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_56_amd64_adjust_three + JMP sequenceDecs_decode_56_amd64_adjust_two + +sequenceDecs_decode_56_amd64_adjust_zero: + MOVQ R11, AX + JMP sequenceDecs_decode_56_amd64_adjust_test_temp_valid + +sequenceDecs_decode_56_amd64_adjust_one: + MOVQ R12, AX + JMP sequenceDecs_decode_56_amd64_adjust_test_temp_valid + +sequenceDecs_decode_56_amd64_adjust_two: + MOVQ R13, AX + JMP sequenceDecs_decode_56_amd64_adjust_test_temp_valid + +sequenceDecs_decode_56_amd64_adjust_three: + LEAQ -1(R11), AX + +sequenceDecs_decode_56_amd64_adjust_test_temp_valid: + TESTQ AX, AX + JNZ sequenceDecs_decode_56_amd64_adjust_temp_valid + MOVQ $0x00000001, AX + +sequenceDecs_decode_56_amd64_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R12, R13 + MOVQ R11, R12 + MOVQ AX, R11 + MOVQ AX, CX + +sequenceDecs_decode_56_amd64_after_adjust: + MOVQ CX, 16(R10) + + // Check values + MOVQ 8(R10), AX + MOVQ (R10), R14 + LEAQ (AX)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decode_56_amd64_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_56_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decode_56_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decode_56_amd64_match_len_ofs_ok: + ADDQ $0x18, R10 + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decode_56_amd64_main_loop + MOVQ s+0(FP), AX + MOVQ R11, 144(AX) + MOVQ R12, 152(AX) + MOVQ R13, 160(AX) + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_56_amd64_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_56_amd64_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: BMI, BMI2, CMOV +TEXT ·sequenceDecs_decode_bmi2(SB), $8-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + MOVQ 104(CX), R9 + MOVQ s+0(FP), CX + MOVQ 144(CX), R10 + MOVQ 152(CX), R11 + MOVQ 160(CX), R12 + +sequenceDecs_decode_bmi2_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decode_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R13 + MOVQ (R13), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decode_bmi2_fill_end + +sequenceDecs_decode_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decode_bmi2_fill_end + CMPQ DX, $0x07 + JLE sequenceDecs_decode_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R13 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R13), CX + ORQ CX, AX + JMP sequenceDecs_decode_bmi2_fill_byte_by_byte + +sequenceDecs_decode_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 16(R9) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 8(R9) + + // Fill bitreader to have enough for the remaining + CMPQ BX, $0x08 + JL sequenceDecs_decode_bmi2_fill_2_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R13 + MOVQ (R13), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decode_bmi2_fill_2_end + +sequenceDecs_decode_bmi2_fill_2_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decode_bmi2_fill_2_end + CMPQ DX, $0x07 + JLE sequenceDecs_decode_bmi2_fill_2_end + SHLQ $0x08, AX + SUBQ $0x01, R13 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R13), CX + ORQ CX, AX + JMP sequenceDecs_decode_bmi2_fill_2_byte_by_byte + +sequenceDecs_decode_bmi2_fill_2_end: + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, (R9) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_bmi2_skip_update + LEAQ (SI)(DI*1), R14 + ADDQ R8, R14 + MOVBQZX R14, R14 + LEAQ (DX)(R14*1), CX + MOVQ AX, R15 + MOVQ CX, DX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + + // Update Offset State + BZHIQ R8, R15, CX + SHRXQ R8, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R15, CX + SHRXQ DI, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R15, CX + MOVQ $0x00001010, R14 + BEXTRQ R14, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decode_bmi2_skip_update: + // Adjust offset + MOVQ 16(R9), CX + CMPQ R13, $0x01 + JBE sequenceDecs_decode_bmi2_adjust_offsetB_1_or_0 + MOVQ R11, R12 + MOVQ R10, R11 + MOVQ CX, R10 + JMP sequenceDecs_decode_bmi2_after_adjust + +sequenceDecs_decode_bmi2_adjust_offsetB_1_or_0: + CMPQ (R9), $0x00000000 + JNE sequenceDecs_decode_bmi2_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_bmi2_adjust_offset_nonzero + +sequenceDecs_decode_bmi2_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_bmi2_adjust_offset_nonzero + MOVQ R10, CX + JMP sequenceDecs_decode_bmi2_after_adjust + +sequenceDecs_decode_bmi2_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_bmi2_adjust_zero + JEQ sequenceDecs_decode_bmi2_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_bmi2_adjust_three + JMP sequenceDecs_decode_bmi2_adjust_two + +sequenceDecs_decode_bmi2_adjust_zero: + MOVQ R10, R13 + JMP sequenceDecs_decode_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_bmi2_adjust_one: + MOVQ R11, R13 + JMP sequenceDecs_decode_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_bmi2_adjust_two: + MOVQ R12, R13 + JMP sequenceDecs_decode_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_bmi2_adjust_three: + LEAQ -1(R10), R13 + +sequenceDecs_decode_bmi2_adjust_test_temp_valid: + TESTQ R13, R13 + JNZ sequenceDecs_decode_bmi2_adjust_temp_valid + MOVQ $0x00000001, R13 + +sequenceDecs_decode_bmi2_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R11, R12 + MOVQ R10, R11 + MOVQ R13, R10 + MOVQ R13, CX + +sequenceDecs_decode_bmi2_after_adjust: + MOVQ CX, 16(R9) + + // Check values + MOVQ 8(R9), R13 + MOVQ (R9), R14 + LEAQ (R13)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ R13, $0x00020002 + JA sequenceDecs_decode_bmi2_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_bmi2_match_len_ofs_ok + TESTQ R13, R13 + JNZ sequenceDecs_decode_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decode_bmi2_match_len_ofs_ok: + ADDQ $0x18, R9 + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decode_bmi2_main_loop + MOVQ s+0(FP), CX + MOVQ R10, 144(CX) + MOVQ R11, 152(CX) + MOVQ R12, 160(CX) + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_bmi2_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_bmi2_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: BMI, BMI2, CMOV +TEXT ·sequenceDecs_decode_56_bmi2(SB), $8-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + MOVQ 104(CX), R9 + MOVQ s+0(FP), CX + MOVQ 144(CX), R10 + MOVQ 152(CX), R11 + MOVQ 160(CX), R12 + +sequenceDecs_decode_56_bmi2_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decode_56_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R13 + MOVQ (R13), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decode_56_bmi2_fill_end + +sequenceDecs_decode_56_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decode_56_bmi2_fill_end + CMPQ DX, $0x07 + JLE sequenceDecs_decode_56_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R13 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R13), CX + ORQ CX, AX + JMP sequenceDecs_decode_56_bmi2_fill_byte_by_byte + +sequenceDecs_decode_56_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 16(R9) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 8(R9) + + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, (R9) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_56_bmi2_skip_update + LEAQ (SI)(DI*1), R14 + ADDQ R8, R14 + MOVBQZX R14, R14 + LEAQ (DX)(R14*1), CX + MOVQ AX, R15 + MOVQ CX, DX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + + // Update Offset State + BZHIQ R8, R15, CX + SHRXQ R8, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R15, CX + SHRXQ DI, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R15, CX + MOVQ $0x00001010, R14 + BEXTRQ R14, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decode_56_bmi2_skip_update: + // Adjust offset + MOVQ 16(R9), CX + CMPQ R13, $0x01 + JBE sequenceDecs_decode_56_bmi2_adjust_offsetB_1_or_0 + MOVQ R11, R12 + MOVQ R10, R11 + MOVQ CX, R10 + JMP sequenceDecs_decode_56_bmi2_after_adjust + +sequenceDecs_decode_56_bmi2_adjust_offsetB_1_or_0: + CMPQ (R9), $0x00000000 + JNE sequenceDecs_decode_56_bmi2_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_56_bmi2_adjust_offset_nonzero + +sequenceDecs_decode_56_bmi2_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_56_bmi2_adjust_offset_nonzero + MOVQ R10, CX + JMP sequenceDecs_decode_56_bmi2_after_adjust + +sequenceDecs_decode_56_bmi2_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_56_bmi2_adjust_zero + JEQ sequenceDecs_decode_56_bmi2_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_56_bmi2_adjust_three + JMP sequenceDecs_decode_56_bmi2_adjust_two + +sequenceDecs_decode_56_bmi2_adjust_zero: + MOVQ R10, R13 + JMP sequenceDecs_decode_56_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_56_bmi2_adjust_one: + MOVQ R11, R13 + JMP sequenceDecs_decode_56_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_56_bmi2_adjust_two: + MOVQ R12, R13 + JMP sequenceDecs_decode_56_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_56_bmi2_adjust_three: + LEAQ -1(R10), R13 + +sequenceDecs_decode_56_bmi2_adjust_test_temp_valid: + TESTQ R13, R13 + JNZ sequenceDecs_decode_56_bmi2_adjust_temp_valid + MOVQ $0x00000001, R13 + +sequenceDecs_decode_56_bmi2_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R11, R12 + MOVQ R10, R11 + MOVQ R13, R10 + MOVQ R13, CX + +sequenceDecs_decode_56_bmi2_after_adjust: + MOVQ CX, 16(R9) + + // Check values + MOVQ 8(R9), R13 + MOVQ (R9), R14 + LEAQ (R13)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ R13, $0x00020002 + JA sequenceDecs_decode_56_bmi2_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_56_bmi2_match_len_ofs_ok + TESTQ R13, R13 + JNZ sequenceDecs_decode_56_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decode_56_bmi2_match_len_ofs_ok: + ADDQ $0x18, R9 + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decode_56_bmi2_main_loop + MOVQ s+0(FP), CX + MOVQ R10, 144(CX) + MOVQ R11, 152(CX) + MOVQ R12, 160(CX) + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_56_bmi2_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_56_bmi2_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_executeSimple_amd64(ctx *executeAsmContext) bool +// Requires: SSE +TEXT ·sequenceDecs_executeSimple_amd64(SB), $8-9 + MOVQ ctx+0(FP), R10 + MOVQ 8(R10), CX + TESTQ CX, CX + JZ empty_seqs + MOVQ (R10), AX + MOVQ 24(R10), DX + MOVQ 32(R10), BX + MOVQ 80(R10), SI + MOVQ 104(R10), DI + MOVQ 120(R10), R8 + MOVQ 56(R10), R9 + MOVQ 64(R10), R10 + ADDQ R10, R9 + + // seqsBase += 24 * seqIndex + LEAQ (DX)(DX*2), R11 + SHLQ $0x03, R11 + ADDQ R11, AX + + // outBase += outPosition + ADDQ DI, BX + +main_loop: + MOVQ (AX), R11 + MOVQ 16(AX), R12 + MOVQ 8(AX), R13 + + // Copy literals + TESTQ R11, R11 + JZ check_offset + XORQ R14, R14 + +copy_1: + MOVUPS (SI)(R14*1), X0 + MOVUPS X0, (BX)(R14*1) + ADDQ $0x10, R14 + CMPQ R14, R11 + JB copy_1 + ADDQ R11, SI + ADDQ R11, BX + ADDQ R11, DI + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + LEAQ (DI)(R10*1), R11 + CMPQ R12, R11 + JG error_match_off_too_big + CMPQ R12, R8 + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, R11 + SUBQ DI, R11 + JLS copy_match + MOVQ R9, R14 + SUBQ R11, R14 + CMPQ R13, R11 + JG copy_all_from_history + MOVQ R13, R11 + SUBQ $0x10, R11 + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R11 + JAE copy_4_loop + LEAQ 16(R14)(R11*1), R14 + LEAQ 16(BX)(R11*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), R11 + MOVB 2(R14), R12 + MOVW R11, (BX) + MOVB R12, 2(BX) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), R11 + MOVL -4(R14)(R13*1), R12 + MOVL R11, (BX) + MOVL R12, -4(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), R11 + MOVQ -8(R14)(R13*1), R12 + MOVQ R11, (BX) + MOVQ R12, -8(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + +copy_4_end: + ADDQ R13, DI + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + JMP loop_finished + +copy_all_from_history: + MOVQ R11, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(BX)(R15*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_5_end + +copy_5_small: + CMPQ R11, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ R11, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(R11*1), BP + MOVB R15, (BX) + MOVB BP, -1(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (BX) + MOVB BP, 2(BX) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(R11*1), BP + MOVL R15, (BX) + MOVL BP, -4(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(R11*1), BP + MOVQ R15, (BX) + MOVQ BP, -8(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + +copy_5_end: + ADDQ R11, DI + SUBQ R11, R13 + + // Copy match from the current buffer +copy_match: + MOVQ BX, R11 + SUBQ R12, R11 + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, DI + MOVQ BX, R12 + ADDQ R13, BX + +copy_2: + MOVUPS (R11), X0 + MOVUPS X0, (R12) + ADDQ $0x10, R11 + ADDQ $0x10, R12 + SUBQ $0x10, R13 + JHI copy_2 + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, DI + +copy_slow_3: + MOVB (R11), R12 + MOVB R12, (BX) + INCQ R11 + INCQ BX + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + +loop_finished: + // Return value + MOVB $0x01, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + MOVQ 80(AX), CX + SUBQ CX, SI + MOVQ SI, 112(AX) + RET + +error_match_off_too_big: + // Return value + MOVB $0x00, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + MOVQ 80(AX), CX + SUBQ CX, SI + MOVQ SI, 112(AX) + RET + +empty_seqs: + // Return value + MOVB $0x01, ret+8(FP) + RET + +// func sequenceDecs_executeSimple_safe_amd64(ctx *executeAsmContext) bool +// Requires: SSE +TEXT ·sequenceDecs_executeSimple_safe_amd64(SB), $8-9 + MOVQ ctx+0(FP), R10 + MOVQ 8(R10), CX + TESTQ CX, CX + JZ empty_seqs + MOVQ (R10), AX + MOVQ 24(R10), DX + MOVQ 32(R10), BX + MOVQ 80(R10), SI + MOVQ 104(R10), DI + MOVQ 120(R10), R8 + MOVQ 56(R10), R9 + MOVQ 64(R10), R10 + ADDQ R10, R9 + + // seqsBase += 24 * seqIndex + LEAQ (DX)(DX*2), R11 + SHLQ $0x03, R11 + ADDQ R11, AX + + // outBase += outPosition + ADDQ DI, BX + +main_loop: + MOVQ (AX), R11 + MOVQ 16(AX), R12 + MOVQ 8(AX), R13 + + // Copy literals + TESTQ R11, R11 + JZ check_offset + MOVQ R11, R14 + SUBQ $0x10, R14 + JB copy_1_small + +copy_1_loop: + MOVUPS (SI), X0 + MOVUPS X0, (BX) + ADDQ $0x10, SI + ADDQ $0x10, BX + SUBQ $0x10, R14 + JAE copy_1_loop + LEAQ 16(SI)(R14*1), SI + LEAQ 16(BX)(R14*1), BX + MOVUPS -16(SI), X0 + MOVUPS X0, -16(BX) + JMP copy_1_end + +copy_1_small: + CMPQ R11, $0x03 + JE copy_1_move_3 + JB copy_1_move_1or2 + CMPQ R11, $0x08 + JB copy_1_move_4through7 + JMP copy_1_move_8through16 + +copy_1_move_1or2: + MOVB (SI), R14 + MOVB -1(SI)(R11*1), R15 + MOVB R14, (BX) + MOVB R15, -1(BX)(R11*1) + ADDQ R11, SI + ADDQ R11, BX + JMP copy_1_end + +copy_1_move_3: + MOVW (SI), R14 + MOVB 2(SI), R15 + MOVW R14, (BX) + MOVB R15, 2(BX) + ADDQ R11, SI + ADDQ R11, BX + JMP copy_1_end + +copy_1_move_4through7: + MOVL (SI), R14 + MOVL -4(SI)(R11*1), R15 + MOVL R14, (BX) + MOVL R15, -4(BX)(R11*1) + ADDQ R11, SI + ADDQ R11, BX + JMP copy_1_end + +copy_1_move_8through16: + MOVQ (SI), R14 + MOVQ -8(SI)(R11*1), R15 + MOVQ R14, (BX) + MOVQ R15, -8(BX)(R11*1) + ADDQ R11, SI + ADDQ R11, BX + +copy_1_end: + ADDQ R11, DI + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + LEAQ (DI)(R10*1), R11 + CMPQ R12, R11 + JG error_match_off_too_big + CMPQ R12, R8 + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, R11 + SUBQ DI, R11 + JLS copy_match + MOVQ R9, R14 + SUBQ R11, R14 + CMPQ R13, R11 + JG copy_all_from_history + MOVQ R13, R11 + SUBQ $0x10, R11 + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R11 + JAE copy_4_loop + LEAQ 16(R14)(R11*1), R14 + LEAQ 16(BX)(R11*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), R11 + MOVB 2(R14), R12 + MOVW R11, (BX) + MOVB R12, 2(BX) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), R11 + MOVL -4(R14)(R13*1), R12 + MOVL R11, (BX) + MOVL R12, -4(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), R11 + MOVQ -8(R14)(R13*1), R12 + MOVQ R11, (BX) + MOVQ R12, -8(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + +copy_4_end: + ADDQ R13, DI + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + JMP loop_finished + +copy_all_from_history: + MOVQ R11, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(BX)(R15*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_5_end + +copy_5_small: + CMPQ R11, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ R11, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(R11*1), BP + MOVB R15, (BX) + MOVB BP, -1(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (BX) + MOVB BP, 2(BX) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(R11*1), BP + MOVL R15, (BX) + MOVL BP, -4(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(R11*1), BP + MOVQ R15, (BX) + MOVQ BP, -8(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + +copy_5_end: + ADDQ R11, DI + SUBQ R11, R13 + + // Copy match from the current buffer +copy_match: + MOVQ BX, R11 + SUBQ R12, R11 + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, DI + MOVQ R13, R12 + SUBQ $0x10, R12 + JB copy_2_small + +copy_2_loop: + MOVUPS (R11), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R11 + ADDQ $0x10, BX + SUBQ $0x10, R12 + JAE copy_2_loop + LEAQ 16(R11)(R12*1), R11 + LEAQ 16(BX)(R12*1), BX + MOVUPS -16(R11), X0 + MOVUPS X0, -16(BX) + JMP copy_2_end + +copy_2_small: + CMPQ R13, $0x03 + JE copy_2_move_3 + JB copy_2_move_1or2 + CMPQ R13, $0x08 + JB copy_2_move_4through7 + JMP copy_2_move_8through16 + +copy_2_move_1or2: + MOVB (R11), R12 + MOVB -1(R11)(R13*1), R14 + MOVB R12, (BX) + MOVB R14, -1(BX)(R13*1) + ADDQ R13, R11 + ADDQ R13, BX + JMP copy_2_end + +copy_2_move_3: + MOVW (R11), R12 + MOVB 2(R11), R14 + MOVW R12, (BX) + MOVB R14, 2(BX) + ADDQ R13, R11 + ADDQ R13, BX + JMP copy_2_end + +copy_2_move_4through7: + MOVL (R11), R12 + MOVL -4(R11)(R13*1), R14 + MOVL R12, (BX) + MOVL R14, -4(BX)(R13*1) + ADDQ R13, R11 + ADDQ R13, BX + JMP copy_2_end + +copy_2_move_8through16: + MOVQ (R11), R12 + MOVQ -8(R11)(R13*1), R14 + MOVQ R12, (BX) + MOVQ R14, -8(BX)(R13*1) + ADDQ R13, R11 + ADDQ R13, BX + +copy_2_end: + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, DI + +copy_slow_3: + MOVB (R11), R12 + MOVB R12, (BX) + INCQ R11 + INCQ BX + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + +loop_finished: + // Return value + MOVB $0x01, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + MOVQ 80(AX), CX + SUBQ CX, SI + MOVQ SI, 112(AX) + RET + +error_match_off_too_big: + // Return value + MOVB $0x00, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + MOVQ 80(AX), CX + SUBQ CX, SI + MOVQ SI, 112(AX) + RET + +empty_seqs: + // Return value + MOVB $0x01, ret+8(FP) + RET + +// func sequenceDecs_decodeSync_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: CMOV, SSE +TEXT ·sequenceDecs_decodeSync_amd64(SB), $64-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + XORQ CX, CX + MOVQ CX, 8(SP) + MOVQ CX, 16(SP) + MOVQ CX, 24(SP) + MOVQ 112(AX), R10 + MOVQ 128(AX), CX + MOVQ CX, 32(SP) + MOVQ 144(AX), R11 + MOVQ 136(AX), R12 + MOVQ 200(AX), CX + MOVQ CX, 56(SP) + MOVQ 176(AX), CX + MOVQ CX, 48(SP) + MOVQ 184(AX), AX + MOVQ AX, 40(SP) + MOVQ 40(SP), AX + ADDQ AX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R10, 32(SP) + + // outBase += outPosition + ADDQ R12, R10 + +sequenceDecs_decodeSync_amd64_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_amd64_fill_end + +sequenceDecs_decodeSync_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_amd64_fill_end + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_amd64_fill_byte_by_byte + +sequenceDecs_decodeSync_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_of_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_of_update_zero: + MOVQ AX, 8(SP) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_ml_update_zero: + MOVQ AX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_amd64_fill_2_end + +sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_amd64_fill_2_end + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_amd64_fill_2_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte + +sequenceDecs_decodeSync_amd64_fill_2_end: + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_ll_update_zero: + MOVQ AX, 24(SP) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R13 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R13 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R13 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decodeSync_amd64_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ AX, $0x01 + JBE sequenceDecs_decodeSync_amd64_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_amd64_after_adjust + +sequenceDecs_decodeSync_amd64_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_amd64_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_amd64_adjust_offset_nonzero + +sequenceDecs_decodeSync_amd64_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_amd64_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_amd64_after_adjust + +sequenceDecs_decodeSync_amd64_adjust_offset_nonzero: + MOVQ R13, AX + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, AX + CMOVQEQ R15, R14 + ADDQ 144(CX)(AX*8), R14 + JNZ sequenceDecs_decodeSync_amd64_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_amd64_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_amd64_adjust_skip + MOVQ 152(CX), AX + MOVQ AX, 160(CX) + +sequenceDecs_decodeSync_amd64_adjust_skip: + MOVQ 144(CX), AX + MOVQ AX, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_amd64_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), AX + MOVQ 24(SP), CX + LEAQ (AX)(CX*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ CX, 104(R14) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decodeSync_amd64_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decodeSync_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_amd64_match_len_ofs_ok: + MOVQ 24(SP), AX + MOVQ 8(SP), CX + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (AX)(R13*1), R14 + ADDQ R10, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ AX, AX + JZ check_offset + XORQ R14, R14 + +copy_1: + MOVUPS (R11)(R14*1), X0 + MOVUPS X0, (R10)(R14*1) + ADDQ $0x10, R14 + CMPQ R14, AX + JB copy_1 + ADDQ AX, R11 + ADDQ AX, R10 + ADDQ AX, R12 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R12, AX + ADDQ 40(SP), AX + CMPQ CX, AX + JG error_match_off_too_big + CMPQ CX, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ CX, AX + SUBQ R12, AX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ AX, R14 + CMPQ R13, AX + JG copy_all_from_history + MOVQ R13, AX + SUBQ $0x10, AX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, AX + JAE copy_4_loop + LEAQ 16(R14)(AX*1), R14 + LEAQ 16(R10)(AX*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), AX + MOVB 2(R14), CL + MOVW AX, (R10) + MOVB CL, 2(R10) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), AX + MOVL -4(R14)(R13*1), CX + MOVL AX, (R10) + MOVL CX, -4(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), AX + MOVQ -8(R14)(R13*1), CX + MOVQ AX, (R10) + MOVQ CX, -8(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + +copy_4_end: + ADDQ R13, R12 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ AX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R10)(R15*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_5_end + +copy_5_small: + CMPQ AX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ AX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(AX*1), BP + MOVB R15, (R10) + MOVB BP, -1(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R10) + MOVB BP, 2(R10) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(AX*1), BP + MOVL R15, (R10) + MOVL BP, -4(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(AX*1), BP + MOVQ R15, (R10) + MOVQ BP, -8(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + +copy_5_end: + ADDQ AX, R12 + SUBQ AX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R10, AX + SUBQ CX, AX + + // ml <= mo + CMPQ R13, CX + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R12 + MOVQ R10, CX + ADDQ R13, R10 + +copy_2: + MOVUPS (AX), X0 + MOVUPS X0, (CX) + ADDQ $0x10, AX + ADDQ $0x10, CX + SUBQ $0x10, R13 + JHI copy_2 + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R12 + +copy_slow_3: + MOVB (AX), CL + MOVB CL, (R10) + INCQ AX + INCQ R10 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decodeSync_amd64_main_loop + +loop_finished: + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R12, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R11 + MOVQ R11, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_amd64_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_amd64_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decodeSync_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: BMI, BMI2, CMOV, SSE +TEXT ·sequenceDecs_decodeSync_bmi2(SB), $64-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + XORQ R9, R9 + MOVQ R9, 8(SP) + MOVQ R9, 16(SP) + MOVQ R9, 24(SP) + MOVQ 112(CX), R9 + MOVQ 128(CX), R10 + MOVQ R10, 32(SP) + MOVQ 144(CX), R10 + MOVQ 136(CX), R11 + MOVQ 200(CX), R12 + MOVQ R12, 56(SP) + MOVQ 176(CX), R12 + MOVQ R12, 48(SP) + MOVQ 184(CX), CX + MOVQ CX, 40(SP) + MOVQ 40(SP), CX + ADDQ CX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R9, 32(SP) + + // outBase += outPosition + ADDQ R11, R9 + +sequenceDecs_decodeSync_bmi2_main_loop: + MOVQ (SP), R12 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_bmi2_fill_end + +sequenceDecs_decodeSync_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_bmi2_fill_end + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_bmi2_fill_byte_by_byte + +sequenceDecs_decodeSync_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 8(SP) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_bmi2_fill_2_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_bmi2_fill_2_end + +sequenceDecs_decodeSync_bmi2_fill_2_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_bmi2_fill_2_end + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_bmi2_fill_2_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_bmi2_fill_2_byte_by_byte + +sequenceDecs_decodeSync_bmi2_fill_2_end: + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 24(SP) + + // Fill bitreader for state updates + MOVQ R12, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R12 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_bmi2_skip_update + LEAQ (SI)(DI*1), R13 + ADDQ R8, R13 + MOVBQZX R13, R13 + LEAQ (DX)(R13*1), CX + MOVQ AX, R14 + MOVQ CX, DX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + + // Update Offset State + BZHIQ R8, R14, CX + SHRXQ R8, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R14, CX + SHRXQ DI, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R14, CX + MOVQ $0x00001010, R13 + BEXTRQ R13, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decodeSync_bmi2_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ R12, $0x01 + JBE sequenceDecs_decodeSync_bmi2_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_bmi2_after_adjust + +sequenceDecs_decodeSync_bmi2_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_bmi2_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero + +sequenceDecs_decodeSync_bmi2_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_bmi2_after_adjust + +sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero: + MOVQ R13, R12 + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, R12 + CMOVQEQ R15, R14 + ADDQ 144(CX)(R12*8), R14 + JNZ sequenceDecs_decodeSync_bmi2_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_bmi2_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_bmi2_adjust_skip + MOVQ 152(CX), R12 + MOVQ R12, 160(CX) + +sequenceDecs_decodeSync_bmi2_adjust_skip: + MOVQ 144(CX), R12 + MOVQ R12, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_bmi2_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), CX + MOVQ 24(SP), R12 + LEAQ (CX)(R12*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ R12, 104(R14) + JS error_not_enough_literals + CMPQ CX, $0x00020002 + JA sequenceDecs_decodeSync_bmi2_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_bmi2_match_len_ofs_ok + TESTQ CX, CX + JNZ sequenceDecs_decodeSync_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_bmi2_match_len_ofs_ok: + MOVQ 24(SP), CX + MOVQ 8(SP), R12 + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (CX)(R13*1), R14 + ADDQ R9, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ CX, CX + JZ check_offset + XORQ R14, R14 + +copy_1: + MOVUPS (R10)(R14*1), X0 + MOVUPS X0, (R9)(R14*1) + ADDQ $0x10, R14 + CMPQ R14, CX + JB copy_1 + ADDQ CX, R10 + ADDQ CX, R9 + ADDQ CX, R11 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R11, CX + ADDQ 40(SP), CX + CMPQ R12, CX + JG error_match_off_too_big + CMPQ R12, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, CX + SUBQ R11, CX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ CX, R14 + CMPQ R13, CX + JG copy_all_from_history + MOVQ R13, CX + SUBQ $0x10, CX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, CX + JAE copy_4_loop + LEAQ 16(R14)(CX*1), R14 + LEAQ 16(R9)(CX*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), CX + MOVB 2(R14), R12 + MOVW CX, (R9) + MOVB R12, 2(R9) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), CX + MOVL -4(R14)(R13*1), R12 + MOVL CX, (R9) + MOVL R12, -4(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), CX + MOVQ -8(R14)(R13*1), R12 + MOVQ CX, (R9) + MOVQ R12, -8(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + +copy_4_end: + ADDQ R13, R11 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ CX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R9)(R15*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_5_end + +copy_5_small: + CMPQ CX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ CX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(CX*1), BP + MOVB R15, (R9) + MOVB BP, -1(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R9) + MOVB BP, 2(R9) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(CX*1), BP + MOVL R15, (R9) + MOVL BP, -4(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(CX*1), BP + MOVQ R15, (R9) + MOVQ BP, -8(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + +copy_5_end: + ADDQ CX, R11 + SUBQ CX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R9, CX + SUBQ R12, CX + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R11 + MOVQ R9, R12 + ADDQ R13, R9 + +copy_2: + MOVUPS (CX), X0 + MOVUPS X0, (R12) + ADDQ $0x10, CX + ADDQ $0x10, R12 + SUBQ $0x10, R13 + JHI copy_2 + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R11 + +copy_slow_3: + MOVB (CX), R12 + MOVB R12, (R9) + INCQ CX + INCQ R9 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decodeSync_bmi2_main_loop + +loop_finished: + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R11, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R10 + MOVQ R10, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_bmi2_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_bmi2_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decodeSync_safe_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: CMOV, SSE +TEXT ·sequenceDecs_decodeSync_safe_amd64(SB), $64-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + XORQ CX, CX + MOVQ CX, 8(SP) + MOVQ CX, 16(SP) + MOVQ CX, 24(SP) + MOVQ 112(AX), R10 + MOVQ 128(AX), CX + MOVQ CX, 32(SP) + MOVQ 144(AX), R11 + MOVQ 136(AX), R12 + MOVQ 200(AX), CX + MOVQ CX, 56(SP) + MOVQ 176(AX), CX + MOVQ CX, 48(SP) + MOVQ 184(AX), AX + MOVQ AX, 40(SP) + MOVQ 40(SP), AX + ADDQ AX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R10, 32(SP) + + // outBase += outPosition + ADDQ R12, R10 + +sequenceDecs_decodeSync_safe_amd64_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_safe_amd64_fill_end + +sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_safe_amd64_fill_end + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_safe_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte + +sequenceDecs_decodeSync_safe_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_of_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_of_update_zero: + MOVQ AX, 8(SP) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_ml_update_zero: + MOVQ AX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_safe_amd64_fill_2_end + +sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_safe_amd64_fill_2_end + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_safe_amd64_fill_2_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte + +sequenceDecs_decodeSync_safe_amd64_fill_2_end: + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_ll_update_zero: + MOVQ AX, 24(SP) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_safe_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R13 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R13 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R13 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decodeSync_safe_amd64_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ AX, $0x01 + JBE sequenceDecs_decodeSync_safe_amd64_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_safe_amd64_after_adjust + +sequenceDecs_decodeSync_safe_amd64_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_safe_amd64_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero + +sequenceDecs_decodeSync_safe_amd64_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_safe_amd64_after_adjust + +sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero: + MOVQ R13, AX + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, AX + CMOVQEQ R15, R14 + ADDQ 144(CX)(AX*8), R14 + JNZ sequenceDecs_decodeSync_safe_amd64_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_safe_amd64_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_safe_amd64_adjust_skip + MOVQ 152(CX), AX + MOVQ AX, 160(CX) + +sequenceDecs_decodeSync_safe_amd64_adjust_skip: + MOVQ 144(CX), AX + MOVQ AX, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_safe_amd64_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), AX + MOVQ 24(SP), CX + LEAQ (AX)(CX*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ CX, 104(R14) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decodeSync_safe_amd64_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decodeSync_safe_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_safe_amd64_match_len_ofs_ok: + MOVQ 24(SP), AX + MOVQ 8(SP), CX + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (AX)(R13*1), R14 + ADDQ R10, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ AX, AX + JZ check_offset + MOVQ AX, R14 + SUBQ $0x10, R14 + JB copy_1_small + +copy_1_loop: + MOVUPS (R11), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R11 + ADDQ $0x10, R10 + SUBQ $0x10, R14 + JAE copy_1_loop + LEAQ 16(R11)(R14*1), R11 + LEAQ 16(R10)(R14*1), R10 + MOVUPS -16(R11), X0 + MOVUPS X0, -16(R10) + JMP copy_1_end + +copy_1_small: + CMPQ AX, $0x03 + JE copy_1_move_3 + JB copy_1_move_1or2 + CMPQ AX, $0x08 + JB copy_1_move_4through7 + JMP copy_1_move_8through16 + +copy_1_move_1or2: + MOVB (R11), R14 + MOVB -1(R11)(AX*1), R15 + MOVB R14, (R10) + MOVB R15, -1(R10)(AX*1) + ADDQ AX, R11 + ADDQ AX, R10 + JMP copy_1_end + +copy_1_move_3: + MOVW (R11), R14 + MOVB 2(R11), R15 + MOVW R14, (R10) + MOVB R15, 2(R10) + ADDQ AX, R11 + ADDQ AX, R10 + JMP copy_1_end + +copy_1_move_4through7: + MOVL (R11), R14 + MOVL -4(R11)(AX*1), R15 + MOVL R14, (R10) + MOVL R15, -4(R10)(AX*1) + ADDQ AX, R11 + ADDQ AX, R10 + JMP copy_1_end + +copy_1_move_8through16: + MOVQ (R11), R14 + MOVQ -8(R11)(AX*1), R15 + MOVQ R14, (R10) + MOVQ R15, -8(R10)(AX*1) + ADDQ AX, R11 + ADDQ AX, R10 + +copy_1_end: + ADDQ AX, R12 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R12, AX + ADDQ 40(SP), AX + CMPQ CX, AX + JG error_match_off_too_big + CMPQ CX, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ CX, AX + SUBQ R12, AX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ AX, R14 + CMPQ R13, AX + JG copy_all_from_history + MOVQ R13, AX + SUBQ $0x10, AX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, AX + JAE copy_4_loop + LEAQ 16(R14)(AX*1), R14 + LEAQ 16(R10)(AX*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), AX + MOVB 2(R14), CL + MOVW AX, (R10) + MOVB CL, 2(R10) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), AX + MOVL -4(R14)(R13*1), CX + MOVL AX, (R10) + MOVL CX, -4(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), AX + MOVQ -8(R14)(R13*1), CX + MOVQ AX, (R10) + MOVQ CX, -8(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + +copy_4_end: + ADDQ R13, R12 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ AX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R10)(R15*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_5_end + +copy_5_small: + CMPQ AX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ AX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(AX*1), BP + MOVB R15, (R10) + MOVB BP, -1(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R10) + MOVB BP, 2(R10) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(AX*1), BP + MOVL R15, (R10) + MOVL BP, -4(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(AX*1), BP + MOVQ R15, (R10) + MOVQ BP, -8(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + +copy_5_end: + ADDQ AX, R12 + SUBQ AX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R10, AX + SUBQ CX, AX + + // ml <= mo + CMPQ R13, CX + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R12 + MOVQ R13, CX + SUBQ $0x10, CX + JB copy_2_small + +copy_2_loop: + MOVUPS (AX), X0 + MOVUPS X0, (R10) + ADDQ $0x10, AX + ADDQ $0x10, R10 + SUBQ $0x10, CX + JAE copy_2_loop + LEAQ 16(AX)(CX*1), AX + LEAQ 16(R10)(CX*1), R10 + MOVUPS -16(AX), X0 + MOVUPS X0, -16(R10) + JMP copy_2_end + +copy_2_small: + CMPQ R13, $0x03 + JE copy_2_move_3 + JB copy_2_move_1or2 + CMPQ R13, $0x08 + JB copy_2_move_4through7 + JMP copy_2_move_8through16 + +copy_2_move_1or2: + MOVB (AX), CL + MOVB -1(AX)(R13*1), R14 + MOVB CL, (R10) + MOVB R14, -1(R10)(R13*1) + ADDQ R13, AX + ADDQ R13, R10 + JMP copy_2_end + +copy_2_move_3: + MOVW (AX), CX + MOVB 2(AX), R14 + MOVW CX, (R10) + MOVB R14, 2(R10) + ADDQ R13, AX + ADDQ R13, R10 + JMP copy_2_end + +copy_2_move_4through7: + MOVL (AX), CX + MOVL -4(AX)(R13*1), R14 + MOVL CX, (R10) + MOVL R14, -4(R10)(R13*1) + ADDQ R13, AX + ADDQ R13, R10 + JMP copy_2_end + +copy_2_move_8through16: + MOVQ (AX), CX + MOVQ -8(AX)(R13*1), R14 + MOVQ CX, (R10) + MOVQ R14, -8(R10)(R13*1) + ADDQ R13, AX + ADDQ R13, R10 + +copy_2_end: + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R12 + +copy_slow_3: + MOVB (AX), CL + MOVB CL, (R10) + INCQ AX + INCQ R10 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decodeSync_safe_amd64_main_loop + +loop_finished: + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R12, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R11 + MOVQ R11, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_safe_amd64_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_safe_amd64_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decodeSync_safe_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: BMI, BMI2, CMOV, SSE +TEXT ·sequenceDecs_decodeSync_safe_bmi2(SB), $64-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + XORQ R9, R9 + MOVQ R9, 8(SP) + MOVQ R9, 16(SP) + MOVQ R9, 24(SP) + MOVQ 112(CX), R9 + MOVQ 128(CX), R10 + MOVQ R10, 32(SP) + MOVQ 144(CX), R10 + MOVQ 136(CX), R11 + MOVQ 200(CX), R12 + MOVQ R12, 56(SP) + MOVQ 176(CX), R12 + MOVQ R12, 48(SP) + MOVQ 184(CX), CX + MOVQ CX, 40(SP) + MOVQ 40(SP), CX + ADDQ CX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R9, 32(SP) + + // outBase += outPosition + ADDQ R11, R9 + +sequenceDecs_decodeSync_safe_bmi2_main_loop: + MOVQ (SP), R12 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_safe_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_end + +sequenceDecs_decodeSync_safe_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_end + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_byte_by_byte + +sequenceDecs_decodeSync_safe_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 8(SP) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_safe_bmi2_fill_2_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_2_end + +sequenceDecs_decodeSync_safe_bmi2_fill_2_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_2_end + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_2_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_2_byte_by_byte + +sequenceDecs_decodeSync_safe_bmi2_fill_2_end: + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 24(SP) + + // Fill bitreader for state updates + MOVQ R12, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R12 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_safe_bmi2_skip_update + LEAQ (SI)(DI*1), R13 + ADDQ R8, R13 + MOVBQZX R13, R13 + LEAQ (DX)(R13*1), CX + MOVQ AX, R14 + MOVQ CX, DX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + + // Update Offset State + BZHIQ R8, R14, CX + SHRXQ R8, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R14, CX + SHRXQ DI, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R14, CX + MOVQ $0x00001010, R13 + BEXTRQ R13, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decodeSync_safe_bmi2_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ R12, $0x01 + JBE sequenceDecs_decodeSync_safe_bmi2_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_safe_bmi2_after_adjust + +sequenceDecs_decodeSync_safe_bmi2_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_safe_bmi2_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero + +sequenceDecs_decodeSync_safe_bmi2_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_safe_bmi2_after_adjust + +sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero: + MOVQ R13, R12 + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, R12 + CMOVQEQ R15, R14 + ADDQ 144(CX)(R12*8), R14 + JNZ sequenceDecs_decodeSync_safe_bmi2_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_safe_bmi2_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_safe_bmi2_adjust_skip + MOVQ 152(CX), R12 + MOVQ R12, 160(CX) + +sequenceDecs_decodeSync_safe_bmi2_adjust_skip: + MOVQ 144(CX), R12 + MOVQ R12, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_safe_bmi2_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), CX + MOVQ 24(SP), R12 + LEAQ (CX)(R12*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ R12, 104(R14) + JS error_not_enough_literals + CMPQ CX, $0x00020002 + JA sequenceDecs_decodeSync_safe_bmi2_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_bmi2_match_len_ofs_ok + TESTQ CX, CX + JNZ sequenceDecs_decodeSync_safe_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_safe_bmi2_match_len_ofs_ok: + MOVQ 24(SP), CX + MOVQ 8(SP), R12 + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (CX)(R13*1), R14 + ADDQ R9, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ CX, CX + JZ check_offset + MOVQ CX, R14 + SUBQ $0x10, R14 + JB copy_1_small + +copy_1_loop: + MOVUPS (R10), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R10 + ADDQ $0x10, R9 + SUBQ $0x10, R14 + JAE copy_1_loop + LEAQ 16(R10)(R14*1), R10 + LEAQ 16(R9)(R14*1), R9 + MOVUPS -16(R10), X0 + MOVUPS X0, -16(R9) + JMP copy_1_end + +copy_1_small: + CMPQ CX, $0x03 + JE copy_1_move_3 + JB copy_1_move_1or2 + CMPQ CX, $0x08 + JB copy_1_move_4through7 + JMP copy_1_move_8through16 + +copy_1_move_1or2: + MOVB (R10), R14 + MOVB -1(R10)(CX*1), R15 + MOVB R14, (R9) + MOVB R15, -1(R9)(CX*1) + ADDQ CX, R10 + ADDQ CX, R9 + JMP copy_1_end + +copy_1_move_3: + MOVW (R10), R14 + MOVB 2(R10), R15 + MOVW R14, (R9) + MOVB R15, 2(R9) + ADDQ CX, R10 + ADDQ CX, R9 + JMP copy_1_end + +copy_1_move_4through7: + MOVL (R10), R14 + MOVL -4(R10)(CX*1), R15 + MOVL R14, (R9) + MOVL R15, -4(R9)(CX*1) + ADDQ CX, R10 + ADDQ CX, R9 + JMP copy_1_end + +copy_1_move_8through16: + MOVQ (R10), R14 + MOVQ -8(R10)(CX*1), R15 + MOVQ R14, (R9) + MOVQ R15, -8(R9)(CX*1) + ADDQ CX, R10 + ADDQ CX, R9 + +copy_1_end: + ADDQ CX, R11 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R11, CX + ADDQ 40(SP), CX + CMPQ R12, CX + JG error_match_off_too_big + CMPQ R12, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, CX + SUBQ R11, CX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ CX, R14 + CMPQ R13, CX + JG copy_all_from_history + MOVQ R13, CX + SUBQ $0x10, CX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, CX + JAE copy_4_loop + LEAQ 16(R14)(CX*1), R14 + LEAQ 16(R9)(CX*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), CX + MOVB 2(R14), R12 + MOVW CX, (R9) + MOVB R12, 2(R9) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), CX + MOVL -4(R14)(R13*1), R12 + MOVL CX, (R9) + MOVL R12, -4(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), CX + MOVQ -8(R14)(R13*1), R12 + MOVQ CX, (R9) + MOVQ R12, -8(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + +copy_4_end: + ADDQ R13, R11 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ CX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R9)(R15*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_5_end + +copy_5_small: + CMPQ CX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ CX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(CX*1), BP + MOVB R15, (R9) + MOVB BP, -1(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R9) + MOVB BP, 2(R9) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(CX*1), BP + MOVL R15, (R9) + MOVL BP, -4(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(CX*1), BP + MOVQ R15, (R9) + MOVQ BP, -8(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + +copy_5_end: + ADDQ CX, R11 + SUBQ CX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R9, CX + SUBQ R12, CX + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R11 + MOVQ R13, R12 + SUBQ $0x10, R12 + JB copy_2_small + +copy_2_loop: + MOVUPS (CX), X0 + MOVUPS X0, (R9) + ADDQ $0x10, CX + ADDQ $0x10, R9 + SUBQ $0x10, R12 + JAE copy_2_loop + LEAQ 16(CX)(R12*1), CX + LEAQ 16(R9)(R12*1), R9 + MOVUPS -16(CX), X0 + MOVUPS X0, -16(R9) + JMP copy_2_end + +copy_2_small: + CMPQ R13, $0x03 + JE copy_2_move_3 + JB copy_2_move_1or2 + CMPQ R13, $0x08 + JB copy_2_move_4through7 + JMP copy_2_move_8through16 + +copy_2_move_1or2: + MOVB (CX), R12 + MOVB -1(CX)(R13*1), R14 + MOVB R12, (R9) + MOVB R14, -1(R9)(R13*1) + ADDQ R13, CX + ADDQ R13, R9 + JMP copy_2_end + +copy_2_move_3: + MOVW (CX), R12 + MOVB 2(CX), R14 + MOVW R12, (R9) + MOVB R14, 2(R9) + ADDQ R13, CX + ADDQ R13, R9 + JMP copy_2_end + +copy_2_move_4through7: + MOVL (CX), R12 + MOVL -4(CX)(R13*1), R14 + MOVL R12, (R9) + MOVL R14, -4(R9)(R13*1) + ADDQ R13, CX + ADDQ R13, R9 + JMP copy_2_end + +copy_2_move_8through16: + MOVQ (CX), R12 + MOVQ -8(CX)(R13*1), R14 + MOVQ R12, (R9) + MOVQ R14, -8(R9)(R13*1) + ADDQ R13, CX + ADDQ R13, R9 + +copy_2_end: + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R11 + +copy_slow_3: + MOVB (CX), R12 + MOVB R12, (R9) + INCQ CX + INCQ R9 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decodeSync_safe_bmi2_main_loop + +loop_finished: + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R11, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R10 + MOVQ R10, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_safe_bmi2_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_safe_bmi2_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go new file mode 100644 index 000000000..c3452bc3a --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go @@ -0,0 +1,237 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +package zstd + +import ( + "fmt" + "io" +) + +// decode sequences from the stream with the provided history but without dictionary. +func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { + return false, nil +} + +// decode sequences from the stream without the provided history. +func (s *sequenceDecs) decode(seqs []seqVals) error { + br := s.br + + // Grab full sizes tables, to avoid bounds checks. + llTable, mlTable, ofTable := s.litLengths.fse.dt[:maxTablesize], s.matchLengths.fse.dt[:maxTablesize], s.offsets.fse.dt[:maxTablesize] + llState, mlState, ofState := s.litLengths.state.state, s.matchLengths.state.state, s.offsets.state.state + s.seqSize = 0 + litRemain := len(s.literals) + + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + for i := range seqs { + var ll, mo, ml int + if br.off > 4+((maxOffsetBits+16+16)>>3) { + // inlined function: + // ll, mo, ml = s.nextFast(br, llState, mlState, ofState) + + // Final will not read from stream. + var llB, mlB, moB uint8 + ll, llB = llState.final() + ml, mlB = mlState.final() + mo, moB = ofState.final() + + // extra bits are stored in reverse order. + br.fillFast() + mo += br.getBits(moB) + if s.maxBits > 32 { + br.fillFast() + } + ml += br.getBits(mlB) + ll += br.getBits(llB) + + if moB > 1 { + s.prevOffset[2] = s.prevOffset[1] + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = mo + } else { + // mo = s.adjustOffset(mo, ll, moB) + // Inlined for rather big speedup + if ll == 0 { + // There is an exception though, when current sequence's literals_length = 0. + // In this case, repeated offsets are shifted by one, so an offset_value of 1 means Repeated_Offset2, + // an offset_value of 2 means Repeated_Offset3, and an offset_value of 3 means Repeated_Offset1 - 1_byte. + mo++ + } + + if mo == 0 { + mo = s.prevOffset[0] + } else { + var temp int + if mo == 3 { + temp = s.prevOffset[0] - 1 + } else { + temp = s.prevOffset[mo] + } + + if temp == 0 { + // 0 is not valid; input is corrupted; force offset to 1 + println("WARNING: temp was 0") + temp = 1 + } + + if mo != 1 { + s.prevOffset[2] = s.prevOffset[1] + } + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = temp + mo = temp + } + } + br.fillFast() + } else { + if br.overread() { + if debugDecoder { + printf("reading sequence %d, exceeded available data\n", i) + } + return io.ErrUnexpectedEOF + } + ll, mo, ml = s.next(br, llState, mlState, ofState) + br.fill() + } + + if debugSequences { + println("Seq", i, "Litlen:", ll, "mo:", mo, "(abs) ml:", ml) + } + // Evaluate. + // We might be doing this async, so do it early. + if mo == 0 && ml > 0 { + return fmt.Errorf("zero matchoff and matchlen (%d) > 0", ml) + } + if ml > maxMatchLen { + return fmt.Errorf("match len (%d) bigger than max allowed length", ml) + } + s.seqSize += ll + ml + if s.seqSize > maxBlockSize { + return fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + } + litRemain -= ll + if litRemain < 0 { + return fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", ll, litRemain+ll) + } + seqs[i] = seqVals{ + ll: ll, + ml: ml, + mo: mo, + } + if i == len(seqs)-1 { + // This is the last sequence, so we shouldn't update state. + break + } + + // Manually inlined, ~ 5-20% faster + // Update all 3 states at once. Approx 20% faster. + nBits := llState.nbBits() + mlState.nbBits() + ofState.nbBits() + if nBits == 0 { + llState = llTable[llState.newState()&maxTableMask] + mlState = mlTable[mlState.newState()&maxTableMask] + ofState = ofTable[ofState.newState()&maxTableMask] + } else { + bits := br.get32BitsFast(nBits) + lowBits := uint16(bits >> ((ofState.nbBits() + mlState.nbBits()) & 31)) + llState = llTable[(llState.newState()+lowBits)&maxTableMask] + + lowBits = uint16(bits >> (ofState.nbBits() & 31)) + lowBits &= bitMask[mlState.nbBits()&15] + mlState = mlTable[(mlState.newState()+lowBits)&maxTableMask] + + lowBits = uint16(bits) & bitMask[ofState.nbBits()&15] + ofState = ofTable[(ofState.newState()+lowBits)&maxTableMask] + } + } + s.seqSize += litRemain + if s.seqSize > maxBlockSize { + return fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + } + err := br.close() + if err != nil { + printf("Closing sequences: %v, %+v\n", err, *br) + } + return err +} + +// executeSimple handles cases when a dictionary is not used. +func (s *sequenceDecs) executeSimple(seqs []seqVals, hist []byte) error { + // Ensure we have enough output size... + if len(s.out)+s.seqSize > cap(s.out) { + addBytes := s.seqSize + len(s.out) + s.out = append(s.out, make([]byte, addBytes)...) + s.out = s.out[:len(s.out)-addBytes] + } + + if debugDecoder { + printf("Execute %d seqs with literals: %d into %d bytes\n", len(seqs), len(s.literals), s.seqSize) + } + + var t = len(s.out) + out := s.out[:t+s.seqSize] + + for _, seq := range seqs { + // Add literals + copy(out[t:], s.literals[:seq.ll]) + t += seq.ll + s.literals = s.literals[seq.ll:] + + // Malformed input + if seq.mo > t+len(hist) || seq.mo > s.windowSize { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", seq.mo, t+len(hist)) + } + + // Copy from history. + if v := seq.mo - t; v > 0 { + // v is the start position in history from end. + start := len(hist) - v + if seq.ml > v { + // Some goes into the current block. + // Copy remainder of history + copy(out[t:], hist[start:]) + t += v + seq.ml -= v + } else { + copy(out[t:], hist[start:start+seq.ml]) + t += seq.ml + continue + } + } + + // We must be in the current buffer now + if seq.ml > 0 { + start := t - seq.mo + if seq.ml <= t-start { + // No overlap + copy(out[t:], out[start:start+seq.ml]) + t += seq.ml + } else { + // Overlapping copy + // Extend destination slice and copy one byte at the time. + src := out[start : start+seq.ml] + dst := out[t:] + dst = dst[:len(src)] + t += len(src) + // Destination is the space we just added. + for i := range src { + dst[i] = src[i] + } + } + } + } + // Add final literals + copy(out[t:], s.literals) + if debugDecoder { + t += len(s.literals) + if t != len(out) { + panic(fmt.Errorf("length mismatch, want %d, got %d, ss: %d", len(out), t, s.seqSize)) + } + } + s.out = out + + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/seqenc.go b/vendor/github.com/klauspost/compress/zstd/seqenc.go index 36bcc3cc0..8014174a7 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqenc.go +++ b/vendor/github.com/klauspost/compress/zstd/seqenc.go @@ -35,7 +35,6 @@ func (s *seqCoders) setPrev(ll, ml, of *fseEncoder) { // Ensure we cannot reuse by accident prevEnc := *prev prevEnc.symbolLen = 0 - return } compareSwap(ll, &s.llEnc, &s.llPrev) compareSwap(ml, &s.mlEnc, &s.mlPrev) diff --git a/vendor/github.com/klauspost/compress/zstd/snappy.go b/vendor/github.com/klauspost/compress/zstd/snappy.go index c95fe5111..9e1baad73 100644 --- a/vendor/github.com/klauspost/compress/zstd/snappy.go +++ b/vendor/github.com/klauspost/compress/zstd/snappy.go @@ -11,7 +11,7 @@ import ( "io" "github.com/klauspost/compress/huff0" - "github.com/klauspost/compress/snappy" + snappy "github.com/klauspost/compress/internal/snapref" ) const ( @@ -185,7 +185,6 @@ func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) { r.block.reset(nil) r.block.literals, err = snappy.Decode(r.block.literals[:n], r.buf[snappyChecksumSize:chunkLen]) if err != nil { - println("snappy.Decode:", err) return written, err } err = r.block.encodeLits(r.block.literals, false) @@ -204,7 +203,7 @@ func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) { written += int64(n) continue case chunkTypeUncompressedData: - if debug { + if debugEncoder { println("Uncompressed, chunklen", chunkLen) } // Section 4.3. Uncompressed data (chunk type 0x01). @@ -247,7 +246,7 @@ func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) { continue case chunkTypeStreamIdentifier: - if debug { + if debugEncoder { println("stream id", chunkLen, len(snappyMagicBody)) } // Section 4.1. Stream identifier (chunk type 0xff). diff --git a/vendor/github.com/klauspost/compress/zstd/zip.go b/vendor/github.com/klauspost/compress/zstd/zip.go new file mode 100644 index 000000000..29c15c8c4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/zip.go @@ -0,0 +1,141 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. + +package zstd + +import ( + "errors" + "io" + "sync" +) + +// ZipMethodWinZip is the method for Zstandard compressed data inside Zip files for WinZip. +// See https://www.winzip.com/win/en/comp_info.html +const ZipMethodWinZip = 93 + +// ZipMethodPKWare is the original method number used by PKWARE to indicate Zstandard compression. +// Deprecated: This has been deprecated by PKWARE, use ZipMethodWinZip instead for compression. +// See https://pkware.cachefly.net/webdocs/APPNOTE/APPNOTE-6.3.9.TXT +const ZipMethodPKWare = 20 + +// zipReaderPool is the default reader pool. +var zipReaderPool = sync.Pool{New: func() interface{} { + z, err := NewReader(nil, WithDecoderLowmem(true), WithDecoderMaxWindow(128<<20), WithDecoderConcurrency(1)) + if err != nil { + panic(err) + } + return z +}} + +// newZipReader creates a pooled zip decompressor. +func newZipReader(opts ...DOption) func(r io.Reader) io.ReadCloser { + pool := &zipReaderPool + if len(opts) > 0 { + opts = append([]DOption{WithDecoderLowmem(true), WithDecoderMaxWindow(128 << 20)}, opts...) + // Force concurrency 1 + opts = append(opts, WithDecoderConcurrency(1)) + // Create our own pool + pool = &sync.Pool{} + } + return func(r io.Reader) io.ReadCloser { + dec, ok := pool.Get().(*Decoder) + if ok { + dec.Reset(r) + } else { + d, err := NewReader(r, opts...) + if err != nil { + panic(err) + } + dec = d + } + return &pooledZipReader{dec: dec, pool: pool} + } +} + +type pooledZipReader struct { + mu sync.Mutex // guards Close and Read + pool *sync.Pool + dec *Decoder +} + +func (r *pooledZipReader) Read(p []byte) (n int, err error) { + r.mu.Lock() + defer r.mu.Unlock() + if r.dec == nil { + return 0, errors.New("read after close or EOF") + } + dec, err := r.dec.Read(p) + if err == io.EOF { + r.dec.Reset(nil) + r.pool.Put(r.dec) + r.dec = nil + } + return dec, err +} + +func (r *pooledZipReader) Close() error { + r.mu.Lock() + defer r.mu.Unlock() + var err error + if r.dec != nil { + err = r.dec.Reset(nil) + r.pool.Put(r.dec) + r.dec = nil + } + return err +} + +type pooledZipWriter struct { + mu sync.Mutex // guards Close and Read + enc *Encoder + pool *sync.Pool +} + +func (w *pooledZipWriter) Write(p []byte) (n int, err error) { + w.mu.Lock() + defer w.mu.Unlock() + if w.enc == nil { + return 0, errors.New("Write after Close") + } + return w.enc.Write(p) +} + +func (w *pooledZipWriter) Close() error { + w.mu.Lock() + defer w.mu.Unlock() + var err error + if w.enc != nil { + err = w.enc.Close() + w.pool.Put(w.enc) + w.enc = nil + } + return err +} + +// ZipCompressor returns a compressor that can be registered with zip libraries. +// The provided encoder options will be used on all encodes. +func ZipCompressor(opts ...EOption) func(w io.Writer) (io.WriteCloser, error) { + var pool sync.Pool + return func(w io.Writer) (io.WriteCloser, error) { + enc, ok := pool.Get().(*Encoder) + if ok { + enc.Reset(w) + } else { + var err error + enc, err = NewWriter(w, opts...) + if err != nil { + return nil, err + } + } + return &pooledZipWriter{enc: enc, pool: &pool}, nil + } +} + +// ZipDecompressor returns a decompressor that can be registered with zip libraries. +// See ZipCompressor for example. +// Options can be specified. WithDecoderConcurrency(1) is forced, +// and by default a 128MB maximum decompression window is specified. +// The window size can be overridden if required. +func ZipDecompressor(opts ...DOption) func(r io.Reader) io.ReadCloser { + return newZipReader(opts...) +} diff --git a/vendor/github.com/klauspost/compress/zstd/zstd.go b/vendor/github.com/klauspost/compress/zstd/zstd.go index 9056beef2..3eb3f1c82 100644 --- a/vendor/github.com/klauspost/compress/zstd/zstd.go +++ b/vendor/github.com/klauspost/compress/zstd/zstd.go @@ -5,6 +5,7 @@ package zstd import ( "bytes" + "encoding/binary" "errors" "log" "math" @@ -14,6 +15,12 @@ import ( // enable debug printing const debug = false +// enable encoding debug printing +const debugEncoder = debug + +// enable decoding debug printing +const debugDecoder = debug + // Enable extra assertions. const debugAsserts = debug || false @@ -32,6 +39,9 @@ const zstdMinMatch = 3 // Reset the buffer offset when reaching this. const bufferReset = math.MaxInt32 - MaxWindowSize +// fcsUnknown is used for unknown frame content size. +const fcsUnknown = math.MaxUint64 + var ( // ErrReservedBlockType is returned when a reserved block type is found. // Typically this indicates wrong or corrupted input. @@ -45,6 +55,10 @@ var ( // Typically returned on invalid input. ErrBlockTooSmall = errors.New("block too small") + // ErrUnexpectedBlockSize is returned when a block has unexpected size. + // Typically returned on invalid input. + ErrUnexpectedBlockSize = errors.New("unexpected block size") + // ErrMagicMismatch is returned when a "magic" number isn't what is expected. // Typically this indicates wrong or corrupted input. ErrMagicMismatch = errors.New("invalid input: magic number mismatch") @@ -68,6 +82,10 @@ var ( // This is only returned if SingleSegment is specified on the frame. ErrFrameSizeExceeded = errors.New("frame size exceeded") + // ErrFrameSizeMismatch is returned if the stated frame size does not match the expected size. + // This is only returned if SingleSegment is specified on the frame. + ErrFrameSizeMismatch = errors.New("frame size does not match size on stream") + // ErrCRCMismatch is returned if CRC mismatches. ErrCRCMismatch = errors.New("CRC check failed") @@ -81,28 +99,17 @@ var ( ) func println(a ...interface{}) { - if debug { + if debug || debugDecoder || debugEncoder { log.Println(a...) } } func printf(format string, a ...interface{}) { - if debug { + if debug || debugDecoder || debugEncoder { log.Printf(format, a...) } } -// matchLenFast does matching, but will not match the last up to 7 bytes. -func matchLenFast(a, b []byte) int { - endI := len(a) & (math.MaxInt32 - 7) - for i := 0; i < endI; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - return i + bits.TrailingZeros64(diff)>>3 - } - } - return endI -} - // matchLen returns the maximum length. // a must be the shortest of the two. // The function also returns whether all bytes matched. @@ -126,26 +133,15 @@ func matchLen(a, b []byte) int { } func load3232(b []byte, i int32) uint32 { - // Help the compiler eliminate bounds checks on the read so it can be done in a single read. - b = b[i:] - b = b[:4] - return uint32(b[0]) | uint32(b[1])<<8 | uint32(b[2])<<16 | uint32(b[3])<<24 + return binary.LittleEndian.Uint32(b[i:]) } func load6432(b []byte, i int32) uint64 { - // Help the compiler eliminate bounds checks on the read so it can be done in a single read. - b = b[i:] - b = b[:8] - return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 | - uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56 + return binary.LittleEndian.Uint64(b[i:]) } func load64(b []byte, i int) uint64 { - // Help the compiler eliminate bounds checks on the read so it can be done in a single read. - b = b[i:] - b = b[:8] - return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 | - uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56 + return binary.LittleEndian.Uint64(b[i:]) } type byter interface { diff --git a/vendor/github.com/opencontainers/image-spec/specs-go/v1/config.go b/vendor/github.com/opencontainers/image-spec/specs-go/v1/config.go index ffff4b6d1..e6aa113f0 100644 --- a/vendor/github.com/opencontainers/image-spec/specs-go/v1/config.go +++ b/vendor/github.com/opencontainers/image-spec/specs-go/v1/config.go @@ -48,6 +48,15 @@ type ImageConfig struct { // StopSignal contains the system call signal that will be sent to the container to exit. StopSignal string `json:"StopSignal,omitempty"` + + // ArgsEscaped `[Deprecated]` - This field is present only for legacy + // compatibility with Docker and should not be used by new image builders. + // It is used by Docker for Windows images to indicate that the `Entrypoint` + // or `Cmd` or both, contains only a single element array, that is a + // pre-escaped, and combined into a single string `CommandLine`. If `true` + // the value in `Entrypoint` or `Cmd` should be used as-is to avoid double + // escaping. + ArgsEscaped bool `json:"ArgsEscaped,omitempty"` } // RootFS describes a layer content addresses diff --git a/vendor/github.com/opencontainers/image-spec/specs-go/version.go b/vendor/github.com/opencontainers/image-spec/specs-go/version.go index d27903579..1afd590fe 100644 --- a/vendor/github.com/opencontainers/image-spec/specs-go/version.go +++ b/vendor/github.com/opencontainers/image-spec/specs-go/version.go @@ -25,7 +25,7 @@ const ( VersionPatch = 0 // VersionDev indicates development branch. Releases will be empty string. - VersionDev = "-rc2" + VersionDev = "-dev" ) // Version is the specification version that the package types support. diff --git a/vendor/github.com/sirupsen/logrus/README.md b/vendor/github.com/sirupsen/logrus/README.md index b042c896f..d1d4a85fd 100644 --- a/vendor/github.com/sirupsen/logrus/README.md +++ b/vendor/github.com/sirupsen/logrus/README.md @@ -9,7 +9,7 @@ the last thing you want from your Logging library (again...). This does not mean Logrus is dead. Logrus will continue to be maintained for security, (backwards compatible) bug fixes, and performance (where we are -limited by the interface). +limited by the interface). I believe Logrus' biggest contribution is to have played a part in today's widespread use of structured logging in Golang. There doesn't seem to be a @@ -43,7 +43,7 @@ plain text): With `log.SetFormatter(&log.JSONFormatter{})`, for easy parsing by logstash or Splunk: -```json +```text {"animal":"walrus","level":"info","msg":"A group of walrus emerges from the ocean","size":10,"time":"2014-03-10 19:57:38.562264131 -0400 EDT"} @@ -99,7 +99,7 @@ time="2015-03-26T01:27:38-04:00" level=fatal method=github.com/sirupsen/arcticcr ``` Note that this does add measurable overhead - the cost will depend on the version of Go, but is between 20 and 40% in recent tests with 1.6 and 1.7. You can validate this in your -environment via benchmarks: +environment via benchmarks: ``` go test -bench=.*CallerTracing ``` @@ -317,6 +317,8 @@ log.SetLevel(log.InfoLevel) It may be useful to set `log.Level = logrus.DebugLevel` in a debug or verbose environment if your application has that. +Note: If you want different log levels for global (`log.SetLevel(...)`) and syslog logging, please check the [syslog hook README](hooks/syslog/README.md#different-log-levels-for-local-and-remote-logging). + #### Entries Besides the fields added with `WithField` or `WithFields` some fields are diff --git a/vendor/github.com/sirupsen/logrus/writer.go b/vendor/github.com/sirupsen/logrus/writer.go index 72e8e3a1b..074fd4b8b 100644 --- a/vendor/github.com/sirupsen/logrus/writer.go +++ b/vendor/github.com/sirupsen/logrus/writer.go @@ -4,6 +4,7 @@ import ( "bufio" "io" "runtime" + "strings" ) // Writer at INFO level. See WriterLevel for details. @@ -20,15 +21,18 @@ func (logger *Logger) WriterLevel(level Level) *io.PipeWriter { return NewEntry(logger).WriterLevel(level) } +// Writer returns an io.Writer that writes to the logger at the info log level func (entry *Entry) Writer() *io.PipeWriter { return entry.WriterLevel(InfoLevel) } +// WriterLevel returns an io.Writer that writes to the logger at the given log level func (entry *Entry) WriterLevel(level Level) *io.PipeWriter { reader, writer := io.Pipe() var printFunc func(args ...interface{}) + // Determine which log function to use based on the specified log level switch level { case TraceLevel: printFunc = entry.Trace @@ -48,23 +52,51 @@ func (entry *Entry) WriterLevel(level Level) *io.PipeWriter { printFunc = entry.Print } + // Start a new goroutine to scan the input and write it to the logger using the specified print function. + // It splits the input into chunks of up to 64KB to avoid buffer overflows. go entry.writerScanner(reader, printFunc) + + // Set a finalizer function to close the writer when it is garbage collected runtime.SetFinalizer(writer, writerFinalizer) return writer } +// writerScanner scans the input from the reader and writes it to the logger func (entry *Entry) writerScanner(reader *io.PipeReader, printFunc func(args ...interface{})) { scanner := bufio.NewScanner(reader) + + // Set the buffer size to the maximum token size to avoid buffer overflows + scanner.Buffer(make([]byte, bufio.MaxScanTokenSize), bufio.MaxScanTokenSize) + + // Define a split function to split the input into chunks of up to 64KB + chunkSize := bufio.MaxScanTokenSize // 64KB + splitFunc := func(data []byte, atEOF bool) (int, []byte, error) { + if len(data) >= chunkSize { + return chunkSize, data[:chunkSize], nil + } + + return bufio.ScanLines(data, atEOF) + } + + // Use the custom split function to split the input + scanner.Split(splitFunc) + + // Scan the input and write it to the logger using the specified print function for scanner.Scan() { - printFunc(scanner.Text()) + printFunc(strings.TrimRight(scanner.Text(), "\r\n")) } + + // If there was an error while scanning the input, log an error if err := scanner.Err(); err != nil { entry.Errorf("Error while reading from Writer: %s", err) } + + // Close the reader when we are done reader.Close() } +// WriterFinalizer is a finalizer function that closes then given writer when it is garbage collected func writerFinalizer(writer *io.PipeWriter) { writer.Close() } diff --git a/vendor/golang.org/x/sys/unix/fcntl.go b/vendor/golang.org/x/sys/unix/fcntl.go index 58c6bfc70..6200876fb 100644 --- a/vendor/golang.org/x/sys/unix/fcntl.go +++ b/vendor/golang.org/x/sys/unix/fcntl.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build dragonfly || freebsd || linux || netbsd || openbsd +//go:build dragonfly || freebsd || linux || netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 0d12c0851..dbe680eab 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -231,3 +231,8 @@ func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) { func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error { return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value)) } + +// IoctlLoopConfigure configures all loop device parameters in a single step +func IoctlLoopConfigure(fd int, value *LoopConfig) error { + return ioctlPtr(fd, LOOP_CONFIGURE, unsafe.Pointer(value)) +} diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index cbe24150a..6202638ba 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -519,6 +519,7 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || + $2 == "LOOP_CONFIGURE" || $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || @@ -560,7 +561,7 @@ ccflags="$@" $2 ~ /^RLIMIT_(AS|CORE|CPU|DATA|FSIZE|LOCKS|MEMLOCK|MSGQUEUE|NICE|NOFILE|NPROC|RSS|RTPRIO|RTTIME|SIGPENDING|STACK)|RLIM_INFINITY/ || $2 ~ /^PRIO_(PROCESS|PGRP|USER)/ || $2 ~ /^CLONE_[A-Z_]+/ || - $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ && + $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+|BPF_F_LINK)$/ && $2 ~ /^(BPF|DLT)_/ || $2 ~ /^AUDIT_/ || $2 ~ /^(CLOCK|TIMER)_/ || diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 6f328e3a5..a00c3e545 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -316,7 +316,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index a5e1c10e3..0f85e29e6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -61,15 +61,23 @@ func FanotifyMark(fd int, flags uint, mask uint64, dirFd int, pathname string) ( } //sys fchmodat(dirfd int, path string, mode uint32) (err error) - -func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { - // Linux fchmodat doesn't support the flags parameter. Mimick glibc's behavior - // and check the flags. Otherwise the mode would be applied to the symlink - // destination which is not what the user expects. - if flags&^AT_SYMLINK_NOFOLLOW != 0 { - return EINVAL - } else if flags&AT_SYMLINK_NOFOLLOW != 0 { - return EOPNOTSUPP +//sys fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) + +func Fchmodat(dirfd int, path string, mode uint32, flags int) error { + // Linux fchmodat doesn't support the flags parameter, but fchmodat2 does. + // Try fchmodat2 if flags are specified. + if flags != 0 { + err := fchmodat2(dirfd, path, mode, flags) + if err == ENOSYS { + // fchmodat2 isn't available. If the flags are known to be valid, + // return EOPNOTSUPP to indicate that fchmodat doesn't support them. + if flags&^(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EINVAL + } else if flags&(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EOPNOTSUPP + } + } + return err } return fchmodat(dirfd, path, mode) } @@ -1302,7 +1310,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func GetsockoptTpacketStats(fd, level, opt int) (*TpacketStats, error) { diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index d2882ee04..b25343c71 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -166,6 +166,20 @@ func Getresgid() (rgid, egid, sgid int) { //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL +//sys fcntl(fd int, cmd int, arg int) (n int, err error) +//sys fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) = SYS_FCNTL + +// FcntlInt performs a fcntl syscall on fd with the provided command and argument. +func FcntlInt(fd uintptr, cmd, arg int) (int, error) { + return fcntl(int(fd), cmd, arg) +} + +// FcntlFlock performs a fcntl syscall for the F_GETLK, F_SETLK or F_SETLKW command. +func FcntlFlock(fd uintptr, cmd int, lk *Flock_t) error { + _, err := fcntlPtr(int(fd), cmd, unsafe.Pointer(lk)) + return err +} + //sys ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) func Ppoll(fds []PollFd, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index 60c8142d4..21974af06 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -158,7 +158,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } const ImplementsGetwd = true diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index d99d05f1b..b473038c6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -1104,7 +1104,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 9c00cbf51..c73cfe2f1 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -486,7 +486,6 @@ const ( BPF_F_ANY_ALIGNMENT = 0x2 BPF_F_BEFORE = 0x8 BPF_F_ID = 0x20 - BPF_F_LINK = 0x2000 BPF_F_NETFILTER_IP_DEFRAG = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 BPF_F_REPLACE = 0x4 @@ -1802,6 +1801,7 @@ const ( LOCK_SH = 0x1 LOCK_UN = 0x8 LOOP_CLR_FD = 0x4c01 + LOOP_CONFIGURE = 0x4c0a LOOP_CTL_ADD = 0x4c80 LOOP_CTL_GET_FREE = 0x4c82 LOOP_CTL_REMOVE = 0x4c81 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index faca7a557..1488d2712 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -37,6 +37,21 @@ func fchmodat(dirfd int, path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FCHMODAT2, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 88bfc2885..a1d061597 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 4cbeff171..41b561731 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -178,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index b8a67b99a..5b2a74097 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 1123f2757..4019a656f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -178,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index af50a65c0..f6eda1344 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index 82badae39..ac4af24f9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -178,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 8fb4ff36a..55df20ae9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index 24d7eecb9..f77d53212 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -178,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index f469a83ee..8c1155cbc 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 9a498a067..fae140b62 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -178,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index c26ca2e1a..7cc80c58d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 1f224aa41..9d1e0ff06 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -213,6 +213,12 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fcntl(SB) + RET +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ppoll(SB) RET diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index bcc920dd2..0688737f4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -584,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index 87a79c709..da115f9a4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -178,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index 997bcd55a..bbf8399ff 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -2671,6 +2671,7 @@ const ( BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e BPF_PROG_TYPE_SYSCALL = 0x1f + BPF_PROG_TYPE_NETFILTER = 0x20 BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2715,6 +2716,11 @@ const ( BPF_PERF_EVENT = 0x29 BPF_TRACE_KPROBE_MULTI = 0x2a BPF_LSM_CGROUP = 0x2b + BPF_STRUCT_OPS = 0x2c + BPF_NETFILTER = 0x2d + BPF_TCX_INGRESS = 0x2e + BPF_TCX_EGRESS = 0x2f + BPF_TRACE_UPROBE_MULTI = 0x30 BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2725,6 +2731,18 @@ const ( BPF_LINK_TYPE_PERF_EVENT = 0x7 BPF_LINK_TYPE_KPROBE_MULTI = 0x8 BPF_LINK_TYPE_STRUCT_OPS = 0x9 + BPF_LINK_TYPE_NETFILTER = 0xa + BPF_LINK_TYPE_TCX = 0xb + BPF_LINK_TYPE_UPROBE_MULTI = 0xc + BPF_PERF_EVENT_UNSPEC = 0x0 + BPF_PERF_EVENT_UPROBE = 0x1 + BPF_PERF_EVENT_URETPROBE = 0x2 + BPF_PERF_EVENT_KPROBE = 0x3 + BPF_PERF_EVENT_KRETPROBE = 0x4 + BPF_PERF_EVENT_TRACEPOINT = 0x5 + BPF_PERF_EVENT_EVENT = 0x6 + BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_UPROBE_MULTI_RETURN = 0x1 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2742,6 +2760,8 @@ const ( BPF_F_MMAPABLE = 0x400 BPF_F_PRESERVE_ELEMS = 0x800 BPF_F_INNER_MAP = 0x1000 + BPF_F_LINK = 0x2000 + BPF_F_PATH_FD = 0x4000 BPF_STATS_RUN_TIME = 0x0 BPF_STACK_BUILD_ID_EMPTY = 0x0 BPF_STACK_BUILD_ID_VALID = 0x1 @@ -2762,6 +2782,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_NO_TUNNEL_KEY = 0x10 BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff @@ -2778,6 +2799,8 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 + BPF_F_ADJ_ROOM_DECAP_L3_IPV4 = 0x80 + BPF_F_ADJ_ROOM_DECAP_L3_IPV6 = 0x100 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2866,6 +2889,8 @@ const ( BPF_DEVCG_DEV_CHAR = 0x2 BPF_FIB_LOOKUP_DIRECT = 0x1 BPF_FIB_LOOKUP_OUTPUT = 0x2 + BPF_FIB_LOOKUP_SKIP_NEIGH = 0x4 + BPF_FIB_LOOKUP_TBID = 0x8 BPF_FIB_LKUP_RET_SUCCESS = 0x0 BPF_FIB_LKUP_RET_BLACKHOLE = 0x1 BPF_FIB_LKUP_RET_UNREACHABLE = 0x2 @@ -2901,6 +2926,7 @@ const ( BPF_CORE_ENUMVAL_EXISTS = 0xa BPF_CORE_ENUMVAL_VALUE = 0xb BPF_CORE_TYPE_MATCHES = 0xc + BPF_F_TIMER_ABS = 0x1 ) const ( @@ -2979,6 +3005,12 @@ type LoopInfo64 struct { Encrypt_key [32]uint8 Init [2]uint64 } +type LoopConfig struct { + Fd uint32 + Size uint32 + Info LoopInfo64 + _ [8]uint64 +} type TIPCSocketAddr struct { Ref uint32 diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index fb6cfd046..47dc57967 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -155,6 +155,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys GetModuleFileName(module Handle, filename *uint16, size uint32) (n uint32, err error) = kernel32.GetModuleFileNameW //sys GetModuleHandleEx(flags uint32, moduleName *uint16, module *Handle) (err error) = kernel32.GetModuleHandleExW //sys SetDefaultDllDirectories(directoryFlags uint32) (err error) +//sys AddDllDirectory(path *uint16) (cookie uintptr, err error) = kernel32.AddDllDirectory +//sys RemoveDllDirectory(cookie uintptr) (err error) = kernel32.RemoveDllDirectory //sys SetDllDirectory(path string) (err error) = kernel32.SetDllDirectoryW //sys GetVersion() (ver uint32, err error) //sys FormatMessage(flags uint32, msgsrc uintptr, msgid uint32, langid uint32, buf []uint16, args *byte) (n uint32, err error) = FormatMessageW diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index db6282e00..146a1f019 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -184,6 +184,7 @@ var ( procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") procGetIfEntry = modiphlpapi.NewProc("GetIfEntry") + procAddDllDirectory = modkernel32.NewProc("AddDllDirectory") procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") procCancelIoEx = modkernel32.NewProc("CancelIoEx") @@ -330,6 +331,7 @@ var ( procReadProcessMemory = modkernel32.NewProc("ReadProcessMemory") procReleaseMutex = modkernel32.NewProc("ReleaseMutex") procRemoveDirectoryW = modkernel32.NewProc("RemoveDirectoryW") + procRemoveDllDirectory = modkernel32.NewProc("RemoveDllDirectory") procResetEvent = modkernel32.NewProc("ResetEvent") procResizePseudoConsole = modkernel32.NewProc("ResizePseudoConsole") procResumeThread = modkernel32.NewProc("ResumeThread") @@ -1605,6 +1607,15 @@ func GetIfEntry(pIfRow *MibIfRow) (errcode error) { return } +func AddDllDirectory(path *uint16) (cookie uintptr, err error) { + r0, _, e1 := syscall.Syscall(procAddDllDirectory.Addr(), 1, uintptr(unsafe.Pointer(path)), 0, 0) + cookie = uintptr(r0) + if cookie == 0 { + err = errnoErr(e1) + } + return +} + func AssignProcessToJobObject(job Handle, process Handle) (err error) { r1, _, e1 := syscall.Syscall(procAssignProcessToJobObject.Addr(), 2, uintptr(job), uintptr(process), 0) if r1 == 0 { @@ -2879,6 +2890,14 @@ func RemoveDirectory(path *uint16) (err error) { return } +func RemoveDllDirectory(cookie uintptr) (err error) { + r1, _, e1 := syscall.Syscall(procRemoveDllDirectory.Addr(), 1, uintptr(cookie), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func ResetEvent(event Handle) (err error) { r1, _, e1 := syscall.Syscall(procResetEvent.Addr(), 1, uintptr(event), 0, 0) if r1 == 0 { diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go index cd874775b..68d2981d1 100644 --- a/vendor/golang.org/x/text/cases/tables13.0.0.go +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package cases diff --git a/vendor/golang.org/x/text/cases/tables15.0.0.go b/vendor/golang.org/x/text/cases/tables15.0.0.go new file mode 100644 index 000000000..e431b9953 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables15.0.0.go @@ -0,0 +1,2528 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +var xorData string = "" + // Size: 213 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x03'" + + "\x00\x03)\x00\x03+\x00\x03/\x00\x03\x19\x00\x03\x1b\x00\x03\x1f\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 13398 bytes (13.08 KiB). Checksum: 544af6e6b1b70931. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 22: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 22 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 24 blocks, 1536 entries, 3072 bytes +// The third block is the zero block. +var caseValues = [1536]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0010, 0x2c1: 0x0010, 0x2c2: 0x0010, 0x2c3: 0x0010, 0x2c4: 0x0010, 0x2c5: 0x0010, + 0x2c6: 0x0010, 0x2c7: 0x0010, 0x2c8: 0x0010, 0x2c9: 0x0014, 0x2ca: 0x0024, 0x2cb: 0x0024, + 0x2cc: 0x0024, 0x2cd: 0x0024, 0x2ce: 0x0024, 0x2cf: 0x0034, 0x2d0: 0x0034, 0x2d1: 0x0034, + 0x2d2: 0x0034, 0x2d3: 0x0034, 0x2d4: 0x0024, 0x2d5: 0x0024, 0x2d6: 0x0024, 0x2d7: 0x0024, + 0x2d8: 0x0024, 0x2d9: 0x0024, 0x2da: 0x0024, 0x2db: 0x0024, 0x2dc: 0x0024, 0x2dd: 0x0024, + 0x2de: 0x0024, 0x2df: 0x0024, 0x2e0: 0x0024, 0x2e1: 0x0024, 0x2e2: 0x0014, 0x2e3: 0x0034, + 0x2e4: 0x0024, 0x2e5: 0x0024, 0x2e6: 0x0034, 0x2e7: 0x0024, 0x2e8: 0x0024, 0x2e9: 0x0034, + 0x2ea: 0x0024, 0x2eb: 0x0024, 0x2ec: 0x0024, 0x2ed: 0x0034, 0x2ee: 0x0034, 0x2ef: 0x0034, + 0x2f0: 0x0034, 0x2f1: 0x0034, 0x2f2: 0x0034, 0x2f3: 0x0024, 0x2f4: 0x0024, 0x2f5: 0x0024, + 0x2f6: 0x0034, 0x2f7: 0x0024, 0x2f8: 0x0024, 0x2f9: 0x0034, 0x2fa: 0x0034, 0x2fb: 0x0024, + 0x2fc: 0x0024, 0x2fd: 0x0024, 0x2fe: 0x0024, 0x2ff: 0x0024, + // Block 0xc, offset 0x300 + 0x300: 0x7053, 0x301: 0x7053, 0x302: 0x7053, 0x303: 0x7053, 0x304: 0x7053, 0x305: 0x7053, + 0x307: 0x7053, + 0x30d: 0x7053, 0x310: 0x1aea, 0x311: 0x1b6a, + 0x312: 0x1bea, 0x313: 0x1c6a, 0x314: 0x1cea, 0x315: 0x1d6a, 0x316: 0x1dea, 0x317: 0x1e6a, + 0x318: 0x1eea, 0x319: 0x1f6a, 0x31a: 0x1fea, 0x31b: 0x206a, 0x31c: 0x20ea, 0x31d: 0x216a, + 0x31e: 0x21ea, 0x31f: 0x226a, 0x320: 0x22ea, 0x321: 0x236a, 0x322: 0x23ea, 0x323: 0x246a, + 0x324: 0x24ea, 0x325: 0x256a, 0x326: 0x25ea, 0x327: 0x266a, 0x328: 0x26ea, 0x329: 0x276a, + 0x32a: 0x27ea, 0x32b: 0x286a, 0x32c: 0x28ea, 0x32d: 0x296a, 0x32e: 0x29ea, 0x32f: 0x2a6a, + 0x330: 0x2aea, 0x331: 0x2b6a, 0x332: 0x2bea, 0x333: 0x2c6a, 0x334: 0x2cea, 0x335: 0x2d6a, + 0x336: 0x2dea, 0x337: 0x2e6a, 0x338: 0x2eea, 0x339: 0x2f6a, 0x33a: 0x2fea, + 0x33c: 0x0015, 0x33d: 0x306a, 0x33e: 0x30ea, 0x33f: 0x316a, + // Block 0xd, offset 0x340 + 0x340: 0x0812, 0x341: 0x0812, 0x342: 0x0812, 0x343: 0x0812, 0x344: 0x0812, 0x345: 0x0812, + 0x348: 0x0813, 0x349: 0x0813, 0x34a: 0x0813, 0x34b: 0x0813, + 0x34c: 0x0813, 0x34d: 0x0813, 0x350: 0x3b1a, 0x351: 0x0812, + 0x352: 0x3bfa, 0x353: 0x0812, 0x354: 0x3d3a, 0x355: 0x0812, 0x356: 0x3e7a, 0x357: 0x0812, + 0x359: 0x0813, 0x35b: 0x0813, 0x35d: 0x0813, + 0x35f: 0x0813, 0x360: 0x0812, 0x361: 0x0812, 0x362: 0x0812, 0x363: 0x0812, + 0x364: 0x0812, 0x365: 0x0812, 0x366: 0x0812, 0x367: 0x0812, 0x368: 0x0813, 0x369: 0x0813, + 0x36a: 0x0813, 0x36b: 0x0813, 0x36c: 0x0813, 0x36d: 0x0813, 0x36e: 0x0813, 0x36f: 0x0813, + 0x370: 0x9252, 0x371: 0x9252, 0x372: 0x9552, 0x373: 0x9552, 0x374: 0x9852, 0x375: 0x9852, + 0x376: 0x9b52, 0x377: 0x9b52, 0x378: 0x9e52, 0x379: 0x9e52, 0x37a: 0xa152, 0x37b: 0xa152, + 0x37c: 0x4d52, 0x37d: 0x4d52, + // Block 0xe, offset 0x380 + 0x380: 0x3fba, 0x381: 0x40aa, 0x382: 0x419a, 0x383: 0x428a, 0x384: 0x437a, 0x385: 0x446a, + 0x386: 0x455a, 0x387: 0x464a, 0x388: 0x4739, 0x389: 0x4829, 0x38a: 0x4919, 0x38b: 0x4a09, + 0x38c: 0x4af9, 0x38d: 0x4be9, 0x38e: 0x4cd9, 0x38f: 0x4dc9, 0x390: 0x4eba, 0x391: 0x4faa, + 0x392: 0x509a, 0x393: 0x518a, 0x394: 0x527a, 0x395: 0x536a, 0x396: 0x545a, 0x397: 0x554a, + 0x398: 0x5639, 0x399: 0x5729, 0x39a: 0x5819, 0x39b: 0x5909, 0x39c: 0x59f9, 0x39d: 0x5ae9, + 0x39e: 0x5bd9, 0x39f: 0x5cc9, 0x3a0: 0x5dba, 0x3a1: 0x5eaa, 0x3a2: 0x5f9a, 0x3a3: 0x608a, + 0x3a4: 0x617a, 0x3a5: 0x626a, 0x3a6: 0x635a, 0x3a7: 0x644a, 0x3a8: 0x6539, 0x3a9: 0x6629, + 0x3aa: 0x6719, 0x3ab: 0x6809, 0x3ac: 0x68f9, 0x3ad: 0x69e9, 0x3ae: 0x6ad9, 0x3af: 0x6bc9, + 0x3b0: 0x0812, 0x3b1: 0x0812, 0x3b2: 0x6cba, 0x3b3: 0x6dca, 0x3b4: 0x6e9a, + 0x3b6: 0x6f7a, 0x3b7: 0x705a, 0x3b8: 0x0813, 0x3b9: 0x0813, 0x3ba: 0x9253, 0x3bb: 0x9253, + 0x3bc: 0x7199, 0x3bd: 0x0004, 0x3be: 0x726a, 0x3bf: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0004, 0x3c1: 0x0004, 0x3c2: 0x72ea, 0x3c3: 0x73fa, 0x3c4: 0x74ca, + 0x3c6: 0x75aa, 0x3c7: 0x768a, 0x3c8: 0x9553, 0x3c9: 0x9553, 0x3ca: 0x9853, 0x3cb: 0x9853, + 0x3cc: 0x77c9, 0x3cd: 0x0004, 0x3ce: 0x0004, 0x3cf: 0x0004, 0x3d0: 0x0812, 0x3d1: 0x0812, + 0x3d2: 0x789a, 0x3d3: 0x79da, 0x3d6: 0x7b1a, 0x3d7: 0x7bfa, + 0x3d8: 0x0813, 0x3d9: 0x0813, 0x3da: 0x9b53, 0x3db: 0x9b53, 0x3dd: 0x0004, + 0x3de: 0x0004, 0x3df: 0x0004, 0x3e0: 0x0812, 0x3e1: 0x0812, 0x3e2: 0x7d3a, 0x3e3: 0x7e7a, + 0x3e4: 0x7fba, 0x3e5: 0x0912, 0x3e6: 0x809a, 0x3e7: 0x817a, 0x3e8: 0x0813, 0x3e9: 0x0813, + 0x3ea: 0xa153, 0x3eb: 0xa153, 0x3ec: 0x0913, 0x3ed: 0x0004, 0x3ee: 0x0004, 0x3ef: 0x0004, + 0x3f2: 0x82ba, 0x3f3: 0x83ca, 0x3f4: 0x849a, + 0x3f6: 0x857a, 0x3f7: 0x865a, 0x3f8: 0x9e53, 0x3f9: 0x9e53, 0x3fa: 0x4d53, 0x3fb: 0x4d53, + 0x3fc: 0x8799, 0x3fd: 0x0004, 0x3fe: 0x0004, + // Block 0x10, offset 0x400 + 0x402: 0x0013, + 0x407: 0x0013, 0x40a: 0x0012, 0x40b: 0x0013, + 0x40c: 0x0013, 0x40d: 0x0013, 0x40e: 0x0012, 0x40f: 0x0012, 0x410: 0x0013, 0x411: 0x0013, + 0x412: 0x0013, 0x413: 0x0012, 0x415: 0x0013, + 0x419: 0x0013, 0x41a: 0x0013, 0x41b: 0x0013, 0x41c: 0x0013, 0x41d: 0x0013, + 0x424: 0x0013, 0x426: 0x886b, 0x428: 0x0013, + 0x42a: 0x88cb, 0x42b: 0x890b, 0x42c: 0x0013, 0x42d: 0x0013, 0x42f: 0x0012, + 0x430: 0x0013, 0x431: 0x0013, 0x432: 0xa453, 0x433: 0x0013, 0x434: 0x0012, 0x435: 0x0010, + 0x436: 0x0010, 0x437: 0x0010, 0x438: 0x0010, 0x439: 0x0012, + 0x43c: 0x0012, 0x43d: 0x0012, 0x43e: 0x0013, 0x43f: 0x0013, + // Block 0x11, offset 0x440 + 0x440: 0x1a13, 0x441: 0x1a13, 0x442: 0x1e13, 0x443: 0x1e13, 0x444: 0x1a13, 0x445: 0x1a13, + 0x446: 0x2613, 0x447: 0x2613, 0x448: 0x2a13, 0x449: 0x2a13, 0x44a: 0x2e13, 0x44b: 0x2e13, + 0x44c: 0x2a13, 0x44d: 0x2a13, 0x44e: 0x2613, 0x44f: 0x2613, 0x450: 0xa752, 0x451: 0xa752, + 0x452: 0xaa52, 0x453: 0xaa52, 0x454: 0xad52, 0x455: 0xad52, 0x456: 0xaa52, 0x457: 0xaa52, + 0x458: 0xa752, 0x459: 0xa752, 0x45a: 0x1a12, 0x45b: 0x1a12, 0x45c: 0x1e12, 0x45d: 0x1e12, + 0x45e: 0x1a12, 0x45f: 0x1a12, 0x460: 0x2612, 0x461: 0x2612, 0x462: 0x2a12, 0x463: 0x2a12, + 0x464: 0x2e12, 0x465: 0x2e12, 0x466: 0x2a12, 0x467: 0x2a12, 0x468: 0x2612, 0x469: 0x2612, + // Block 0x12, offset 0x480 + 0x480: 0x6552, 0x481: 0x6552, 0x482: 0x6552, 0x483: 0x6552, 0x484: 0x6552, 0x485: 0x6552, + 0x486: 0x6552, 0x487: 0x6552, 0x488: 0x6552, 0x489: 0x6552, 0x48a: 0x6552, 0x48b: 0x6552, + 0x48c: 0x6552, 0x48d: 0x6552, 0x48e: 0x6552, 0x48f: 0x6552, 0x490: 0xb052, 0x491: 0xb052, + 0x492: 0xb052, 0x493: 0xb052, 0x494: 0xb052, 0x495: 0xb052, 0x496: 0xb052, 0x497: 0xb052, + 0x498: 0xb052, 0x499: 0xb052, 0x49a: 0xb052, 0x49b: 0xb052, 0x49c: 0xb052, 0x49d: 0xb052, + 0x49e: 0xb052, 0x49f: 0xb052, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x896b, 0x4a3: 0x8b53, + 0x4a4: 0x89cb, 0x4a5: 0x8a2a, 0x4a6: 0x8a8a, 0x4a7: 0x0f13, 0x4a8: 0x0f12, 0x4a9: 0x0313, + 0x4aa: 0x0312, 0x4ab: 0x0713, 0x4ac: 0x0712, 0x4ad: 0x8aeb, 0x4ae: 0x8b4b, 0x4af: 0x8bab, + 0x4b0: 0x8c0b, 0x4b1: 0x0012, 0x4b2: 0x0113, 0x4b3: 0x0112, 0x4b4: 0x0012, 0x4b5: 0x0313, + 0x4b6: 0x0312, 0x4b7: 0x0012, 0x4b8: 0x0012, 0x4b9: 0x0012, 0x4ba: 0x0012, 0x4bb: 0x0012, + 0x4bc: 0x0015, 0x4bd: 0x0015, 0x4be: 0x8c6b, 0x4bf: 0x8ccb, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0113, 0x4c1: 0x0112, 0x4c2: 0x0113, 0x4c3: 0x0112, 0x4c4: 0x0113, 0x4c5: 0x0112, + 0x4c6: 0x0113, 0x4c7: 0x0112, 0x4c8: 0x0014, 0x4c9: 0x0014, 0x4ca: 0x0014, 0x4cb: 0x0713, + 0x4cc: 0x0712, 0x4cd: 0x8d2b, 0x4ce: 0x0012, 0x4cf: 0x0010, 0x4d0: 0x0113, 0x4d1: 0x0112, + 0x4d2: 0x0113, 0x4d3: 0x0112, 0x4d4: 0x6552, 0x4d5: 0x0012, 0x4d6: 0x0113, 0x4d7: 0x0112, + 0x4d8: 0x0113, 0x4d9: 0x0112, 0x4da: 0x0113, 0x4db: 0x0112, 0x4dc: 0x0113, 0x4dd: 0x0112, + 0x4de: 0x0113, 0x4df: 0x0112, 0x4e0: 0x0113, 0x4e1: 0x0112, 0x4e2: 0x0113, 0x4e3: 0x0112, + 0x4e4: 0x0113, 0x4e5: 0x0112, 0x4e6: 0x0113, 0x4e7: 0x0112, 0x4e8: 0x0113, 0x4e9: 0x0112, + 0x4ea: 0x8d8b, 0x4eb: 0x8deb, 0x4ec: 0x8e4b, 0x4ed: 0x8eab, 0x4ee: 0x8f0b, 0x4ef: 0x0012, + 0x4f0: 0x8f6b, 0x4f1: 0x8fcb, 0x4f2: 0x902b, 0x4f3: 0xb353, 0x4f4: 0x0113, 0x4f5: 0x0112, + 0x4f6: 0x0113, 0x4f7: 0x0112, 0x4f8: 0x0113, 0x4f9: 0x0112, 0x4fa: 0x0113, 0x4fb: 0x0112, + 0x4fc: 0x0113, 0x4fd: 0x0112, 0x4fe: 0x0113, 0x4ff: 0x0112, + // Block 0x14, offset 0x500 + 0x500: 0x90ea, 0x501: 0x916a, 0x502: 0x91ea, 0x503: 0x926a, 0x504: 0x931a, 0x505: 0x93ca, + 0x506: 0x944a, + 0x513: 0x94ca, 0x514: 0x95aa, 0x515: 0x968a, 0x516: 0x976a, 0x517: 0x984a, + 0x51d: 0x0010, + 0x51e: 0x0034, 0x51f: 0x0010, 0x520: 0x0010, 0x521: 0x0010, 0x522: 0x0010, 0x523: 0x0010, + 0x524: 0x0010, 0x525: 0x0010, 0x526: 0x0010, 0x527: 0x0010, 0x528: 0x0010, + 0x52a: 0x0010, 0x52b: 0x0010, 0x52c: 0x0010, 0x52d: 0x0010, 0x52e: 0x0010, 0x52f: 0x0010, + 0x530: 0x0010, 0x531: 0x0010, 0x532: 0x0010, 0x533: 0x0010, 0x534: 0x0010, 0x535: 0x0010, + 0x536: 0x0010, 0x538: 0x0010, 0x539: 0x0010, 0x53a: 0x0010, 0x53b: 0x0010, + 0x53c: 0x0010, 0x53e: 0x0010, + // Block 0x15, offset 0x540 + 0x540: 0x2713, 0x541: 0x2913, 0x542: 0x2b13, 0x543: 0x2913, 0x544: 0x2f13, 0x545: 0x2913, + 0x546: 0x2b13, 0x547: 0x2913, 0x548: 0x2713, 0x549: 0x3913, 0x54a: 0x3b13, + 0x54c: 0x3f13, 0x54d: 0x3913, 0x54e: 0x3b13, 0x54f: 0x3913, 0x550: 0x2713, 0x551: 0x2913, + 0x552: 0x2b13, 0x554: 0x2f13, 0x555: 0x2913, 0x557: 0xbc52, + 0x558: 0xbf52, 0x559: 0xc252, 0x55a: 0xbf52, 0x55b: 0xc552, 0x55c: 0xbf52, 0x55d: 0xc252, + 0x55e: 0xbf52, 0x55f: 0xbc52, 0x560: 0xc852, 0x561: 0xcb52, 0x563: 0xce52, + 0x564: 0xc852, 0x565: 0xcb52, 0x566: 0xc852, 0x567: 0x2712, 0x568: 0x2912, 0x569: 0x2b12, + 0x56a: 0x2912, 0x56b: 0x2f12, 0x56c: 0x2912, 0x56d: 0x2b12, 0x56e: 0x2912, 0x56f: 0x2712, + 0x570: 0x3912, 0x571: 0x3b12, 0x573: 0x3f12, 0x574: 0x3912, 0x575: 0x3b12, + 0x576: 0x3912, 0x577: 0x2712, 0x578: 0x2912, 0x579: 0x2b12, 0x57b: 0x2f12, + 0x57c: 0x2912, + // Block 0x16, offset 0x580 + 0x580: 0x2213, 0x581: 0x2213, 0x582: 0x2613, 0x583: 0x2613, 0x584: 0x2213, 0x585: 0x2213, + 0x586: 0x2e13, 0x587: 0x2e13, 0x588: 0x2213, 0x589: 0x2213, 0x58a: 0x2613, 0x58b: 0x2613, + 0x58c: 0x2213, 0x58d: 0x2213, 0x58e: 0x3e13, 0x58f: 0x3e13, 0x590: 0x2213, 0x591: 0x2213, + 0x592: 0x2613, 0x593: 0x2613, 0x594: 0x2213, 0x595: 0x2213, 0x596: 0x2e13, 0x597: 0x2e13, + 0x598: 0x2213, 0x599: 0x2213, 0x59a: 0x2613, 0x59b: 0x2613, 0x59c: 0x2213, 0x59d: 0x2213, + 0x59e: 0xd153, 0x59f: 0xd153, 0x5a0: 0xd453, 0x5a1: 0xd453, 0x5a2: 0x2212, 0x5a3: 0x2212, + 0x5a4: 0x2612, 0x5a5: 0x2612, 0x5a6: 0x2212, 0x5a7: 0x2212, 0x5a8: 0x2e12, 0x5a9: 0x2e12, + 0x5aa: 0x2212, 0x5ab: 0x2212, 0x5ac: 0x2612, 0x5ad: 0x2612, 0x5ae: 0x2212, 0x5af: 0x2212, + 0x5b0: 0x3e12, 0x5b1: 0x3e12, 0x5b2: 0x2212, 0x5b3: 0x2212, 0x5b4: 0x2612, 0x5b5: 0x2612, + 0x5b6: 0x2212, 0x5b7: 0x2212, 0x5b8: 0x2e12, 0x5b9: 0x2e12, 0x5ba: 0x2212, 0x5bb: 0x2212, + 0x5bc: 0x2612, 0x5bd: 0x2612, 0x5be: 0x2212, 0x5bf: 0x2212, + // Block 0x17, offset 0x5c0 + 0x5c2: 0x0010, + 0x5c7: 0x0010, 0x5c9: 0x0010, 0x5cb: 0x0010, + 0x5cd: 0x0010, 0x5ce: 0x0010, 0x5cf: 0x0010, 0x5d1: 0x0010, + 0x5d2: 0x0010, 0x5d4: 0x0010, 0x5d7: 0x0010, + 0x5d9: 0x0010, 0x5db: 0x0010, 0x5dd: 0x0010, + 0x5df: 0x0010, 0x5e1: 0x0010, 0x5e2: 0x0010, + 0x5e4: 0x0010, 0x5e7: 0x0010, 0x5e8: 0x0010, 0x5e9: 0x0010, + 0x5ea: 0x0010, 0x5ec: 0x0010, 0x5ed: 0x0010, 0x5ee: 0x0010, 0x5ef: 0x0010, + 0x5f0: 0x0010, 0x5f1: 0x0010, 0x5f2: 0x0010, 0x5f4: 0x0010, 0x5f5: 0x0010, + 0x5f6: 0x0010, 0x5f7: 0x0010, 0x5f9: 0x0010, 0x5fa: 0x0010, 0x5fb: 0x0010, + 0x5fc: 0x0010, 0x5fe: 0x0010, +} + +// caseIndex: 27 blocks, 1728 entries, 3456 bytes +// Block 0 is the zero block. +var caseIndex = [1728]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x16, 0xc3: 0x17, 0xc4: 0x18, 0xc5: 0x19, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x1a, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x1b, 0xcc: 0x1c, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1d, 0xd1: 0x1e, 0xd2: 0x1f, 0xd3: 0x20, 0xd4: 0x21, 0xd5: 0x22, 0xd6: 0x08, 0xd7: 0x23, + 0xd8: 0x24, 0xd9: 0x25, 0xda: 0x26, 0xdb: 0x27, 0xdc: 0x28, 0xdd: 0x29, 0xde: 0x2a, 0xdf: 0x2b, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x16, 0xf3: 0x18, + // Block 0x4, offset 0x100 + 0x120: 0x2c, 0x121: 0x2d, 0x122: 0x2e, 0x123: 0x09, 0x124: 0x2f, 0x125: 0x30, 0x126: 0x31, 0x127: 0x32, + 0x128: 0x33, 0x129: 0x34, 0x12a: 0x35, 0x12b: 0x36, 0x12c: 0x37, 0x12d: 0x38, 0x12e: 0x39, 0x12f: 0x3a, + 0x130: 0x3b, 0x131: 0x3c, 0x132: 0x3d, 0x133: 0x3e, 0x134: 0x3f, 0x135: 0x40, 0x136: 0x41, 0x137: 0x42, + 0x138: 0x43, 0x139: 0x44, 0x13a: 0x45, 0x13b: 0x46, 0x13c: 0x47, 0x13d: 0x48, 0x13e: 0x49, 0x13f: 0x4a, + // Block 0x5, offset 0x140 + 0x140: 0x4b, 0x141: 0x4c, 0x142: 0x4d, 0x143: 0x0a, 0x144: 0x26, 0x145: 0x26, 0x146: 0x26, 0x147: 0x26, + 0x148: 0x26, 0x149: 0x4e, 0x14a: 0x4f, 0x14b: 0x50, 0x14c: 0x51, 0x14d: 0x52, 0x14e: 0x53, 0x14f: 0x54, + 0x150: 0x55, 0x151: 0x26, 0x152: 0x26, 0x153: 0x26, 0x154: 0x26, 0x155: 0x26, 0x156: 0x26, 0x157: 0x26, + 0x158: 0x26, 0x159: 0x56, 0x15a: 0x57, 0x15b: 0x58, 0x15c: 0x59, 0x15d: 0x5a, 0x15e: 0x5b, 0x15f: 0x5c, + 0x160: 0x5d, 0x161: 0x5e, 0x162: 0x5f, 0x163: 0x60, 0x164: 0x61, 0x165: 0x62, 0x167: 0x63, + 0x168: 0x64, 0x169: 0x65, 0x16a: 0x66, 0x16b: 0x67, 0x16c: 0x68, 0x16d: 0x69, 0x16e: 0x6a, 0x16f: 0x6b, + 0x170: 0x6c, 0x171: 0x6d, 0x172: 0x6e, 0x173: 0x6f, 0x174: 0x70, 0x175: 0x71, 0x176: 0x72, 0x177: 0x73, + 0x178: 0x74, 0x179: 0x74, 0x17a: 0x75, 0x17b: 0x74, 0x17c: 0x76, 0x17d: 0x0b, 0x17e: 0x0c, 0x17f: 0x0d, + // Block 0x6, offset 0x180 + 0x180: 0x77, 0x181: 0x78, 0x182: 0x79, 0x183: 0x7a, 0x184: 0x0e, 0x185: 0x7b, 0x186: 0x7c, + 0x192: 0x7d, 0x193: 0x0f, + 0x1b0: 0x7e, 0x1b1: 0x10, 0x1b2: 0x74, 0x1b3: 0x7f, 0x1b4: 0x80, 0x1b5: 0x81, 0x1b6: 0x82, 0x1b7: 0x83, + 0x1b8: 0x84, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x85, 0x1c2: 0x86, 0x1c3: 0x87, 0x1c4: 0x88, 0x1c5: 0x26, 0x1c6: 0x89, + // Block 0x8, offset 0x200 + 0x200: 0x8a, 0x201: 0x26, 0x202: 0x26, 0x203: 0x26, 0x204: 0x26, 0x205: 0x26, 0x206: 0x26, 0x207: 0x26, + 0x208: 0x26, 0x209: 0x26, 0x20a: 0x26, 0x20b: 0x26, 0x20c: 0x26, 0x20d: 0x26, 0x20e: 0x26, 0x20f: 0x26, + 0x210: 0x26, 0x211: 0x26, 0x212: 0x8b, 0x213: 0x8c, 0x214: 0x26, 0x215: 0x26, 0x216: 0x26, 0x217: 0x26, + 0x218: 0x8d, 0x219: 0x8e, 0x21a: 0x8f, 0x21b: 0x90, 0x21c: 0x91, 0x21d: 0x92, 0x21e: 0x11, 0x21f: 0x93, + 0x220: 0x94, 0x221: 0x95, 0x222: 0x26, 0x223: 0x96, 0x224: 0x97, 0x225: 0x98, 0x226: 0x99, 0x227: 0x9a, + 0x228: 0x9b, 0x229: 0x9c, 0x22a: 0x9d, 0x22b: 0x9e, 0x22c: 0x9f, 0x22d: 0xa0, 0x22e: 0xa1, 0x22f: 0xa2, + 0x230: 0x26, 0x231: 0x26, 0x232: 0x26, 0x233: 0x26, 0x234: 0x26, 0x235: 0x26, 0x236: 0x26, 0x237: 0x26, + 0x238: 0x26, 0x239: 0x26, 0x23a: 0x26, 0x23b: 0x26, 0x23c: 0x26, 0x23d: 0x26, 0x23e: 0x26, 0x23f: 0x26, + // Block 0x9, offset 0x240 + 0x240: 0x26, 0x241: 0x26, 0x242: 0x26, 0x243: 0x26, 0x244: 0x26, 0x245: 0x26, 0x246: 0x26, 0x247: 0x26, + 0x248: 0x26, 0x249: 0x26, 0x24a: 0x26, 0x24b: 0x26, 0x24c: 0x26, 0x24d: 0x26, 0x24e: 0x26, 0x24f: 0x26, + 0x250: 0x26, 0x251: 0x26, 0x252: 0x26, 0x253: 0x26, 0x254: 0x26, 0x255: 0x26, 0x256: 0x26, 0x257: 0x26, + 0x258: 0x26, 0x259: 0x26, 0x25a: 0x26, 0x25b: 0x26, 0x25c: 0x26, 0x25d: 0x26, 0x25e: 0x26, 0x25f: 0x26, + 0x260: 0x26, 0x261: 0x26, 0x262: 0x26, 0x263: 0x26, 0x264: 0x26, 0x265: 0x26, 0x266: 0x26, 0x267: 0x26, + 0x268: 0x26, 0x269: 0x26, 0x26a: 0x26, 0x26b: 0x26, 0x26c: 0x26, 0x26d: 0x26, 0x26e: 0x26, 0x26f: 0x26, + 0x270: 0x26, 0x271: 0x26, 0x272: 0x26, 0x273: 0x26, 0x274: 0x26, 0x275: 0x26, 0x276: 0x26, 0x277: 0x26, + 0x278: 0x26, 0x279: 0x26, 0x27a: 0x26, 0x27b: 0x26, 0x27c: 0x26, 0x27d: 0x26, 0x27e: 0x26, 0x27f: 0x26, + // Block 0xa, offset 0x280 + 0x280: 0x26, 0x281: 0x26, 0x282: 0x26, 0x283: 0x26, 0x284: 0x26, 0x285: 0x26, 0x286: 0x26, 0x287: 0x26, + 0x288: 0x26, 0x289: 0x26, 0x28a: 0x26, 0x28b: 0x26, 0x28c: 0x26, 0x28d: 0x26, 0x28e: 0x26, 0x28f: 0x26, + 0x290: 0x26, 0x291: 0x26, 0x292: 0x26, 0x293: 0x26, 0x294: 0x26, 0x295: 0x26, 0x296: 0x26, 0x297: 0x26, + 0x298: 0x26, 0x299: 0x26, 0x29a: 0x26, 0x29b: 0x26, 0x29c: 0x26, 0x29d: 0x26, 0x29e: 0xa3, 0x29f: 0xa4, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x12, 0x2ed: 0xa5, 0x2ee: 0xa6, 0x2ef: 0xa7, + 0x2f0: 0x26, 0x2f1: 0x26, 0x2f2: 0x26, 0x2f3: 0x26, 0x2f4: 0xa8, 0x2f5: 0xa9, 0x2f6: 0xaa, 0x2f7: 0xab, + 0x2f8: 0xac, 0x2f9: 0xad, 0x2fa: 0x26, 0x2fb: 0xae, 0x2fc: 0xaf, 0x2fd: 0xb0, 0x2fe: 0xb1, 0x2ff: 0xb2, + // Block 0xc, offset 0x300 + 0x300: 0xb3, 0x301: 0xb4, 0x302: 0x26, 0x303: 0xb5, 0x305: 0xb6, 0x307: 0xb7, + 0x30a: 0xb8, 0x30b: 0xb9, 0x30c: 0xba, 0x30d: 0xbb, 0x30e: 0xbc, 0x30f: 0xbd, + 0x310: 0xbe, 0x311: 0xbf, 0x312: 0xc0, 0x313: 0xc1, 0x314: 0xc2, 0x315: 0xc3, 0x316: 0x13, + 0x318: 0x26, 0x319: 0x26, 0x31a: 0x26, 0x31b: 0x26, 0x31c: 0xc4, 0x31d: 0xc5, 0x31e: 0xc6, + 0x320: 0xc7, 0x321: 0xc8, 0x322: 0xc9, 0x323: 0xca, 0x324: 0xcb, 0x326: 0xcc, + 0x328: 0xcd, 0x329: 0xce, 0x32a: 0xcf, 0x32b: 0xd0, 0x32c: 0x60, 0x32d: 0xd1, 0x32e: 0xd2, + 0x330: 0x26, 0x331: 0xd3, 0x332: 0xd4, 0x333: 0xd5, 0x334: 0xd6, + 0x33a: 0xd7, 0x33b: 0xd8, 0x33c: 0xd9, 0x33d: 0xda, 0x33e: 0xdb, 0x33f: 0xdc, + // Block 0xd, offset 0x340 + 0x340: 0xdd, 0x341: 0xde, 0x342: 0xdf, 0x343: 0xe0, 0x344: 0xe1, 0x345: 0xe2, 0x346: 0xe3, 0x347: 0xe4, + 0x348: 0xe5, 0x349: 0xe6, 0x34a: 0xe7, 0x34b: 0xe8, 0x34c: 0xe9, 0x34d: 0xea, + 0x350: 0xeb, 0x351: 0xec, 0x352: 0xed, 0x353: 0xee, 0x356: 0xef, 0x357: 0xf0, + 0x358: 0xf1, 0x359: 0xf2, 0x35a: 0xf3, 0x35b: 0xf4, 0x35c: 0xf5, + 0x360: 0xf6, 0x362: 0xf7, 0x363: 0xf8, 0x364: 0xf9, 0x365: 0xfa, 0x366: 0xfb, 0x367: 0xfc, + 0x368: 0xfd, 0x369: 0xfe, 0x36a: 0xff, 0x36b: 0x100, + 0x370: 0x101, 0x371: 0x102, 0x372: 0x103, 0x374: 0x104, 0x375: 0x105, 0x376: 0x106, + 0x37b: 0x107, 0x37c: 0x108, 0x37d: 0x109, 0x37e: 0x10a, + // Block 0xe, offset 0x380 + 0x380: 0x26, 0x381: 0x26, 0x382: 0x26, 0x383: 0x26, 0x384: 0x26, 0x385: 0x26, 0x386: 0x26, 0x387: 0x26, + 0x388: 0x26, 0x389: 0x26, 0x38a: 0x26, 0x38b: 0x26, 0x38c: 0x26, 0x38d: 0x26, 0x38e: 0x10b, + 0x390: 0x26, 0x391: 0x10c, 0x392: 0x26, 0x393: 0x26, 0x394: 0x26, 0x395: 0x10d, + 0x3be: 0xa9, 0x3bf: 0x10e, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x26, 0x3c1: 0x26, 0x3c2: 0x26, 0x3c3: 0x26, 0x3c4: 0x26, 0x3c5: 0x26, 0x3c6: 0x26, 0x3c7: 0x26, + 0x3c8: 0x26, 0x3c9: 0x26, 0x3ca: 0x26, 0x3cb: 0x26, 0x3cc: 0x26, 0x3cd: 0x26, 0x3ce: 0x26, 0x3cf: 0x26, + 0x3d0: 0x10f, 0x3d1: 0x110, + // Block 0x10, offset 0x400 + 0x410: 0x26, 0x411: 0x26, 0x412: 0x26, 0x413: 0x26, 0x414: 0x26, 0x415: 0x26, 0x416: 0x26, 0x417: 0x26, + 0x418: 0x26, 0x419: 0x111, + // Block 0x11, offset 0x440 + 0x460: 0x26, 0x461: 0x26, 0x462: 0x26, 0x463: 0x26, 0x464: 0x26, 0x465: 0x26, 0x466: 0x26, 0x467: 0x26, + 0x468: 0x100, 0x469: 0x112, 0x46a: 0x113, 0x46b: 0x114, 0x46c: 0x115, 0x46d: 0x116, 0x46e: 0x117, + 0x479: 0x118, 0x47c: 0x26, 0x47d: 0x119, 0x47e: 0x11a, 0x47f: 0x11b, + // Block 0x12, offset 0x480 + 0x4bf: 0x11c, + // Block 0x13, offset 0x4c0 + 0x4f0: 0x26, 0x4f1: 0x11d, 0x4f2: 0x11e, + // Block 0x14, offset 0x500 + 0x53c: 0x11f, 0x53d: 0x120, + // Block 0x15, offset 0x540 + 0x545: 0x121, 0x546: 0x122, + 0x549: 0x123, + 0x550: 0x124, 0x551: 0x125, 0x552: 0x126, 0x553: 0x127, 0x554: 0x128, 0x555: 0x129, 0x556: 0x12a, 0x557: 0x12b, + 0x558: 0x12c, 0x559: 0x12d, 0x55a: 0x12e, 0x55b: 0x12f, 0x55c: 0x130, 0x55d: 0x131, 0x55e: 0x132, 0x55f: 0x133, + 0x568: 0x134, 0x569: 0x135, 0x56a: 0x136, + 0x57c: 0x137, + // Block 0x16, offset 0x580 + 0x580: 0x138, 0x581: 0x139, 0x582: 0x13a, 0x584: 0x13b, 0x585: 0x13c, + 0x58a: 0x13d, 0x58b: 0x13e, + 0x593: 0x13f, + 0x59f: 0x140, + 0x5a0: 0x26, 0x5a1: 0x26, 0x5a2: 0x26, 0x5a3: 0x141, 0x5a4: 0x14, 0x5a5: 0x142, + 0x5b8: 0x143, 0x5b9: 0x15, 0x5ba: 0x144, + // Block 0x17, offset 0x5c0 + 0x5c4: 0x145, 0x5c5: 0x146, 0x5c6: 0x147, + 0x5cf: 0x148, + 0x5ef: 0x149, + // Block 0x18, offset 0x600 + 0x610: 0x0a, 0x611: 0x0b, 0x612: 0x0c, 0x613: 0x0d, 0x614: 0x0e, 0x616: 0x0f, + 0x61a: 0x10, 0x61b: 0x11, 0x61c: 0x12, 0x61d: 0x13, 0x61e: 0x14, 0x61f: 0x15, + // Block 0x19, offset 0x640 + 0x640: 0x14a, 0x641: 0x14b, 0x644: 0x14b, 0x645: 0x14b, 0x646: 0x14b, 0x647: 0x14c, + // Block 0x1a, offset 0x680 + 0x6a0: 0x17, +} + +// sparseOffsets: 312 entries, 624 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xaf, 0xb7, 0xbd, 0xcb, 0xd6, 0xe3, 0xee, 0xfa, 0x104, 0x110, 0x11b, 0x127, 0x133, 0x13b, 0x145, 0x150, 0x15b, 0x167, 0x16d, 0x178, 0x17e, 0x186, 0x189, 0x18e, 0x192, 0x196, 0x19d, 0x1a6, 0x1ae, 0x1af, 0x1b8, 0x1bf, 0x1c7, 0x1cd, 0x1d2, 0x1d6, 0x1d9, 0x1db, 0x1de, 0x1e3, 0x1e4, 0x1e6, 0x1e8, 0x1ea, 0x1f1, 0x1f6, 0x1fa, 0x203, 0x206, 0x209, 0x20f, 0x210, 0x21b, 0x21c, 0x21d, 0x222, 0x22f, 0x238, 0x23e, 0x246, 0x24f, 0x258, 0x261, 0x266, 0x269, 0x274, 0x282, 0x284, 0x28b, 0x28f, 0x29b, 0x29c, 0x2a7, 0x2af, 0x2b7, 0x2bd, 0x2be, 0x2cc, 0x2d1, 0x2d4, 0x2d9, 0x2dd, 0x2e3, 0x2e8, 0x2eb, 0x2f0, 0x2f5, 0x2f6, 0x2fc, 0x2fe, 0x2ff, 0x301, 0x303, 0x306, 0x307, 0x309, 0x30c, 0x312, 0x316, 0x318, 0x31d, 0x324, 0x334, 0x33e, 0x33f, 0x348, 0x34c, 0x351, 0x359, 0x35f, 0x365, 0x36f, 0x374, 0x37d, 0x383, 0x38c, 0x390, 0x398, 0x39a, 0x39c, 0x39f, 0x3a1, 0x3a3, 0x3a4, 0x3a5, 0x3a7, 0x3a9, 0x3af, 0x3b4, 0x3b6, 0x3bd, 0x3c0, 0x3c2, 0x3c8, 0x3cd, 0x3cf, 0x3d0, 0x3d1, 0x3d2, 0x3d4, 0x3d6, 0x3d8, 0x3db, 0x3dd, 0x3e0, 0x3e8, 0x3eb, 0x3ef, 0x3f7, 0x3f9, 0x409, 0x40a, 0x40c, 0x411, 0x417, 0x419, 0x41a, 0x41c, 0x41e, 0x420, 0x42d, 0x42e, 0x42f, 0x433, 0x435, 0x436, 0x437, 0x438, 0x439, 0x43c, 0x43f, 0x440, 0x443, 0x44a, 0x450, 0x452, 0x456, 0x45e, 0x464, 0x468, 0x46f, 0x473, 0x477, 0x480, 0x48a, 0x48c, 0x492, 0x498, 0x4a2, 0x4ac, 0x4ae, 0x4b7, 0x4bd, 0x4c3, 0x4c9, 0x4cc, 0x4d2, 0x4d5, 0x4de, 0x4df, 0x4e6, 0x4ea, 0x4eb, 0x4ee, 0x4f8, 0x4fb, 0x4fd, 0x504, 0x50c, 0x512, 0x519, 0x51a, 0x520, 0x523, 0x52b, 0x532, 0x53c, 0x544, 0x547, 0x54c, 0x550, 0x551, 0x552, 0x553, 0x554, 0x555, 0x557, 0x55a, 0x55b, 0x55e, 0x55f, 0x562, 0x564, 0x568, 0x569, 0x56b, 0x56e, 0x570, 0x573, 0x576, 0x578, 0x57d, 0x57f, 0x580, 0x585, 0x589, 0x58a, 0x58d, 0x591, 0x59c, 0x5a0, 0x5a8, 0x5ad, 0x5b1, 0x5b4, 0x5b8, 0x5bb, 0x5be, 0x5c3, 0x5c7, 0x5cb, 0x5cf, 0x5d3, 0x5d5, 0x5d7, 0x5da, 0x5de, 0x5e4, 0x5e5, 0x5e6, 0x5e9, 0x5eb, 0x5ed, 0x5f0, 0x5f5, 0x5f9, 0x5fb, 0x601, 0x60a, 0x60f, 0x610, 0x613, 0x614, 0x615, 0x616, 0x618, 0x619, 0x61a} + +// sparseValues: 1562 entries, 6248 bytes +var sparseValues = [1562]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x18, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0004, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0024, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x19, offset 0xb7 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1a, offset 0xbd + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1b, offset 0xcb + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1d, offset 0xe3 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1e, offset 0xee + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x1f, offset 0xfa + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x20, offset 0x104 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x21, offset 0x110 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x22, offset 0x11b + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x23, offset 0x127 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x24, offset 0x133 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x150 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x28, offset 0x15b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9d, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb3}, + // Block 0x29, offset 0x167 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2a, offset 0x16d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2d, offset 0x186 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2e, offset 0x189 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x2f, offset 0x18e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x30, offset 0x192 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x196 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x33, offset 0x1a6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x34, offset 0x1ae + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x35, offset 0x1af + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x36, offset 0x1b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x37, offset 0x1bf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3a, offset 0x1d2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3b, offset 0x1d6 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3d, offset 0x1db + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3e, offset 0x1de + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x3f, offset 0x1e3 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x40, offset 0x1e4 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x41, offset 0x1e6 + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x42, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x43, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0030, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x9f, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0030, lo: 0xb4, hi: 0xb4}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x45, offset 0x1f6 + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x46, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x47, offset 0x203 + {value: 0x0014, lo: 0x8b, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x48, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x49, offset 0x209 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4b, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4c, offset 0x21b + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4d, offset 0x21c + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4e, offset 0x21d + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x4f, offset 0x222 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x50, offset 0x22f + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x238 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0024, lo: 0x81, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8e}, + // Block 0x52, offset 0x23e + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x246 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24f + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x258 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x261 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x269 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x274 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x282 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x284 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28b + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29c + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a7 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2af + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bd + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2be + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cc + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d1 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d4 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d9 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dd + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e3 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e8 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2eb + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2f0 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f5 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f6 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fc + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fe + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2ff + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x306 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x307 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30c + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x312 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x316 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x318 + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x324 + {value: 0x0117, lo: 0x80, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0117, lo: 0x90, hi: 0x91}, + {value: 0x0012, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x95, hi: 0x95}, + {value: 0x0117, lo: 0x96, hi: 0x99}, + {value: 0x0015, lo: 0xb2, hi: 0xb4}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x7f, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x33f + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x34c + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x351 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x359 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x35f + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x365 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x36f + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x374 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x37d + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x383 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0015, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x38c + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x39a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x3a1 + {value: 0x0004, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x3a3 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x3a4 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x3a5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x3a7 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x3a9 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3af + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3b6 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3bd + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3c0 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3c2 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3d1 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3d2 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3db + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3e0 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3e8 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3ef + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0xbc53, lo: 0xb0, hi: 0xb0}, + {value: 0xbf53, lo: 0xb1, hi: 0xb1}, + {value: 0xc253, lo: 0xb2, hi: 0xb2}, + {value: 0xbf53, lo: 0xb3, hi: 0xb3}, + {value: 0xc553, lo: 0xb4, hi: 0xb4}, + {value: 0xbf53, lo: 0xb5, hi: 0xb5}, + {value: 0xc253, lo: 0xb6, hi: 0xb6}, + {value: 0xbf53, lo: 0xb7, hi: 0xb7}, + {value: 0xbc53, lo: 0xb8, hi: 0xb8}, + {value: 0xc853, lo: 0xb9, hi: 0xb9}, + {value: 0xcb53, lo: 0xba, hi: 0xba}, + {value: 0xce53, lo: 0xbc, hi: 0xbc}, + {value: 0xc853, lo: 0xbd, hi: 0xbd}, + {value: 0xcb53, lo: 0xbe, hi: 0xbe}, + {value: 0xc853, lo: 0xbf, hi: 0xbf}, + // Block 0xae, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x40a + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x40c + {value: 0x0015, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0015, lo: 0x83, hi: 0x85}, + {value: 0x0015, lo: 0x87, hi: 0xb0}, + {value: 0x0015, lo: 0xb2, hi: 0xba}, + // Block 0xb1, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x41a + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x420 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x42d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x42e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x42f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x433 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x435 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x436 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x437 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x438 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x439 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x43c + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x43f + {value: 0x0034, lo: 0xbd, hi: 0xbf}, + // Block 0xc3, offset 0x440 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc4, offset 0x443 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc6, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc7, offset 0x452 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc8, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x45e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xca, offset 0x464 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcb, offset 0x468 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcc, offset 0x46f + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcd, offset 0x473 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xce, offset 0x477 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcf, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xd0, offset 0x48a + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + // Block 0xd1, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd2, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd3, offset 0x498 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd4, offset 0x4a2 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd5, offset 0x4ac + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd6, offset 0x4ae + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd7, offset 0x4b7 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4bd + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd9, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4c9 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xdb, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x4d2 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdd, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xde, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdf, offset 0x4df + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xe0, offset 0x4e6 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xe1, offset 0x4ea + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe2, offset 0x4eb + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe4, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe5, offset 0x4fb + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4fd + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe7, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe8, offset 0x50c + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe9, offset 0x512 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xea, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xeb, offset 0x51a + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xec, offset 0x520 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xed, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xee, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xef, offset 0x532 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xf0, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x544 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf2, offset 0x547 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xf3, offset 0x54c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0030, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xf4, offset 0x550 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf5, offset 0x551 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf6, offset 0x552 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf7, offset 0x553 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf8, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0xb0}, + // Block 0xf9, offset 0x555 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x557 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x95}, + // Block 0xfb, offset 0x55a + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xfc, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xfd, offset 0x55e + {value: 0x0010, lo: 0x80, hi: 0xbe}, + // Block 0xfe, offset 0x55f + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xff, offset 0x562 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0x100, offset 0x564 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x568 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0x102, offset 0x569 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0x103, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x104, offset 0x56e + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0x105, offset 0x570 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0x106, offset 0x573 + {value: 0x0004, lo: 0xb0, hi: 0xb3}, + {value: 0x0004, lo: 0xb5, hi: 0xbb}, + {value: 0x0004, lo: 0xbd, hi: 0xbe}, + // Block 0x107, offset 0x576 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x108, offset 0x578 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x109, offset 0x57d + {value: 0x0014, lo: 0x80, hi: 0xad}, + {value: 0x0014, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x57f + {value: 0x0014, lo: 0x80, hi: 0x86}, + // Block 0x10b, offset 0x580 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x585 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x10d, offset 0x589 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x10e, offset 0x58a + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x10f, offset 0x58d + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x110, offset 0x591 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x111, offset 0x59c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x112, offset 0x5a0 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x113, offset 0x5a8 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x114, offset 0x5ad + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x115, offset 0x5b1 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x116, offset 0x5b4 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x117, offset 0x5b8 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x118, offset 0x5bb + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x119, offset 0x5be + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x11a, offset 0x5c3 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x11b, offset 0x5c7 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x11c, offset 0x5cb + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x11d, offset 0x5cf + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x11e, offset 0x5d3 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11f, offset 0x5d5 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x120, offset 0x5d7 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x121, offset 0x5da + {value: 0x0012, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8a, hi: 0x8a}, + {value: 0x0012, lo: 0x8b, hi: 0x9e}, + {value: 0x0012, lo: 0xa5, hi: 0xaa}, + // Block 0x122, offset 0x5de + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + {value: 0x0015, lo: 0xb0, hi: 0xbf}, + // Block 0x123, offset 0x5e4 + {value: 0x0015, lo: 0x80, hi: 0xad}, + // Block 0x124, offset 0x5e5 + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + // Block 0x125, offset 0x5e6 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x126, offset 0x5e9 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x127, offset 0x5eb + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xae}, + // Block 0x128, offset 0x5ed + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x129, offset 0x5f0 + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x12a, offset 0x5f5 + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xab}, + {value: 0x0010, lo: 0xad, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xbe}, + // Block 0x12b, offset 0x5f9 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x12c, offset 0x5fb + {value: 0xd152, lo: 0x80, hi: 0x81}, + {value: 0xd452, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x12d, offset 0x601 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x12e, offset 0x60a + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x12f, offset 0x60f + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x130, offset 0x610 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x131, offset 0x613 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x132, offset 0x614 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x133, offset 0x615 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x134, offset 0x616 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x135, offset 0x618 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x136, offset 0x619 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 16093 bytes (15KiB); checksum: EE91C452 diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de59..a09ed198a 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b58378..14167e74e 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f4947..1153baf29 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b69..a6573dcb2 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/secure/precis/tables13.0.0.go b/vendor/golang.org/x/text/secure/precis/tables13.0.0.go index aad68b35e..7bc1a1629 100644 --- a/vendor/golang.org/x/text/secure/precis/tables13.0.0.go +++ b/vendor/golang.org/x/text/secure/precis/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package precis diff --git a/vendor/golang.org/x/text/secure/precis/tables15.0.0.go b/vendor/golang.org/x/text/secure/precis/tables15.0.0.go new file mode 100644 index 000000000..48c322777 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/tables15.0.0.go @@ -0,0 +1,4316 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package precis + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *derivedPropertiesTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return derivedPropertiesValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = derivedPropertiesIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *derivedPropertiesTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return derivedPropertiesValues[c0] + } + i := derivedPropertiesIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *derivedPropertiesTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return derivedPropertiesValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = derivedPropertiesIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *derivedPropertiesTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return derivedPropertiesValues[c0] + } + i := derivedPropertiesIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// derivedPropertiesTrie. Total size: 28992 bytes (28.31 KiB). Checksum: 6ba05cbedd26c252. +type derivedPropertiesTrie struct{} + +func newDerivedPropertiesTrie(i int) *derivedPropertiesTrie { + return &derivedPropertiesTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *derivedPropertiesTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(derivedPropertiesValues[n<<6+uint32(b)]) + } +} + +// derivedPropertiesValues: 373 blocks, 23872 entries, 23872 bytes +// The third block is the zero block. +var derivedPropertiesValues = [23872]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x0040, 0x01: 0x0040, 0x02: 0x0040, 0x03: 0x0040, 0x04: 0x0040, 0x05: 0x0040, + 0x06: 0x0040, 0x07: 0x0040, 0x08: 0x0040, 0x09: 0x0040, 0x0a: 0x0040, 0x0b: 0x0040, + 0x0c: 0x0040, 0x0d: 0x0040, 0x0e: 0x0040, 0x0f: 0x0040, 0x10: 0x0040, 0x11: 0x0040, + 0x12: 0x0040, 0x13: 0x0040, 0x14: 0x0040, 0x15: 0x0040, 0x16: 0x0040, 0x17: 0x0040, + 0x18: 0x0040, 0x19: 0x0040, 0x1a: 0x0040, 0x1b: 0x0040, 0x1c: 0x0040, 0x1d: 0x0040, + 0x1e: 0x0040, 0x1f: 0x0040, 0x20: 0x0080, 0x21: 0x00c0, 0x22: 0x00c0, 0x23: 0x00c0, + 0x24: 0x00c0, 0x25: 0x00c0, 0x26: 0x00c0, 0x27: 0x00c0, 0x28: 0x00c0, 0x29: 0x00c0, + 0x2a: 0x00c0, 0x2b: 0x00c0, 0x2c: 0x00c0, 0x2d: 0x00c0, 0x2e: 0x00c0, 0x2f: 0x00c0, + 0x30: 0x00c0, 0x31: 0x00c0, 0x32: 0x00c0, 0x33: 0x00c0, 0x34: 0x00c0, 0x35: 0x00c0, + 0x36: 0x00c0, 0x37: 0x00c0, 0x38: 0x00c0, 0x39: 0x00c0, 0x3a: 0x00c0, 0x3b: 0x00c0, + 0x3c: 0x00c0, 0x3d: 0x00c0, 0x3e: 0x00c0, 0x3f: 0x00c0, + // Block 0x1, offset 0x40 + 0x40: 0x00c0, 0x41: 0x00c0, 0x42: 0x00c0, 0x43: 0x00c0, 0x44: 0x00c0, 0x45: 0x00c0, + 0x46: 0x00c0, 0x47: 0x00c0, 0x48: 0x00c0, 0x49: 0x00c0, 0x4a: 0x00c0, 0x4b: 0x00c0, + 0x4c: 0x00c0, 0x4d: 0x00c0, 0x4e: 0x00c0, 0x4f: 0x00c0, 0x50: 0x00c0, 0x51: 0x00c0, + 0x52: 0x00c0, 0x53: 0x00c0, 0x54: 0x00c0, 0x55: 0x00c0, 0x56: 0x00c0, 0x57: 0x00c0, + 0x58: 0x00c0, 0x59: 0x00c0, 0x5a: 0x00c0, 0x5b: 0x00c0, 0x5c: 0x00c0, 0x5d: 0x00c0, + 0x5e: 0x00c0, 0x5f: 0x00c0, 0x60: 0x00c0, 0x61: 0x00c0, 0x62: 0x00c0, 0x63: 0x00c0, + 0x64: 0x00c0, 0x65: 0x00c0, 0x66: 0x00c0, 0x67: 0x00c0, 0x68: 0x00c0, 0x69: 0x00c0, + 0x6a: 0x00c0, 0x6b: 0x00c0, 0x6c: 0x00c7, 0x6d: 0x00c0, 0x6e: 0x00c0, 0x6f: 0x00c0, + 0x70: 0x00c0, 0x71: 0x00c0, 0x72: 0x00c0, 0x73: 0x00c0, 0x74: 0x00c0, 0x75: 0x00c0, + 0x76: 0x00c0, 0x77: 0x00c0, 0x78: 0x00c0, 0x79: 0x00c0, 0x7a: 0x00c0, 0x7b: 0x00c0, + 0x7c: 0x00c0, 0x7d: 0x00c0, 0x7e: 0x00c0, 0x7f: 0x0040, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x0080, 0xe1: 0x0080, 0xe2: 0x0080, 0xe3: 0x0080, + 0xe4: 0x0080, 0xe5: 0x0080, 0xe6: 0x0080, 0xe7: 0x0080, 0xe8: 0x0080, 0xe9: 0x0080, + 0xea: 0x0080, 0xeb: 0x0080, 0xec: 0x0080, 0xed: 0x0040, 0xee: 0x0080, 0xef: 0x0080, + 0xf0: 0x0080, 0xf1: 0x0080, 0xf2: 0x0080, 0xf3: 0x0080, 0xf4: 0x0080, 0xf5: 0x0080, + 0xf6: 0x0080, 0xf7: 0x004f, 0xf8: 0x0080, 0xf9: 0x0080, 0xfa: 0x0080, 0xfb: 0x0080, + 0xfc: 0x0080, 0xfd: 0x0080, 0xfe: 0x0080, 0xff: 0x0080, + // Block 0x4, offset 0x100 + 0x100: 0x00c0, 0x101: 0x00c0, 0x102: 0x00c0, 0x103: 0x00c0, 0x104: 0x00c0, 0x105: 0x00c0, + 0x106: 0x00c0, 0x107: 0x00c0, 0x108: 0x00c0, 0x109: 0x00c0, 0x10a: 0x00c0, 0x10b: 0x00c0, + 0x10c: 0x00c0, 0x10d: 0x00c0, 0x10e: 0x00c0, 0x10f: 0x00c0, 0x110: 0x00c0, 0x111: 0x00c0, + 0x112: 0x00c0, 0x113: 0x00c0, 0x114: 0x00c0, 0x115: 0x00c0, 0x116: 0x00c0, 0x117: 0x0080, + 0x118: 0x00c0, 0x119: 0x00c0, 0x11a: 0x00c0, 0x11b: 0x00c0, 0x11c: 0x00c0, 0x11d: 0x00c0, + 0x11e: 0x00c0, 0x11f: 0x00c0, 0x120: 0x00c0, 0x121: 0x00c0, 0x122: 0x00c0, 0x123: 0x00c0, + 0x124: 0x00c0, 0x125: 0x00c0, 0x126: 0x00c0, 0x127: 0x00c0, 0x128: 0x00c0, 0x129: 0x00c0, + 0x12a: 0x00c0, 0x12b: 0x00c0, 0x12c: 0x00c0, 0x12d: 0x00c0, 0x12e: 0x00c0, 0x12f: 0x00c0, + 0x130: 0x00c0, 0x131: 0x00c0, 0x132: 0x00c0, 0x133: 0x00c0, 0x134: 0x00c0, 0x135: 0x00c0, + 0x136: 0x00c0, 0x137: 0x0080, 0x138: 0x00c0, 0x139: 0x00c0, 0x13a: 0x00c0, 0x13b: 0x00c0, + 0x13c: 0x00c0, 0x13d: 0x00c0, 0x13e: 0x00c0, 0x13f: 0x00c0, + // Block 0x5, offset 0x140 + 0x140: 0x00c0, 0x141: 0x00c0, 0x142: 0x00c0, 0x143: 0x00c0, 0x144: 0x00c0, 0x145: 0x00c0, + 0x146: 0x00c0, 0x147: 0x00c0, 0x148: 0x00c0, 0x149: 0x00c0, 0x14a: 0x00c0, 0x14b: 0x00c0, + 0x14c: 0x00c0, 0x14d: 0x00c0, 0x14e: 0x00c0, 0x14f: 0x00c0, 0x150: 0x00c0, 0x151: 0x00c0, + 0x152: 0x00c0, 0x153: 0x00c0, 0x154: 0x00c0, 0x155: 0x00c0, 0x156: 0x00c0, 0x157: 0x00c0, + 0x158: 0x00c0, 0x159: 0x00c0, 0x15a: 0x00c0, 0x15b: 0x00c0, 0x15c: 0x00c0, 0x15d: 0x00c0, + 0x15e: 0x00c0, 0x15f: 0x00c0, 0x160: 0x00c0, 0x161: 0x00c0, 0x162: 0x00c0, 0x163: 0x00c0, + 0x164: 0x00c0, 0x165: 0x00c0, 0x166: 0x00c0, 0x167: 0x00c0, 0x168: 0x00c0, 0x169: 0x00c0, + 0x16a: 0x00c0, 0x16b: 0x00c0, 0x16c: 0x00c0, 0x16d: 0x00c0, 0x16e: 0x00c0, 0x16f: 0x00c0, + 0x170: 0x00c0, 0x171: 0x00c0, 0x172: 0x0080, 0x173: 0x0080, 0x174: 0x00c0, 0x175: 0x00c0, + 0x176: 0x00c0, 0x177: 0x00c0, 0x178: 0x00c0, 0x179: 0x00c0, 0x17a: 0x00c0, 0x17b: 0x00c0, + 0x17c: 0x00c0, 0x17d: 0x00c0, 0x17e: 0x00c0, 0x17f: 0x0080, + // Block 0x6, offset 0x180 + 0x180: 0x0080, 0x181: 0x00c0, 0x182: 0x00c0, 0x183: 0x00c0, 0x184: 0x00c0, 0x185: 0x00c0, + 0x186: 0x00c0, 0x187: 0x00c0, 0x188: 0x00c0, 0x189: 0x0080, 0x18a: 0x00c0, 0x18b: 0x00c0, + 0x18c: 0x00c0, 0x18d: 0x00c0, 0x18e: 0x00c0, 0x18f: 0x00c0, 0x190: 0x00c0, 0x191: 0x00c0, + 0x192: 0x00c0, 0x193: 0x00c0, 0x194: 0x00c0, 0x195: 0x00c0, 0x196: 0x00c0, 0x197: 0x00c0, + 0x198: 0x00c0, 0x199: 0x00c0, 0x19a: 0x00c0, 0x19b: 0x00c0, 0x19c: 0x00c0, 0x19d: 0x00c0, + 0x19e: 0x00c0, 0x19f: 0x00c0, 0x1a0: 0x00c0, 0x1a1: 0x00c0, 0x1a2: 0x00c0, 0x1a3: 0x00c0, + 0x1a4: 0x00c0, 0x1a5: 0x00c0, 0x1a6: 0x00c0, 0x1a7: 0x00c0, 0x1a8: 0x00c0, 0x1a9: 0x00c0, + 0x1aa: 0x00c0, 0x1ab: 0x00c0, 0x1ac: 0x00c0, 0x1ad: 0x00c0, 0x1ae: 0x00c0, 0x1af: 0x00c0, + 0x1b0: 0x00c0, 0x1b1: 0x00c0, 0x1b2: 0x00c0, 0x1b3: 0x00c0, 0x1b4: 0x00c0, 0x1b5: 0x00c0, + 0x1b6: 0x00c0, 0x1b7: 0x00c0, 0x1b8: 0x00c0, 0x1b9: 0x00c0, 0x1ba: 0x00c0, 0x1bb: 0x00c0, + 0x1bc: 0x00c0, 0x1bd: 0x00c0, 0x1be: 0x00c0, 0x1bf: 0x0080, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x00c0, 0x1c1: 0x00c0, 0x1c2: 0x00c0, 0x1c3: 0x00c0, 0x1c4: 0x00c0, 0x1c5: 0x00c0, + 0x1c6: 0x00c0, 0x1c7: 0x00c0, 0x1c8: 0x00c0, 0x1c9: 0x00c0, 0x1ca: 0x00c0, 0x1cb: 0x00c0, + 0x1cc: 0x00c0, 0x1cd: 0x00c0, 0x1ce: 0x00c0, 0x1cf: 0x00c0, 0x1d0: 0x00c0, 0x1d1: 0x00c0, + 0x1d2: 0x00c0, 0x1d3: 0x00c0, 0x1d4: 0x00c0, 0x1d5: 0x00c0, 0x1d6: 0x00c0, 0x1d7: 0x00c0, + 0x1d8: 0x00c0, 0x1d9: 0x00c0, 0x1da: 0x00c0, 0x1db: 0x00c0, 0x1dc: 0x00c0, 0x1dd: 0x00c0, + 0x1de: 0x00c0, 0x1df: 0x00c0, 0x1e0: 0x00c0, 0x1e1: 0x00c0, 0x1e2: 0x00c0, 0x1e3: 0x00c0, + 0x1e4: 0x00c0, 0x1e5: 0x00c0, 0x1e6: 0x00c0, 0x1e7: 0x00c0, 0x1e8: 0x00c0, 0x1e9: 0x00c0, + 0x1ea: 0x00c0, 0x1eb: 0x00c0, 0x1ec: 0x00c0, 0x1ed: 0x00c0, 0x1ee: 0x00c0, 0x1ef: 0x00c0, + 0x1f0: 0x00c0, 0x1f1: 0x00c0, 0x1f2: 0x00c0, 0x1f3: 0x00c0, 0x1f4: 0x00c0, 0x1f5: 0x00c0, + 0x1f6: 0x00c0, 0x1f7: 0x00c0, 0x1f8: 0x00c0, 0x1f9: 0x00c0, 0x1fa: 0x00c0, 0x1fb: 0x00c0, + 0x1fc: 0x00c0, 0x1fd: 0x00c0, 0x1fe: 0x00c0, 0x1ff: 0x00c0, + // Block 0x8, offset 0x200 + 0x200: 0x00c0, 0x201: 0x00c0, 0x202: 0x00c0, 0x203: 0x00c0, 0x204: 0x0080, 0x205: 0x0080, + 0x206: 0x0080, 0x207: 0x0080, 0x208: 0x0080, 0x209: 0x0080, 0x20a: 0x0080, 0x20b: 0x0080, + 0x20c: 0x0080, 0x20d: 0x00c0, 0x20e: 0x00c0, 0x20f: 0x00c0, 0x210: 0x00c0, 0x211: 0x00c0, + 0x212: 0x00c0, 0x213: 0x00c0, 0x214: 0x00c0, 0x215: 0x00c0, 0x216: 0x00c0, 0x217: 0x00c0, + 0x218: 0x00c0, 0x219: 0x00c0, 0x21a: 0x00c0, 0x21b: 0x00c0, 0x21c: 0x00c0, 0x21d: 0x00c0, + 0x21e: 0x00c0, 0x21f: 0x00c0, 0x220: 0x00c0, 0x221: 0x00c0, 0x222: 0x00c0, 0x223: 0x00c0, + 0x224: 0x00c0, 0x225: 0x00c0, 0x226: 0x00c0, 0x227: 0x00c0, 0x228: 0x00c0, 0x229: 0x00c0, + 0x22a: 0x00c0, 0x22b: 0x00c0, 0x22c: 0x00c0, 0x22d: 0x00c0, 0x22e: 0x00c0, 0x22f: 0x00c0, + 0x230: 0x00c0, 0x231: 0x0080, 0x232: 0x0080, 0x233: 0x0080, 0x234: 0x00c0, 0x235: 0x00c0, + 0x236: 0x00c0, 0x237: 0x00c0, 0x238: 0x00c0, 0x239: 0x00c0, 0x23a: 0x00c0, 0x23b: 0x00c0, + 0x23c: 0x00c0, 0x23d: 0x00c0, 0x23e: 0x00c0, 0x23f: 0x00c0, + // Block 0x9, offset 0x240 + 0x240: 0x00c0, 0x241: 0x00c0, 0x242: 0x00c0, 0x243: 0x00c0, 0x244: 0x00c0, 0x245: 0x00c0, + 0x246: 0x00c0, 0x247: 0x00c0, 0x248: 0x00c0, 0x249: 0x00c0, 0x24a: 0x00c0, 0x24b: 0x00c0, + 0x24c: 0x00c0, 0x24d: 0x00c0, 0x24e: 0x00c0, 0x24f: 0x00c0, 0x250: 0x00c0, 0x251: 0x00c0, + 0x252: 0x00c0, 0x253: 0x00c0, 0x254: 0x00c0, 0x255: 0x00c0, 0x256: 0x00c0, 0x257: 0x00c0, + 0x258: 0x00c0, 0x259: 0x00c0, 0x25a: 0x00c0, 0x25b: 0x00c0, 0x25c: 0x00c0, 0x25d: 0x00c0, + 0x25e: 0x00c0, 0x25f: 0x00c0, 0x260: 0x00c0, 0x261: 0x00c0, 0x262: 0x00c0, 0x263: 0x00c0, + 0x264: 0x00c0, 0x265: 0x00c0, 0x266: 0x00c0, 0x267: 0x00c0, 0x268: 0x00c0, 0x269: 0x00c0, + 0x26a: 0x00c0, 0x26b: 0x00c0, 0x26c: 0x00c0, 0x26d: 0x00c0, 0x26e: 0x00c0, 0x26f: 0x00c0, + 0x270: 0x0080, 0x271: 0x0080, 0x272: 0x0080, 0x273: 0x0080, 0x274: 0x0080, 0x275: 0x0080, + 0x276: 0x0080, 0x277: 0x0080, 0x278: 0x0080, 0x279: 0x00c0, 0x27a: 0x00c0, 0x27b: 0x00c0, + 0x27c: 0x00c0, 0x27d: 0x00c0, 0x27e: 0x00c0, 0x27f: 0x00c0, + // Block 0xa, offset 0x280 + 0x280: 0x00c0, 0x281: 0x00c0, 0x282: 0x0080, 0x283: 0x0080, 0x284: 0x0080, 0x285: 0x0080, + 0x286: 0x00c0, 0x287: 0x00c0, 0x288: 0x00c0, 0x289: 0x00c0, 0x28a: 0x00c0, 0x28b: 0x00c0, + 0x28c: 0x00c0, 0x28d: 0x00c0, 0x28e: 0x00c0, 0x28f: 0x00c0, 0x290: 0x00c0, 0x291: 0x00c0, + 0x292: 0x0080, 0x293: 0x0080, 0x294: 0x0080, 0x295: 0x0080, 0x296: 0x0080, 0x297: 0x0080, + 0x298: 0x0080, 0x299: 0x0080, 0x29a: 0x0080, 0x29b: 0x0080, 0x29c: 0x0080, 0x29d: 0x0080, + 0x29e: 0x0080, 0x29f: 0x0080, 0x2a0: 0x0080, 0x2a1: 0x0080, 0x2a2: 0x0080, 0x2a3: 0x0080, + 0x2a4: 0x0080, 0x2a5: 0x0080, 0x2a6: 0x0080, 0x2a7: 0x0080, 0x2a8: 0x0080, 0x2a9: 0x0080, + 0x2aa: 0x0080, 0x2ab: 0x0080, 0x2ac: 0x00c0, 0x2ad: 0x0080, 0x2ae: 0x00c0, 0x2af: 0x0080, + 0x2b0: 0x0080, 0x2b1: 0x0080, 0x2b2: 0x0080, 0x2b3: 0x0080, 0x2b4: 0x0080, 0x2b5: 0x0080, + 0x2b6: 0x0080, 0x2b7: 0x0080, 0x2b8: 0x0080, 0x2b9: 0x0080, 0x2ba: 0x0080, 0x2bb: 0x0080, + 0x2bc: 0x0080, 0x2bd: 0x0080, 0x2be: 0x0080, 0x2bf: 0x0080, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x00c3, 0x2c1: 0x00c3, 0x2c2: 0x00c3, 0x2c3: 0x00c3, 0x2c4: 0x00c3, 0x2c5: 0x00c3, + 0x2c6: 0x00c3, 0x2c7: 0x00c3, 0x2c8: 0x00c3, 0x2c9: 0x00c3, 0x2ca: 0x00c3, 0x2cb: 0x00c3, + 0x2cc: 0x00c3, 0x2cd: 0x00c3, 0x2ce: 0x00c3, 0x2cf: 0x00c3, 0x2d0: 0x00c3, 0x2d1: 0x00c3, + 0x2d2: 0x00c3, 0x2d3: 0x00c3, 0x2d4: 0x00c3, 0x2d5: 0x00c3, 0x2d6: 0x00c3, 0x2d7: 0x00c3, + 0x2d8: 0x00c3, 0x2d9: 0x00c3, 0x2da: 0x00c3, 0x2db: 0x00c3, 0x2dc: 0x00c3, 0x2dd: 0x00c3, + 0x2de: 0x00c3, 0x2df: 0x00c3, 0x2e0: 0x00c3, 0x2e1: 0x00c3, 0x2e2: 0x00c3, 0x2e3: 0x00c3, + 0x2e4: 0x00c3, 0x2e5: 0x00c3, 0x2e6: 0x00c3, 0x2e7: 0x00c3, 0x2e8: 0x00c3, 0x2e9: 0x00c3, + 0x2ea: 0x00c3, 0x2eb: 0x00c3, 0x2ec: 0x00c3, 0x2ed: 0x00c3, 0x2ee: 0x00c3, 0x2ef: 0x00c3, + 0x2f0: 0x00c3, 0x2f1: 0x00c3, 0x2f2: 0x00c3, 0x2f3: 0x00c3, 0x2f4: 0x00c3, 0x2f5: 0x00c3, + 0x2f6: 0x00c3, 0x2f7: 0x00c3, 0x2f8: 0x00c3, 0x2f9: 0x00c3, 0x2fa: 0x00c3, 0x2fb: 0x00c3, + 0x2fc: 0x00c3, 0x2fd: 0x00c3, 0x2fe: 0x00c3, 0x2ff: 0x00c3, + // Block 0xc, offset 0x300 + 0x300: 0x0083, 0x301: 0x0083, 0x302: 0x00c3, 0x303: 0x0083, 0x304: 0x0083, 0x305: 0x00c3, + 0x306: 0x00c3, 0x307: 0x00c3, 0x308: 0x00c3, 0x309: 0x00c3, 0x30a: 0x00c3, 0x30b: 0x00c3, + 0x30c: 0x00c3, 0x30d: 0x00c3, 0x30e: 0x00c3, 0x30f: 0x0040, 0x310: 0x00c3, 0x311: 0x00c3, + 0x312: 0x00c3, 0x313: 0x00c3, 0x314: 0x00c3, 0x315: 0x00c3, 0x316: 0x00c3, 0x317: 0x00c3, + 0x318: 0x00c3, 0x319: 0x00c3, 0x31a: 0x00c3, 0x31b: 0x00c3, 0x31c: 0x00c3, 0x31d: 0x00c3, + 0x31e: 0x00c3, 0x31f: 0x00c3, 0x320: 0x00c3, 0x321: 0x00c3, 0x322: 0x00c3, 0x323: 0x00c3, + 0x324: 0x00c3, 0x325: 0x00c3, 0x326: 0x00c3, 0x327: 0x00c3, 0x328: 0x00c3, 0x329: 0x00c3, + 0x32a: 0x00c3, 0x32b: 0x00c3, 0x32c: 0x00c3, 0x32d: 0x00c3, 0x32e: 0x00c3, 0x32f: 0x00c3, + 0x330: 0x00c8, 0x331: 0x00c8, 0x332: 0x00c8, 0x333: 0x00c8, 0x334: 0x0080, 0x335: 0x0050, + 0x336: 0x00c8, 0x337: 0x00c8, 0x33a: 0x0088, 0x33b: 0x00c8, + 0x33c: 0x00c8, 0x33d: 0x00c8, 0x33e: 0x0080, 0x33f: 0x00c8, + // Block 0xd, offset 0x340 + 0x344: 0x0088, 0x345: 0x0080, + 0x346: 0x00c8, 0x347: 0x0080, 0x348: 0x00c8, 0x349: 0x00c8, 0x34a: 0x00c8, + 0x34c: 0x00c8, 0x34e: 0x00c8, 0x34f: 0x00c8, 0x350: 0x00c8, 0x351: 0x00c8, + 0x352: 0x00c8, 0x353: 0x00c8, 0x354: 0x00c8, 0x355: 0x00c8, 0x356: 0x00c8, 0x357: 0x00c8, + 0x358: 0x00c8, 0x359: 0x00c8, 0x35a: 0x00c8, 0x35b: 0x00c8, 0x35c: 0x00c8, 0x35d: 0x00c8, + 0x35e: 0x00c8, 0x35f: 0x00c8, 0x360: 0x00c8, 0x361: 0x00c8, 0x363: 0x00c8, + 0x364: 0x00c8, 0x365: 0x00c8, 0x366: 0x00c8, 0x367: 0x00c8, 0x368: 0x00c8, 0x369: 0x00c8, + 0x36a: 0x00c8, 0x36b: 0x00c8, 0x36c: 0x00c8, 0x36d: 0x00c8, 0x36e: 0x00c8, 0x36f: 0x00c8, + 0x370: 0x00c8, 0x371: 0x00c8, 0x372: 0x00c8, 0x373: 0x00c8, 0x374: 0x00c8, 0x375: 0x00c8, + 0x376: 0x00c8, 0x377: 0x00c8, 0x378: 0x00c8, 0x379: 0x00c8, 0x37a: 0x00c8, 0x37b: 0x00c8, + 0x37c: 0x00c8, 0x37d: 0x00c8, 0x37e: 0x00c8, 0x37f: 0x00c8, + // Block 0xe, offset 0x380 + 0x380: 0x00c8, 0x381: 0x00c8, 0x382: 0x00c8, 0x383: 0x00c8, 0x384: 0x00c8, 0x385: 0x00c8, + 0x386: 0x00c8, 0x387: 0x00c8, 0x388: 0x00c8, 0x389: 0x00c8, 0x38a: 0x00c8, 0x38b: 0x00c8, + 0x38c: 0x00c8, 0x38d: 0x00c8, 0x38e: 0x00c8, 0x38f: 0x00c8, 0x390: 0x0088, 0x391: 0x0088, + 0x392: 0x0088, 0x393: 0x0088, 0x394: 0x0088, 0x395: 0x0088, 0x396: 0x0088, 0x397: 0x00c8, + 0x398: 0x00c8, 0x399: 0x00c8, 0x39a: 0x00c8, 0x39b: 0x00c8, 0x39c: 0x00c8, 0x39d: 0x00c8, + 0x39e: 0x00c8, 0x39f: 0x00c8, 0x3a0: 0x00c8, 0x3a1: 0x00c8, 0x3a2: 0x00c0, 0x3a3: 0x00c0, + 0x3a4: 0x00c0, 0x3a5: 0x00c0, 0x3a6: 0x00c0, 0x3a7: 0x00c0, 0x3a8: 0x00c0, 0x3a9: 0x00c0, + 0x3aa: 0x00c0, 0x3ab: 0x00c0, 0x3ac: 0x00c0, 0x3ad: 0x00c0, 0x3ae: 0x00c0, 0x3af: 0x00c0, + 0x3b0: 0x0088, 0x3b1: 0x0088, 0x3b2: 0x0088, 0x3b3: 0x00c8, 0x3b4: 0x0088, 0x3b5: 0x0088, + 0x3b6: 0x0088, 0x3b7: 0x00c8, 0x3b8: 0x00c8, 0x3b9: 0x0088, 0x3ba: 0x00c8, 0x3bb: 0x00c8, + 0x3bc: 0x00c8, 0x3bd: 0x00c8, 0x3be: 0x00c8, 0x3bf: 0x00c8, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x00c0, 0x3c1: 0x00c0, 0x3c2: 0x0080, 0x3c3: 0x00c3, 0x3c4: 0x00c3, 0x3c5: 0x00c3, + 0x3c6: 0x00c3, 0x3c7: 0x00c3, 0x3c8: 0x0083, 0x3c9: 0x0083, 0x3ca: 0x00c0, 0x3cb: 0x00c0, + 0x3cc: 0x00c0, 0x3cd: 0x00c0, 0x3ce: 0x00c0, 0x3cf: 0x00c0, 0x3d0: 0x00c0, 0x3d1: 0x00c0, + 0x3d2: 0x00c0, 0x3d3: 0x00c0, 0x3d4: 0x00c0, 0x3d5: 0x00c0, 0x3d6: 0x00c0, 0x3d7: 0x00c0, + 0x3d8: 0x00c0, 0x3d9: 0x00c0, 0x3da: 0x00c0, 0x3db: 0x00c0, 0x3dc: 0x00c0, 0x3dd: 0x00c0, + 0x3de: 0x00c0, 0x3df: 0x00c0, 0x3e0: 0x00c0, 0x3e1: 0x00c0, 0x3e2: 0x00c0, 0x3e3: 0x00c0, + 0x3e4: 0x00c0, 0x3e5: 0x00c0, 0x3e6: 0x00c0, 0x3e7: 0x00c0, 0x3e8: 0x00c0, 0x3e9: 0x00c0, + 0x3ea: 0x00c0, 0x3eb: 0x00c0, 0x3ec: 0x00c0, 0x3ed: 0x00c0, 0x3ee: 0x00c0, 0x3ef: 0x00c0, + 0x3f0: 0x00c0, 0x3f1: 0x00c0, 0x3f2: 0x00c0, 0x3f3: 0x00c0, 0x3f4: 0x00c0, 0x3f5: 0x00c0, + 0x3f6: 0x00c0, 0x3f7: 0x00c0, 0x3f8: 0x00c0, 0x3f9: 0x00c0, 0x3fa: 0x00c0, 0x3fb: 0x00c0, + 0x3fc: 0x00c0, 0x3fd: 0x00c0, 0x3fe: 0x00c0, 0x3ff: 0x00c0, + // Block 0x10, offset 0x400 + 0x400: 0x00c0, 0x401: 0x00c0, 0x402: 0x00c0, 0x403: 0x00c0, 0x404: 0x00c0, 0x405: 0x00c0, + 0x406: 0x00c0, 0x407: 0x00c0, 0x408: 0x00c0, 0x409: 0x00c0, 0x40a: 0x00c0, 0x40b: 0x00c0, + 0x40c: 0x00c0, 0x40d: 0x00c0, 0x40e: 0x00c0, 0x40f: 0x00c0, 0x410: 0x00c0, 0x411: 0x00c0, + 0x412: 0x00c0, 0x413: 0x00c0, 0x414: 0x00c0, 0x415: 0x00c0, 0x416: 0x00c0, 0x417: 0x00c0, + 0x418: 0x00c0, 0x419: 0x00c0, 0x41a: 0x00c0, 0x41b: 0x00c0, 0x41c: 0x00c0, 0x41d: 0x00c0, + 0x41e: 0x00c0, 0x41f: 0x00c0, 0x420: 0x00c0, 0x421: 0x00c0, 0x422: 0x00c0, 0x423: 0x00c0, + 0x424: 0x00c0, 0x425: 0x00c0, 0x426: 0x00c0, 0x427: 0x00c0, 0x428: 0x00c0, 0x429: 0x00c0, + 0x42a: 0x00c0, 0x42b: 0x00c0, 0x42c: 0x00c0, 0x42d: 0x00c0, 0x42e: 0x00c0, 0x42f: 0x00c0, + 0x431: 0x00c0, 0x432: 0x00c0, 0x433: 0x00c0, 0x434: 0x00c0, 0x435: 0x00c0, + 0x436: 0x00c0, 0x437: 0x00c0, 0x438: 0x00c0, 0x439: 0x00c0, 0x43a: 0x00c0, 0x43b: 0x00c0, + 0x43c: 0x00c0, 0x43d: 0x00c0, 0x43e: 0x00c0, 0x43f: 0x00c0, + // Block 0x11, offset 0x440 + 0x440: 0x00c0, 0x441: 0x00c0, 0x442: 0x00c0, 0x443: 0x00c0, 0x444: 0x00c0, 0x445: 0x00c0, + 0x446: 0x00c0, 0x447: 0x00c0, 0x448: 0x00c0, 0x449: 0x00c0, 0x44a: 0x00c0, 0x44b: 0x00c0, + 0x44c: 0x00c0, 0x44d: 0x00c0, 0x44e: 0x00c0, 0x44f: 0x00c0, 0x450: 0x00c0, 0x451: 0x00c0, + 0x452: 0x00c0, 0x453: 0x00c0, 0x454: 0x00c0, 0x455: 0x00c0, 0x456: 0x00c0, + 0x459: 0x00c0, 0x45a: 0x0080, 0x45b: 0x0080, 0x45c: 0x0080, 0x45d: 0x0080, + 0x45e: 0x0080, 0x45f: 0x0080, 0x460: 0x00c0, 0x461: 0x00c0, 0x462: 0x00c0, 0x463: 0x00c0, + 0x464: 0x00c0, 0x465: 0x00c0, 0x466: 0x00c0, 0x467: 0x00c0, 0x468: 0x00c0, 0x469: 0x00c0, + 0x46a: 0x00c0, 0x46b: 0x00c0, 0x46c: 0x00c0, 0x46d: 0x00c0, 0x46e: 0x00c0, 0x46f: 0x00c0, + 0x470: 0x00c0, 0x471: 0x00c0, 0x472: 0x00c0, 0x473: 0x00c0, 0x474: 0x00c0, 0x475: 0x00c0, + 0x476: 0x00c0, 0x477: 0x00c0, 0x478: 0x00c0, 0x479: 0x00c0, 0x47a: 0x00c0, 0x47b: 0x00c0, + 0x47c: 0x00c0, 0x47d: 0x00c0, 0x47e: 0x00c0, 0x47f: 0x00c0, + // Block 0x12, offset 0x480 + 0x480: 0x00c0, 0x481: 0x00c0, 0x482: 0x00c0, 0x483: 0x00c0, 0x484: 0x00c0, 0x485: 0x00c0, + 0x486: 0x00c0, 0x487: 0x0080, 0x488: 0x00c0, 0x489: 0x0080, 0x48a: 0x0080, + 0x48d: 0x0080, 0x48e: 0x0080, 0x48f: 0x0080, 0x491: 0x00cb, + 0x492: 0x00cb, 0x493: 0x00cb, 0x494: 0x00cb, 0x495: 0x00cb, 0x496: 0x00cb, 0x497: 0x00cb, + 0x498: 0x00cb, 0x499: 0x00cb, 0x49a: 0x00cb, 0x49b: 0x00cb, 0x49c: 0x00cb, 0x49d: 0x00cb, + 0x49e: 0x00cb, 0x49f: 0x00cb, 0x4a0: 0x00cb, 0x4a1: 0x00cb, 0x4a2: 0x00cb, 0x4a3: 0x00cb, + 0x4a4: 0x00cb, 0x4a5: 0x00cb, 0x4a6: 0x00cb, 0x4a7: 0x00cb, 0x4a8: 0x00cb, 0x4a9: 0x00cb, + 0x4aa: 0x00cb, 0x4ab: 0x00cb, 0x4ac: 0x00cb, 0x4ad: 0x00cb, 0x4ae: 0x00cb, 0x4af: 0x00cb, + 0x4b0: 0x00cb, 0x4b1: 0x00cb, 0x4b2: 0x00cb, 0x4b3: 0x00cb, 0x4b4: 0x00cb, 0x4b5: 0x00cb, + 0x4b6: 0x00cb, 0x4b7: 0x00cb, 0x4b8: 0x00cb, 0x4b9: 0x00cb, 0x4ba: 0x00cb, 0x4bb: 0x00cb, + 0x4bc: 0x00cb, 0x4bd: 0x00cb, 0x4be: 0x008a, 0x4bf: 0x00cb, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x008a, 0x4c1: 0x00cb, 0x4c2: 0x00cb, 0x4c3: 0x008a, 0x4c4: 0x00cb, 0x4c5: 0x00cb, + 0x4c6: 0x008a, 0x4c7: 0x00cb, + 0x4d0: 0x00ca, 0x4d1: 0x00ca, + 0x4d2: 0x00ca, 0x4d3: 0x00ca, 0x4d4: 0x00ca, 0x4d5: 0x00ca, 0x4d6: 0x00ca, 0x4d7: 0x00ca, + 0x4d8: 0x00ca, 0x4d9: 0x00ca, 0x4da: 0x00ca, 0x4db: 0x00ca, 0x4dc: 0x00ca, 0x4dd: 0x00ca, + 0x4de: 0x00ca, 0x4df: 0x00ca, 0x4e0: 0x00ca, 0x4e1: 0x00ca, 0x4e2: 0x00ca, 0x4e3: 0x00ca, + 0x4e4: 0x00ca, 0x4e5: 0x00ca, 0x4e6: 0x00ca, 0x4e7: 0x00ca, 0x4e8: 0x00ca, 0x4e9: 0x00ca, + 0x4ea: 0x00ca, 0x4ef: 0x00ca, + 0x4f0: 0x00ca, 0x4f1: 0x00ca, 0x4f2: 0x00ca, 0x4f3: 0x0051, 0x4f4: 0x0051, + // Block 0x14, offset 0x500 + 0x500: 0x0040, 0x501: 0x0040, 0x502: 0x0040, 0x503: 0x0040, 0x504: 0x0040, 0x505: 0x0040, + 0x506: 0x0080, 0x507: 0x0080, 0x508: 0x0080, 0x509: 0x0080, 0x50a: 0x0080, 0x50b: 0x0080, + 0x50c: 0x0080, 0x50d: 0x0080, 0x50e: 0x0080, 0x50f: 0x0080, 0x510: 0x00c3, 0x511: 0x00c3, + 0x512: 0x00c3, 0x513: 0x00c3, 0x514: 0x00c3, 0x515: 0x00c3, 0x516: 0x00c3, 0x517: 0x00c3, + 0x518: 0x00c3, 0x519: 0x00c3, 0x51a: 0x00c3, 0x51b: 0x0080, 0x51c: 0x0040, 0x51d: 0x0080, + 0x51e: 0x0080, 0x51f: 0x0080, 0x520: 0x00c2, 0x521: 0x00c0, 0x522: 0x00c4, 0x523: 0x00c4, + 0x524: 0x00c4, 0x525: 0x00c4, 0x526: 0x00c2, 0x527: 0x00c4, 0x528: 0x00c2, 0x529: 0x00c4, + 0x52a: 0x00c2, 0x52b: 0x00c2, 0x52c: 0x00c2, 0x52d: 0x00c2, 0x52e: 0x00c2, 0x52f: 0x00c4, + 0x530: 0x00c4, 0x531: 0x00c4, 0x532: 0x00c4, 0x533: 0x00c2, 0x534: 0x00c2, 0x535: 0x00c2, + 0x536: 0x00c2, 0x537: 0x00c2, 0x538: 0x00c2, 0x539: 0x00c2, 0x53a: 0x00c2, 0x53b: 0x00c2, + 0x53c: 0x00c2, 0x53d: 0x00c2, 0x53e: 0x00c2, 0x53f: 0x00c2, + // Block 0x15, offset 0x540 + 0x540: 0x0040, 0x541: 0x00c2, 0x542: 0x00c2, 0x543: 0x00c2, 0x544: 0x00c2, 0x545: 0x00c2, + 0x546: 0x00c2, 0x547: 0x00c2, 0x548: 0x00c4, 0x549: 0x00c2, 0x54a: 0x00c2, 0x54b: 0x00c3, + 0x54c: 0x00c3, 0x54d: 0x00c3, 0x54e: 0x00c3, 0x54f: 0x00c3, 0x550: 0x00c3, 0x551: 0x00c3, + 0x552: 0x00c3, 0x553: 0x00c3, 0x554: 0x00c3, 0x555: 0x00c3, 0x556: 0x00c3, 0x557: 0x00c3, + 0x558: 0x00c3, 0x559: 0x00c3, 0x55a: 0x00c3, 0x55b: 0x00c3, 0x55c: 0x00c3, 0x55d: 0x00c3, + 0x55e: 0x00c3, 0x55f: 0x00c3, 0x560: 0x0053, 0x561: 0x0053, 0x562: 0x0053, 0x563: 0x0053, + 0x564: 0x0053, 0x565: 0x0053, 0x566: 0x0053, 0x567: 0x0053, 0x568: 0x0053, 0x569: 0x0053, + 0x56a: 0x0080, 0x56b: 0x0080, 0x56c: 0x0080, 0x56d: 0x0080, 0x56e: 0x00c2, 0x56f: 0x00c2, + 0x570: 0x00c3, 0x571: 0x00c4, 0x572: 0x00c4, 0x573: 0x00c4, 0x574: 0x00c0, 0x575: 0x0084, + 0x576: 0x0084, 0x577: 0x0084, 0x578: 0x0082, 0x579: 0x00c2, 0x57a: 0x00c2, 0x57b: 0x00c2, + 0x57c: 0x00c2, 0x57d: 0x00c2, 0x57e: 0x00c2, 0x57f: 0x00c2, + // Block 0x16, offset 0x580 + 0x580: 0x00c2, 0x581: 0x00c2, 0x582: 0x00c2, 0x583: 0x00c2, 0x584: 0x00c2, 0x585: 0x00c2, + 0x586: 0x00c2, 0x587: 0x00c2, 0x588: 0x00c4, 0x589: 0x00c4, 0x58a: 0x00c4, 0x58b: 0x00c4, + 0x58c: 0x00c4, 0x58d: 0x00c4, 0x58e: 0x00c4, 0x58f: 0x00c4, 0x590: 0x00c4, 0x591: 0x00c4, + 0x592: 0x00c4, 0x593: 0x00c4, 0x594: 0x00c4, 0x595: 0x00c4, 0x596: 0x00c4, 0x597: 0x00c4, + 0x598: 0x00c4, 0x599: 0x00c4, 0x59a: 0x00c2, 0x59b: 0x00c2, 0x59c: 0x00c2, 0x59d: 0x00c2, + 0x59e: 0x00c2, 0x59f: 0x00c2, 0x5a0: 0x00c2, 0x5a1: 0x00c2, 0x5a2: 0x00c2, 0x5a3: 0x00c2, + 0x5a4: 0x00c2, 0x5a5: 0x00c2, 0x5a6: 0x00c2, 0x5a7: 0x00c2, 0x5a8: 0x00c2, 0x5a9: 0x00c2, + 0x5aa: 0x00c2, 0x5ab: 0x00c2, 0x5ac: 0x00c2, 0x5ad: 0x00c2, 0x5ae: 0x00c2, 0x5af: 0x00c2, + 0x5b0: 0x00c2, 0x5b1: 0x00c2, 0x5b2: 0x00c2, 0x5b3: 0x00c2, 0x5b4: 0x00c2, 0x5b5: 0x00c2, + 0x5b6: 0x00c2, 0x5b7: 0x00c2, 0x5b8: 0x00c2, 0x5b9: 0x00c2, 0x5ba: 0x00c2, 0x5bb: 0x00c2, + 0x5bc: 0x00c2, 0x5bd: 0x00c2, 0x5be: 0x00c2, 0x5bf: 0x00c2, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x00c4, 0x5c1: 0x00c2, 0x5c2: 0x00c2, 0x5c3: 0x00c4, 0x5c4: 0x00c4, 0x5c5: 0x00c4, + 0x5c6: 0x00c4, 0x5c7: 0x00c4, 0x5c8: 0x00c4, 0x5c9: 0x00c4, 0x5ca: 0x00c4, 0x5cb: 0x00c4, + 0x5cc: 0x00c2, 0x5cd: 0x00c4, 0x5ce: 0x00c2, 0x5cf: 0x00c4, 0x5d0: 0x00c2, 0x5d1: 0x00c2, + 0x5d2: 0x00c4, 0x5d3: 0x00c4, 0x5d4: 0x0080, 0x5d5: 0x00c4, 0x5d6: 0x00c3, 0x5d7: 0x00c3, + 0x5d8: 0x00c3, 0x5d9: 0x00c3, 0x5da: 0x00c3, 0x5db: 0x00c3, 0x5dc: 0x00c3, 0x5dd: 0x0040, + 0x5de: 0x0080, 0x5df: 0x00c3, 0x5e0: 0x00c3, 0x5e1: 0x00c3, 0x5e2: 0x00c3, 0x5e3: 0x00c3, + 0x5e4: 0x00c3, 0x5e5: 0x00c0, 0x5e6: 0x00c0, 0x5e7: 0x00c3, 0x5e8: 0x00c3, 0x5e9: 0x0080, + 0x5ea: 0x00c3, 0x5eb: 0x00c3, 0x5ec: 0x00c3, 0x5ed: 0x00c3, 0x5ee: 0x00c4, 0x5ef: 0x00c4, + 0x5f0: 0x0054, 0x5f1: 0x0054, 0x5f2: 0x0054, 0x5f3: 0x0054, 0x5f4: 0x0054, 0x5f5: 0x0054, + 0x5f6: 0x0054, 0x5f7: 0x0054, 0x5f8: 0x0054, 0x5f9: 0x0054, 0x5fa: 0x00c2, 0x5fb: 0x00c2, + 0x5fc: 0x00c2, 0x5fd: 0x00c0, 0x5fe: 0x00c0, 0x5ff: 0x00c2, + // Block 0x18, offset 0x600 + 0x600: 0x0080, 0x601: 0x0080, 0x602: 0x0080, 0x603: 0x0080, 0x604: 0x0080, 0x605: 0x0080, + 0x606: 0x0080, 0x607: 0x0080, 0x608: 0x0080, 0x609: 0x0080, 0x60a: 0x0080, 0x60b: 0x0080, + 0x60c: 0x0080, 0x60d: 0x0080, 0x60f: 0x0040, 0x610: 0x00c4, 0x611: 0x00c3, + 0x612: 0x00c2, 0x613: 0x00c2, 0x614: 0x00c2, 0x615: 0x00c4, 0x616: 0x00c4, 0x617: 0x00c4, + 0x618: 0x00c4, 0x619: 0x00c4, 0x61a: 0x00c2, 0x61b: 0x00c2, 0x61c: 0x00c2, 0x61d: 0x00c2, + 0x61e: 0x00c4, 0x61f: 0x00c2, 0x620: 0x00c2, 0x621: 0x00c2, 0x622: 0x00c2, 0x623: 0x00c2, + 0x624: 0x00c2, 0x625: 0x00c2, 0x626: 0x00c2, 0x627: 0x00c2, 0x628: 0x00c4, 0x629: 0x00c2, + 0x62a: 0x00c4, 0x62b: 0x00c2, 0x62c: 0x00c4, 0x62d: 0x00c2, 0x62e: 0x00c2, 0x62f: 0x00c4, + 0x630: 0x00c3, 0x631: 0x00c3, 0x632: 0x00c3, 0x633: 0x00c3, 0x634: 0x00c3, 0x635: 0x00c3, + 0x636: 0x00c3, 0x637: 0x00c3, 0x638: 0x00c3, 0x639: 0x00c3, 0x63a: 0x00c3, 0x63b: 0x00c3, + 0x63c: 0x00c3, 0x63d: 0x00c3, 0x63e: 0x00c3, 0x63f: 0x00c3, + // Block 0x19, offset 0x640 + 0x640: 0x00c3, 0x641: 0x00c3, 0x642: 0x00c3, 0x643: 0x00c3, 0x644: 0x00c3, 0x645: 0x00c3, + 0x646: 0x00c3, 0x647: 0x00c3, 0x648: 0x00c3, 0x649: 0x00c3, 0x64a: 0x00c3, + 0x64d: 0x00c4, 0x64e: 0x00c2, 0x64f: 0x00c2, 0x650: 0x00c2, 0x651: 0x00c2, + 0x652: 0x00c2, 0x653: 0x00c2, 0x654: 0x00c2, 0x655: 0x00c2, 0x656: 0x00c2, 0x657: 0x00c2, + 0x658: 0x00c2, 0x659: 0x00c4, 0x65a: 0x00c4, 0x65b: 0x00c4, 0x65c: 0x00c2, 0x65d: 0x00c2, + 0x65e: 0x00c2, 0x65f: 0x00c2, 0x660: 0x00c2, 0x661: 0x00c2, 0x662: 0x00c2, 0x663: 0x00c2, + 0x664: 0x00c2, 0x665: 0x00c2, 0x666: 0x00c2, 0x667: 0x00c2, 0x668: 0x00c2, 0x669: 0x00c2, + 0x66a: 0x00c2, 0x66b: 0x00c4, 0x66c: 0x00c4, 0x66d: 0x00c2, 0x66e: 0x00c2, 0x66f: 0x00c2, + 0x670: 0x00c2, 0x671: 0x00c4, 0x672: 0x00c2, 0x673: 0x00c4, 0x674: 0x00c4, 0x675: 0x00c2, + 0x676: 0x00c2, 0x677: 0x00c2, 0x678: 0x00c4, 0x679: 0x00c4, 0x67a: 0x00c2, 0x67b: 0x00c2, + 0x67c: 0x00c2, 0x67d: 0x00c2, 0x67e: 0x00c2, 0x67f: 0x00c2, + // Block 0x1a, offset 0x680 + 0x680: 0x00c0, 0x681: 0x00c0, 0x682: 0x00c0, 0x683: 0x00c0, 0x684: 0x00c0, 0x685: 0x00c0, + 0x686: 0x00c0, 0x687: 0x00c0, 0x688: 0x00c0, 0x689: 0x00c0, 0x68a: 0x00c0, 0x68b: 0x00c0, + 0x68c: 0x00c0, 0x68d: 0x00c0, 0x68e: 0x00c0, 0x68f: 0x00c0, 0x690: 0x00c0, 0x691: 0x00c0, + 0x692: 0x00c0, 0x693: 0x00c0, 0x694: 0x00c0, 0x695: 0x00c0, 0x696: 0x00c0, 0x697: 0x00c0, + 0x698: 0x00c0, 0x699: 0x00c0, 0x69a: 0x00c0, 0x69b: 0x00c0, 0x69c: 0x00c0, 0x69d: 0x00c0, + 0x69e: 0x00c0, 0x69f: 0x00c0, 0x6a0: 0x00c0, 0x6a1: 0x00c0, 0x6a2: 0x00c0, 0x6a3: 0x00c0, + 0x6a4: 0x00c0, 0x6a5: 0x00c0, 0x6a6: 0x00c3, 0x6a7: 0x00c3, 0x6a8: 0x00c3, 0x6a9: 0x00c3, + 0x6aa: 0x00c3, 0x6ab: 0x00c3, 0x6ac: 0x00c3, 0x6ad: 0x00c3, 0x6ae: 0x00c3, 0x6af: 0x00c3, + 0x6b0: 0x00c3, 0x6b1: 0x00c0, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x00c0, 0x6c1: 0x00c0, 0x6c2: 0x00c0, 0x6c3: 0x00c0, 0x6c4: 0x00c0, 0x6c5: 0x00c0, + 0x6c6: 0x00c0, 0x6c7: 0x00c0, 0x6c8: 0x00c0, 0x6c9: 0x00c0, 0x6ca: 0x00c2, 0x6cb: 0x00c2, + 0x6cc: 0x00c2, 0x6cd: 0x00c2, 0x6ce: 0x00c2, 0x6cf: 0x00c2, 0x6d0: 0x00c2, 0x6d1: 0x00c2, + 0x6d2: 0x00c2, 0x6d3: 0x00c2, 0x6d4: 0x00c2, 0x6d5: 0x00c2, 0x6d6: 0x00c2, 0x6d7: 0x00c2, + 0x6d8: 0x00c2, 0x6d9: 0x00c2, 0x6da: 0x00c2, 0x6db: 0x00c2, 0x6dc: 0x00c2, 0x6dd: 0x00c2, + 0x6de: 0x00c2, 0x6df: 0x00c2, 0x6e0: 0x00c2, 0x6e1: 0x00c2, 0x6e2: 0x00c2, 0x6e3: 0x00c2, + 0x6e4: 0x00c2, 0x6e5: 0x00c2, 0x6e6: 0x00c2, 0x6e7: 0x00c2, 0x6e8: 0x00c2, 0x6e9: 0x00c2, + 0x6ea: 0x00c2, 0x6eb: 0x00c3, 0x6ec: 0x00c3, 0x6ed: 0x00c3, 0x6ee: 0x00c3, 0x6ef: 0x00c3, + 0x6f0: 0x00c3, 0x6f1: 0x00c3, 0x6f2: 0x00c3, 0x6f3: 0x00c3, 0x6f4: 0x00c0, 0x6f5: 0x00c0, + 0x6f6: 0x0080, 0x6f7: 0x0080, 0x6f8: 0x0080, 0x6f9: 0x0080, 0x6fa: 0x0040, + 0x6fd: 0x00c3, 0x6fe: 0x0080, 0x6ff: 0x0080, + // Block 0x1c, offset 0x700 + 0x700: 0x00c0, 0x701: 0x00c0, 0x702: 0x00c0, 0x703: 0x00c0, 0x704: 0x00c0, 0x705: 0x00c0, + 0x706: 0x00c0, 0x707: 0x00c0, 0x708: 0x00c0, 0x709: 0x00c0, 0x70a: 0x00c0, 0x70b: 0x00c0, + 0x70c: 0x00c0, 0x70d: 0x00c0, 0x70e: 0x00c0, 0x70f: 0x00c0, 0x710: 0x00c0, 0x711: 0x00c0, + 0x712: 0x00c0, 0x713: 0x00c0, 0x714: 0x00c0, 0x715: 0x00c0, 0x716: 0x00c3, 0x717: 0x00c3, + 0x718: 0x00c3, 0x719: 0x00c3, 0x71a: 0x00c0, 0x71b: 0x00c3, 0x71c: 0x00c3, 0x71d: 0x00c3, + 0x71e: 0x00c3, 0x71f: 0x00c3, 0x720: 0x00c3, 0x721: 0x00c3, 0x722: 0x00c3, 0x723: 0x00c3, + 0x724: 0x00c0, 0x725: 0x00c3, 0x726: 0x00c3, 0x727: 0x00c3, 0x728: 0x00c0, 0x729: 0x00c3, + 0x72a: 0x00c3, 0x72b: 0x00c3, 0x72c: 0x00c3, 0x72d: 0x00c3, + 0x730: 0x0080, 0x731: 0x0080, 0x732: 0x0080, 0x733: 0x0080, 0x734: 0x0080, 0x735: 0x0080, + 0x736: 0x0080, 0x737: 0x0080, 0x738: 0x0080, 0x739: 0x0080, 0x73a: 0x0080, 0x73b: 0x0080, + 0x73c: 0x0080, 0x73d: 0x0080, 0x73e: 0x0080, + // Block 0x1d, offset 0x740 + 0x740: 0x00c4, 0x741: 0x00c2, 0x742: 0x00c2, 0x743: 0x00c2, 0x744: 0x00c2, 0x745: 0x00c2, + 0x746: 0x00c4, 0x747: 0x00c4, 0x748: 0x00c2, 0x749: 0x00c4, 0x74a: 0x00c2, 0x74b: 0x00c2, + 0x74c: 0x00c2, 0x74d: 0x00c2, 0x74e: 0x00c2, 0x74f: 0x00c2, 0x750: 0x00c2, 0x751: 0x00c2, + 0x752: 0x00c2, 0x753: 0x00c2, 0x754: 0x00c4, 0x755: 0x00c2, 0x756: 0x00c4, 0x757: 0x00c4, + 0x758: 0x00c4, 0x759: 0x00c3, 0x75a: 0x00c3, 0x75b: 0x00c3, + 0x75e: 0x0080, 0x760: 0x00c2, 0x761: 0x00c0, 0x762: 0x00c2, 0x763: 0x00c2, + 0x764: 0x00c2, 0x765: 0x00c2, 0x766: 0x00c0, 0x767: 0x00c4, 0x768: 0x00c2, 0x769: 0x00c4, + 0x76a: 0x00c4, + 0x770: 0x00c4, 0x771: 0x00c4, 0x772: 0x00c4, 0x773: 0x00c4, 0x774: 0x00c4, 0x775: 0x00c4, + 0x776: 0x00c4, 0x777: 0x00c4, 0x778: 0x00c4, 0x779: 0x00c4, 0x77a: 0x00c4, 0x77b: 0x00c4, + 0x77c: 0x00c4, 0x77d: 0x00c4, 0x77e: 0x00c4, 0x77f: 0x00c4, + // Block 0x1e, offset 0x780 + 0x780: 0x00c4, 0x781: 0x00c4, 0x782: 0x00c4, 0x783: 0x00c0, 0x784: 0x00c0, 0x785: 0x00c0, + 0x786: 0x00c2, 0x787: 0x00c0, 0x788: 0x0080, 0x789: 0x00c2, 0x78a: 0x00c2, 0x78b: 0x00c2, + 0x78c: 0x00c2, 0x78d: 0x00c2, 0x78e: 0x00c4, 0x790: 0x0040, 0x791: 0x0040, + 0x798: 0x00c3, 0x799: 0x00c3, 0x79a: 0x00c3, 0x79b: 0x00c3, 0x79c: 0x00c3, 0x79d: 0x00c3, + 0x79e: 0x00c3, 0x79f: 0x00c3, 0x7a0: 0x00c2, 0x7a1: 0x00c2, 0x7a2: 0x00c2, 0x7a3: 0x00c2, + 0x7a4: 0x00c2, 0x7a5: 0x00c2, 0x7a6: 0x00c2, 0x7a7: 0x00c2, 0x7a8: 0x00c2, 0x7a9: 0x00c2, + 0x7aa: 0x00c4, 0x7ab: 0x00c4, 0x7ac: 0x00c4, 0x7ad: 0x00c0, 0x7ae: 0x00c4, 0x7af: 0x00c2, + 0x7b0: 0x00c2, 0x7b1: 0x00c4, 0x7b2: 0x00c4, 0x7b3: 0x00c2, 0x7b4: 0x00c2, 0x7b5: 0x00c2, + 0x7b6: 0x00c2, 0x7b7: 0x00c2, 0x7b8: 0x00c2, 0x7b9: 0x00c4, 0x7ba: 0x00c2, 0x7bb: 0x00c2, + 0x7bc: 0x00c2, 0x7bd: 0x00c2, 0x7be: 0x00c2, 0x7bf: 0x00c2, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x00c2, 0x7c1: 0x00c2, 0x7c2: 0x00c2, 0x7c3: 0x00c2, 0x7c4: 0x00c2, 0x7c5: 0x00c2, + 0x7c6: 0x00c2, 0x7c7: 0x00c2, 0x7c8: 0x00c2, 0x7c9: 0x00c0, 0x7ca: 0x00c3, 0x7cb: 0x00c3, + 0x7cc: 0x00c3, 0x7cd: 0x00c3, 0x7ce: 0x00c3, 0x7cf: 0x00c3, 0x7d0: 0x00c3, 0x7d1: 0x00c3, + 0x7d2: 0x00c3, 0x7d3: 0x00c3, 0x7d4: 0x00c3, 0x7d5: 0x00c3, 0x7d6: 0x00c3, 0x7d7: 0x00c3, + 0x7d8: 0x00c3, 0x7d9: 0x00c3, 0x7da: 0x00c3, 0x7db: 0x00c3, 0x7dc: 0x00c3, 0x7dd: 0x00c3, + 0x7de: 0x00c3, 0x7df: 0x00c3, 0x7e0: 0x00c3, 0x7e1: 0x00c3, 0x7e2: 0x0040, 0x7e3: 0x00c3, + 0x7e4: 0x00c3, 0x7e5: 0x00c3, 0x7e6: 0x00c3, 0x7e7: 0x00c3, 0x7e8: 0x00c3, 0x7e9: 0x00c3, + 0x7ea: 0x00c3, 0x7eb: 0x00c3, 0x7ec: 0x00c3, 0x7ed: 0x00c3, 0x7ee: 0x00c3, 0x7ef: 0x00c3, + 0x7f0: 0x00c3, 0x7f1: 0x00c3, 0x7f2: 0x00c3, 0x7f3: 0x00c3, 0x7f4: 0x00c3, 0x7f5: 0x00c3, + 0x7f6: 0x00c3, 0x7f7: 0x00c3, 0x7f8: 0x00c3, 0x7f9: 0x00c3, 0x7fa: 0x00c3, 0x7fb: 0x00c3, + 0x7fc: 0x00c3, 0x7fd: 0x00c3, 0x7fe: 0x00c3, 0x7ff: 0x00c3, + // Block 0x20, offset 0x800 + 0x800: 0x00c3, 0x801: 0x00c3, 0x802: 0x00c3, 0x803: 0x00c0, 0x804: 0x00c0, 0x805: 0x00c0, + 0x806: 0x00c0, 0x807: 0x00c0, 0x808: 0x00c0, 0x809: 0x00c0, 0x80a: 0x00c0, 0x80b: 0x00c0, + 0x80c: 0x00c0, 0x80d: 0x00c0, 0x80e: 0x00c0, 0x80f: 0x00c0, 0x810: 0x00c0, 0x811: 0x00c0, + 0x812: 0x00c0, 0x813: 0x00c0, 0x814: 0x00c0, 0x815: 0x00c0, 0x816: 0x00c0, 0x817: 0x00c0, + 0x818: 0x00c0, 0x819: 0x00c0, 0x81a: 0x00c0, 0x81b: 0x00c0, 0x81c: 0x00c0, 0x81d: 0x00c0, + 0x81e: 0x00c0, 0x81f: 0x00c0, 0x820: 0x00c0, 0x821: 0x00c0, 0x822: 0x00c0, 0x823: 0x00c0, + 0x824: 0x00c0, 0x825: 0x00c0, 0x826: 0x00c0, 0x827: 0x00c0, 0x828: 0x00c0, 0x829: 0x00c0, + 0x82a: 0x00c0, 0x82b: 0x00c0, 0x82c: 0x00c0, 0x82d: 0x00c0, 0x82e: 0x00c0, 0x82f: 0x00c0, + 0x830: 0x00c0, 0x831: 0x00c0, 0x832: 0x00c0, 0x833: 0x00c0, 0x834: 0x00c0, 0x835: 0x00c0, + 0x836: 0x00c0, 0x837: 0x00c0, 0x838: 0x00c0, 0x839: 0x00c0, 0x83a: 0x00c3, 0x83b: 0x00c0, + 0x83c: 0x00c3, 0x83d: 0x00c0, 0x83e: 0x00c0, 0x83f: 0x00c0, + // Block 0x21, offset 0x840 + 0x840: 0x00c0, 0x841: 0x00c3, 0x842: 0x00c3, 0x843: 0x00c3, 0x844: 0x00c3, 0x845: 0x00c3, + 0x846: 0x00c3, 0x847: 0x00c3, 0x848: 0x00c3, 0x849: 0x00c0, 0x84a: 0x00c0, 0x84b: 0x00c0, + 0x84c: 0x00c0, 0x84d: 0x00c6, 0x84e: 0x00c0, 0x84f: 0x00c0, 0x850: 0x00c0, 0x851: 0x00c3, + 0x852: 0x00c3, 0x853: 0x00c3, 0x854: 0x00c3, 0x855: 0x00c3, 0x856: 0x00c3, 0x857: 0x00c3, + 0x858: 0x0080, 0x859: 0x0080, 0x85a: 0x0080, 0x85b: 0x0080, 0x85c: 0x0080, 0x85d: 0x0080, + 0x85e: 0x0080, 0x85f: 0x0080, 0x860: 0x00c0, 0x861: 0x00c0, 0x862: 0x00c3, 0x863: 0x00c3, + 0x864: 0x0080, 0x865: 0x0080, 0x866: 0x00c0, 0x867: 0x00c0, 0x868: 0x00c0, 0x869: 0x00c0, + 0x86a: 0x00c0, 0x86b: 0x00c0, 0x86c: 0x00c0, 0x86d: 0x00c0, 0x86e: 0x00c0, 0x86f: 0x00c0, + 0x870: 0x0080, 0x871: 0x00c0, 0x872: 0x00c0, 0x873: 0x00c0, 0x874: 0x00c0, 0x875: 0x00c0, + 0x876: 0x00c0, 0x877: 0x00c0, 0x878: 0x00c0, 0x879: 0x00c0, 0x87a: 0x00c0, 0x87b: 0x00c0, + 0x87c: 0x00c0, 0x87d: 0x00c0, 0x87e: 0x00c0, 0x87f: 0x00c0, + // Block 0x22, offset 0x880 + 0x880: 0x00c0, 0x881: 0x00c3, 0x882: 0x00c0, 0x883: 0x00c0, 0x885: 0x00c0, + 0x886: 0x00c0, 0x887: 0x00c0, 0x888: 0x00c0, 0x889: 0x00c0, 0x88a: 0x00c0, 0x88b: 0x00c0, + 0x88c: 0x00c0, 0x88f: 0x00c0, 0x890: 0x00c0, + 0x893: 0x00c0, 0x894: 0x00c0, 0x895: 0x00c0, 0x896: 0x00c0, 0x897: 0x00c0, + 0x898: 0x00c0, 0x899: 0x00c0, 0x89a: 0x00c0, 0x89b: 0x00c0, 0x89c: 0x00c0, 0x89d: 0x00c0, + 0x89e: 0x00c0, 0x89f: 0x00c0, 0x8a0: 0x00c0, 0x8a1: 0x00c0, 0x8a2: 0x00c0, 0x8a3: 0x00c0, + 0x8a4: 0x00c0, 0x8a5: 0x00c0, 0x8a6: 0x00c0, 0x8a7: 0x00c0, 0x8a8: 0x00c0, + 0x8aa: 0x00c0, 0x8ab: 0x00c0, 0x8ac: 0x00c0, 0x8ad: 0x00c0, 0x8ae: 0x00c0, 0x8af: 0x00c0, + 0x8b0: 0x00c0, 0x8b2: 0x00c0, + 0x8b6: 0x00c0, 0x8b7: 0x00c0, 0x8b8: 0x00c0, 0x8b9: 0x00c0, + 0x8bc: 0x00c3, 0x8bd: 0x00c0, 0x8be: 0x00c0, 0x8bf: 0x00c0, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x00c0, 0x8c1: 0x00c3, 0x8c2: 0x00c3, 0x8c3: 0x00c3, 0x8c4: 0x00c3, + 0x8c7: 0x00c0, 0x8c8: 0x00c0, 0x8cb: 0x00c0, + 0x8cc: 0x00c0, 0x8cd: 0x00c6, 0x8ce: 0x00c0, + 0x8d7: 0x00c0, + 0x8dc: 0x0080, 0x8dd: 0x0080, + 0x8df: 0x0080, 0x8e0: 0x00c0, 0x8e1: 0x00c0, 0x8e2: 0x00c3, 0x8e3: 0x00c3, + 0x8e6: 0x00c0, 0x8e7: 0x00c0, 0x8e8: 0x00c0, 0x8e9: 0x00c0, + 0x8ea: 0x00c0, 0x8eb: 0x00c0, 0x8ec: 0x00c0, 0x8ed: 0x00c0, 0x8ee: 0x00c0, 0x8ef: 0x00c0, + 0x8f0: 0x00c0, 0x8f1: 0x00c0, 0x8f2: 0x0080, 0x8f3: 0x0080, 0x8f4: 0x0080, 0x8f5: 0x0080, + 0x8f6: 0x0080, 0x8f7: 0x0080, 0x8f8: 0x0080, 0x8f9: 0x0080, 0x8fa: 0x0080, 0x8fb: 0x0080, + 0x8fc: 0x00c0, 0x8fd: 0x0080, 0x8fe: 0x00c3, + // Block 0x24, offset 0x900 + 0x901: 0x00c3, 0x902: 0x00c3, 0x903: 0x00c0, 0x905: 0x00c0, + 0x906: 0x00c0, 0x907: 0x00c0, 0x908: 0x00c0, 0x909: 0x00c0, 0x90a: 0x00c0, + 0x90f: 0x00c0, 0x910: 0x00c0, + 0x913: 0x00c0, 0x914: 0x00c0, 0x915: 0x00c0, 0x916: 0x00c0, 0x917: 0x00c0, + 0x918: 0x00c0, 0x919: 0x00c0, 0x91a: 0x00c0, 0x91b: 0x00c0, 0x91c: 0x00c0, 0x91d: 0x00c0, + 0x91e: 0x00c0, 0x91f: 0x00c0, 0x920: 0x00c0, 0x921: 0x00c0, 0x922: 0x00c0, 0x923: 0x00c0, + 0x924: 0x00c0, 0x925: 0x00c0, 0x926: 0x00c0, 0x927: 0x00c0, 0x928: 0x00c0, + 0x92a: 0x00c0, 0x92b: 0x00c0, 0x92c: 0x00c0, 0x92d: 0x00c0, 0x92e: 0x00c0, 0x92f: 0x00c0, + 0x930: 0x00c0, 0x932: 0x00c0, 0x933: 0x0080, 0x935: 0x00c0, + 0x936: 0x0080, 0x938: 0x00c0, 0x939: 0x00c0, + 0x93c: 0x00c3, 0x93e: 0x00c0, 0x93f: 0x00c0, + // Block 0x25, offset 0x940 + 0x940: 0x00c0, 0x941: 0x00c3, 0x942: 0x00c3, + 0x947: 0x00c3, 0x948: 0x00c3, 0x94b: 0x00c3, + 0x94c: 0x00c3, 0x94d: 0x00c6, 0x951: 0x00c3, + 0x959: 0x0080, 0x95a: 0x0080, 0x95b: 0x0080, 0x95c: 0x00c0, + 0x95e: 0x0080, + 0x966: 0x00c0, 0x967: 0x00c0, 0x968: 0x00c0, 0x969: 0x00c0, + 0x96a: 0x00c0, 0x96b: 0x00c0, 0x96c: 0x00c0, 0x96d: 0x00c0, 0x96e: 0x00c0, 0x96f: 0x00c0, + 0x970: 0x00c3, 0x971: 0x00c3, 0x972: 0x00c0, 0x973: 0x00c0, 0x974: 0x00c0, 0x975: 0x00c3, + 0x976: 0x0080, + // Block 0x26, offset 0x980 + 0x981: 0x00c3, 0x982: 0x00c3, 0x983: 0x00c0, 0x985: 0x00c0, + 0x986: 0x00c0, 0x987: 0x00c0, 0x988: 0x00c0, 0x989: 0x00c0, 0x98a: 0x00c0, 0x98b: 0x00c0, + 0x98c: 0x00c0, 0x98d: 0x00c0, 0x98f: 0x00c0, 0x990: 0x00c0, 0x991: 0x00c0, + 0x993: 0x00c0, 0x994: 0x00c0, 0x995: 0x00c0, 0x996: 0x00c0, 0x997: 0x00c0, + 0x998: 0x00c0, 0x999: 0x00c0, 0x99a: 0x00c0, 0x99b: 0x00c0, 0x99c: 0x00c0, 0x99d: 0x00c0, + 0x99e: 0x00c0, 0x99f: 0x00c0, 0x9a0: 0x00c0, 0x9a1: 0x00c0, 0x9a2: 0x00c0, 0x9a3: 0x00c0, + 0x9a4: 0x00c0, 0x9a5: 0x00c0, 0x9a6: 0x00c0, 0x9a7: 0x00c0, 0x9a8: 0x00c0, + 0x9aa: 0x00c0, 0x9ab: 0x00c0, 0x9ac: 0x00c0, 0x9ad: 0x00c0, 0x9ae: 0x00c0, 0x9af: 0x00c0, + 0x9b0: 0x00c0, 0x9b2: 0x00c0, 0x9b3: 0x00c0, 0x9b5: 0x00c0, + 0x9b6: 0x00c0, 0x9b7: 0x00c0, 0x9b8: 0x00c0, 0x9b9: 0x00c0, + 0x9bc: 0x00c3, 0x9bd: 0x00c0, 0x9be: 0x00c0, 0x9bf: 0x00c0, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x00c0, 0x9c1: 0x00c3, 0x9c2: 0x00c3, 0x9c3: 0x00c3, 0x9c4: 0x00c3, 0x9c5: 0x00c3, + 0x9c7: 0x00c3, 0x9c8: 0x00c3, 0x9c9: 0x00c0, 0x9cb: 0x00c0, + 0x9cc: 0x00c0, 0x9cd: 0x00c6, 0x9d0: 0x00c0, + 0x9e0: 0x00c0, 0x9e1: 0x00c0, 0x9e2: 0x00c3, 0x9e3: 0x00c3, + 0x9e6: 0x00c0, 0x9e7: 0x00c0, 0x9e8: 0x00c0, 0x9e9: 0x00c0, + 0x9ea: 0x00c0, 0x9eb: 0x00c0, 0x9ec: 0x00c0, 0x9ed: 0x00c0, 0x9ee: 0x00c0, 0x9ef: 0x00c0, + 0x9f0: 0x0080, 0x9f1: 0x0080, + 0x9f9: 0x00c0, 0x9fa: 0x00c3, 0x9fb: 0x00c3, + 0x9fc: 0x00c3, 0x9fd: 0x00c3, 0x9fe: 0x00c3, 0x9ff: 0x00c3, + // Block 0x28, offset 0xa00 + 0xa01: 0x00c3, 0xa02: 0x00c0, 0xa03: 0x00c0, 0xa05: 0x00c0, + 0xa06: 0x00c0, 0xa07: 0x00c0, 0xa08: 0x00c0, 0xa09: 0x00c0, 0xa0a: 0x00c0, 0xa0b: 0x00c0, + 0xa0c: 0x00c0, 0xa0f: 0x00c0, 0xa10: 0x00c0, + 0xa13: 0x00c0, 0xa14: 0x00c0, 0xa15: 0x00c0, 0xa16: 0x00c0, 0xa17: 0x00c0, + 0xa18: 0x00c0, 0xa19: 0x00c0, 0xa1a: 0x00c0, 0xa1b: 0x00c0, 0xa1c: 0x00c0, 0xa1d: 0x00c0, + 0xa1e: 0x00c0, 0xa1f: 0x00c0, 0xa20: 0x00c0, 0xa21: 0x00c0, 0xa22: 0x00c0, 0xa23: 0x00c0, + 0xa24: 0x00c0, 0xa25: 0x00c0, 0xa26: 0x00c0, 0xa27: 0x00c0, 0xa28: 0x00c0, + 0xa2a: 0x00c0, 0xa2b: 0x00c0, 0xa2c: 0x00c0, 0xa2d: 0x00c0, 0xa2e: 0x00c0, 0xa2f: 0x00c0, + 0xa30: 0x00c0, 0xa32: 0x00c0, 0xa33: 0x00c0, 0xa35: 0x00c0, + 0xa36: 0x00c0, 0xa37: 0x00c0, 0xa38: 0x00c0, 0xa39: 0x00c0, + 0xa3c: 0x00c3, 0xa3d: 0x00c0, 0xa3e: 0x00c0, 0xa3f: 0x00c3, + // Block 0x29, offset 0xa40 + 0xa40: 0x00c0, 0xa41: 0x00c3, 0xa42: 0x00c3, 0xa43: 0x00c3, 0xa44: 0x00c3, + 0xa47: 0x00c0, 0xa48: 0x00c0, 0xa4b: 0x00c0, + 0xa4c: 0x00c0, 0xa4d: 0x00c6, + 0xa55: 0x00c3, 0xa56: 0x00c3, 0xa57: 0x00c0, + 0xa5c: 0x0080, 0xa5d: 0x0080, + 0xa5f: 0x00c0, 0xa60: 0x00c0, 0xa61: 0x00c0, 0xa62: 0x00c3, 0xa63: 0x00c3, + 0xa66: 0x00c0, 0xa67: 0x00c0, 0xa68: 0x00c0, 0xa69: 0x00c0, + 0xa6a: 0x00c0, 0xa6b: 0x00c0, 0xa6c: 0x00c0, 0xa6d: 0x00c0, 0xa6e: 0x00c0, 0xa6f: 0x00c0, + 0xa70: 0x0080, 0xa71: 0x00c0, 0xa72: 0x0080, 0xa73: 0x0080, 0xa74: 0x0080, 0xa75: 0x0080, + 0xa76: 0x0080, 0xa77: 0x0080, + // Block 0x2a, offset 0xa80 + 0xa82: 0x00c3, 0xa83: 0x00c0, 0xa85: 0x00c0, + 0xa86: 0x00c0, 0xa87: 0x00c0, 0xa88: 0x00c0, 0xa89: 0x00c0, 0xa8a: 0x00c0, + 0xa8e: 0x00c0, 0xa8f: 0x00c0, 0xa90: 0x00c0, + 0xa92: 0x00c0, 0xa93: 0x00c0, 0xa94: 0x00c0, 0xa95: 0x00c0, + 0xa99: 0x00c0, 0xa9a: 0x00c0, 0xa9c: 0x00c0, + 0xa9e: 0x00c0, 0xa9f: 0x00c0, 0xaa3: 0x00c0, + 0xaa4: 0x00c0, 0xaa8: 0x00c0, 0xaa9: 0x00c0, + 0xaaa: 0x00c0, 0xaae: 0x00c0, 0xaaf: 0x00c0, + 0xab0: 0x00c0, 0xab1: 0x00c0, 0xab2: 0x00c0, 0xab3: 0x00c0, 0xab4: 0x00c0, 0xab5: 0x00c0, + 0xab6: 0x00c0, 0xab7: 0x00c0, 0xab8: 0x00c0, 0xab9: 0x00c0, + 0xabe: 0x00c0, 0xabf: 0x00c0, + // Block 0x2b, offset 0xac0 + 0xac0: 0x00c3, 0xac1: 0x00c0, 0xac2: 0x00c0, + 0xac6: 0x00c0, 0xac7: 0x00c0, 0xac8: 0x00c0, 0xaca: 0x00c0, 0xacb: 0x00c0, + 0xacc: 0x00c0, 0xacd: 0x00c6, 0xad0: 0x00c0, + 0xad7: 0x00c0, + 0xae6: 0x00c0, 0xae7: 0x00c0, 0xae8: 0x00c0, 0xae9: 0x00c0, + 0xaea: 0x00c0, 0xaeb: 0x00c0, 0xaec: 0x00c0, 0xaed: 0x00c0, 0xaee: 0x00c0, 0xaef: 0x00c0, + 0xaf0: 0x0080, 0xaf1: 0x0080, 0xaf2: 0x0080, 0xaf3: 0x0080, 0xaf4: 0x0080, 0xaf5: 0x0080, + 0xaf6: 0x0080, 0xaf7: 0x0080, 0xaf8: 0x0080, 0xaf9: 0x0080, 0xafa: 0x0080, + // Block 0x2c, offset 0xb00 + 0xb00: 0x00c3, 0xb01: 0x00c0, 0xb02: 0x00c0, 0xb03: 0x00c0, 0xb04: 0x00c3, 0xb05: 0x00c0, + 0xb06: 0x00c0, 0xb07: 0x00c0, 0xb08: 0x00c0, 0xb09: 0x00c0, 0xb0a: 0x00c0, 0xb0b: 0x00c0, + 0xb0c: 0x00c0, 0xb0e: 0x00c0, 0xb0f: 0x00c0, 0xb10: 0x00c0, + 0xb12: 0x00c0, 0xb13: 0x00c0, 0xb14: 0x00c0, 0xb15: 0x00c0, 0xb16: 0x00c0, 0xb17: 0x00c0, + 0xb18: 0x00c0, 0xb19: 0x00c0, 0xb1a: 0x00c0, 0xb1b: 0x00c0, 0xb1c: 0x00c0, 0xb1d: 0x00c0, + 0xb1e: 0x00c0, 0xb1f: 0x00c0, 0xb20: 0x00c0, 0xb21: 0x00c0, 0xb22: 0x00c0, 0xb23: 0x00c0, + 0xb24: 0x00c0, 0xb25: 0x00c0, 0xb26: 0x00c0, 0xb27: 0x00c0, 0xb28: 0x00c0, + 0xb2a: 0x00c0, 0xb2b: 0x00c0, 0xb2c: 0x00c0, 0xb2d: 0x00c0, 0xb2e: 0x00c0, 0xb2f: 0x00c0, + 0xb30: 0x00c0, 0xb31: 0x00c0, 0xb32: 0x00c0, 0xb33: 0x00c0, 0xb34: 0x00c0, 0xb35: 0x00c0, + 0xb36: 0x00c0, 0xb37: 0x00c0, 0xb38: 0x00c0, 0xb39: 0x00c0, + 0xb3c: 0x00c3, 0xb3d: 0x00c0, 0xb3e: 0x00c3, 0xb3f: 0x00c3, + // Block 0x2d, offset 0xb40 + 0xb40: 0x00c3, 0xb41: 0x00c0, 0xb42: 0x00c0, 0xb43: 0x00c0, 0xb44: 0x00c0, + 0xb46: 0x00c3, 0xb47: 0x00c3, 0xb48: 0x00c3, 0xb4a: 0x00c3, 0xb4b: 0x00c3, + 0xb4c: 0x00c3, 0xb4d: 0x00c6, + 0xb55: 0x00c3, 0xb56: 0x00c3, + 0xb58: 0x00c0, 0xb59: 0x00c0, 0xb5a: 0x00c0, 0xb5d: 0x00c0, + 0xb60: 0x00c0, 0xb61: 0x00c0, 0xb62: 0x00c3, 0xb63: 0x00c3, + 0xb66: 0x00c0, 0xb67: 0x00c0, 0xb68: 0x00c0, 0xb69: 0x00c0, + 0xb6a: 0x00c0, 0xb6b: 0x00c0, 0xb6c: 0x00c0, 0xb6d: 0x00c0, 0xb6e: 0x00c0, 0xb6f: 0x00c0, + 0xb77: 0x0080, 0xb78: 0x0080, 0xb79: 0x0080, 0xb7a: 0x0080, 0xb7b: 0x0080, + 0xb7c: 0x0080, 0xb7d: 0x0080, 0xb7e: 0x0080, 0xb7f: 0x0080, + // Block 0x2e, offset 0xb80 + 0xb80: 0x00c0, 0xb81: 0x00c3, 0xb82: 0x00c0, 0xb83: 0x00c0, 0xb84: 0x0080, 0xb85: 0x00c0, + 0xb86: 0x00c0, 0xb87: 0x00c0, 0xb88: 0x00c0, 0xb89: 0x00c0, 0xb8a: 0x00c0, 0xb8b: 0x00c0, + 0xb8c: 0x00c0, 0xb8e: 0x00c0, 0xb8f: 0x00c0, 0xb90: 0x00c0, + 0xb92: 0x00c0, 0xb93: 0x00c0, 0xb94: 0x00c0, 0xb95: 0x00c0, 0xb96: 0x00c0, 0xb97: 0x00c0, + 0xb98: 0x00c0, 0xb99: 0x00c0, 0xb9a: 0x00c0, 0xb9b: 0x00c0, 0xb9c: 0x00c0, 0xb9d: 0x00c0, + 0xb9e: 0x00c0, 0xb9f: 0x00c0, 0xba0: 0x00c0, 0xba1: 0x00c0, 0xba2: 0x00c0, 0xba3: 0x00c0, + 0xba4: 0x00c0, 0xba5: 0x00c0, 0xba6: 0x00c0, 0xba7: 0x00c0, 0xba8: 0x00c0, + 0xbaa: 0x00c0, 0xbab: 0x00c0, 0xbac: 0x00c0, 0xbad: 0x00c0, 0xbae: 0x00c0, 0xbaf: 0x00c0, + 0xbb0: 0x00c0, 0xbb1: 0x00c0, 0xbb2: 0x00c0, 0xbb3: 0x00c0, 0xbb5: 0x00c0, + 0xbb6: 0x00c0, 0xbb7: 0x00c0, 0xbb8: 0x00c0, 0xbb9: 0x00c0, + 0xbbc: 0x00c3, 0xbbd: 0x00c0, 0xbbe: 0x00c0, 0xbbf: 0x00c3, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x00c0, 0xbc1: 0x00c0, 0xbc2: 0x00c0, 0xbc3: 0x00c0, 0xbc4: 0x00c0, + 0xbc6: 0x00c3, 0xbc7: 0x00c0, 0xbc8: 0x00c0, 0xbca: 0x00c0, 0xbcb: 0x00c0, + 0xbcc: 0x00c3, 0xbcd: 0x00c6, + 0xbd5: 0x00c0, 0xbd6: 0x00c0, + 0xbdd: 0x00c0, + 0xbde: 0x00c0, 0xbe0: 0x00c0, 0xbe1: 0x00c0, 0xbe2: 0x00c3, 0xbe3: 0x00c3, + 0xbe6: 0x00c0, 0xbe7: 0x00c0, 0xbe8: 0x00c0, 0xbe9: 0x00c0, + 0xbea: 0x00c0, 0xbeb: 0x00c0, 0xbec: 0x00c0, 0xbed: 0x00c0, 0xbee: 0x00c0, 0xbef: 0x00c0, + 0xbf1: 0x00c0, 0xbf2: 0x00c0, 0xbf3: 0x00c0, + // Block 0x30, offset 0xc00 + 0xc00: 0x00c3, 0xc01: 0x00c3, 0xc02: 0x00c0, 0xc03: 0x00c0, 0xc04: 0x00c0, 0xc05: 0x00c0, + 0xc06: 0x00c0, 0xc07: 0x00c0, 0xc08: 0x00c0, 0xc09: 0x00c0, 0xc0a: 0x00c0, 0xc0b: 0x00c0, + 0xc0c: 0x00c0, 0xc0e: 0x00c0, 0xc0f: 0x00c0, 0xc10: 0x00c0, + 0xc12: 0x00c0, 0xc13: 0x00c0, 0xc14: 0x00c0, 0xc15: 0x00c0, 0xc16: 0x00c0, 0xc17: 0x00c0, + 0xc18: 0x00c0, 0xc19: 0x00c0, 0xc1a: 0x00c0, 0xc1b: 0x00c0, 0xc1c: 0x00c0, 0xc1d: 0x00c0, + 0xc1e: 0x00c0, 0xc1f: 0x00c0, 0xc20: 0x00c0, 0xc21: 0x00c0, 0xc22: 0x00c0, 0xc23: 0x00c0, + 0xc24: 0x00c0, 0xc25: 0x00c0, 0xc26: 0x00c0, 0xc27: 0x00c0, 0xc28: 0x00c0, 0xc29: 0x00c0, + 0xc2a: 0x00c0, 0xc2b: 0x00c0, 0xc2c: 0x00c0, 0xc2d: 0x00c0, 0xc2e: 0x00c0, 0xc2f: 0x00c0, + 0xc30: 0x00c0, 0xc31: 0x00c0, 0xc32: 0x00c0, 0xc33: 0x00c0, 0xc34: 0x00c0, 0xc35: 0x00c0, + 0xc36: 0x00c0, 0xc37: 0x00c0, 0xc38: 0x00c0, 0xc39: 0x00c0, 0xc3a: 0x00c0, 0xc3b: 0x00c6, + 0xc3c: 0x00c6, 0xc3d: 0x00c0, 0xc3e: 0x00c0, 0xc3f: 0x00c0, + // Block 0x31, offset 0xc40 + 0xc40: 0x00c0, 0xc41: 0x00c3, 0xc42: 0x00c3, 0xc43: 0x00c3, 0xc44: 0x00c3, + 0xc46: 0x00c0, 0xc47: 0x00c0, 0xc48: 0x00c0, 0xc4a: 0x00c0, 0xc4b: 0x00c0, + 0xc4c: 0x00c0, 0xc4d: 0x00c6, 0xc4e: 0x00c0, 0xc4f: 0x0080, + 0xc54: 0x00c0, 0xc55: 0x00c0, 0xc56: 0x00c0, 0xc57: 0x00c0, + 0xc58: 0x0080, 0xc59: 0x0080, 0xc5a: 0x0080, 0xc5b: 0x0080, 0xc5c: 0x0080, 0xc5d: 0x0080, + 0xc5e: 0x0080, 0xc5f: 0x00c0, 0xc60: 0x00c0, 0xc61: 0x00c0, 0xc62: 0x00c3, 0xc63: 0x00c3, + 0xc66: 0x00c0, 0xc67: 0x00c0, 0xc68: 0x00c0, 0xc69: 0x00c0, + 0xc6a: 0x00c0, 0xc6b: 0x00c0, 0xc6c: 0x00c0, 0xc6d: 0x00c0, 0xc6e: 0x00c0, 0xc6f: 0x00c0, + 0xc70: 0x0080, 0xc71: 0x0080, 0xc72: 0x0080, 0xc73: 0x0080, 0xc74: 0x0080, 0xc75: 0x0080, + 0xc76: 0x0080, 0xc77: 0x0080, 0xc78: 0x0080, 0xc79: 0x0080, 0xc7a: 0x00c0, 0xc7b: 0x00c0, + 0xc7c: 0x00c0, 0xc7d: 0x00c0, 0xc7e: 0x00c0, 0xc7f: 0x00c0, + // Block 0x32, offset 0xc80 + 0xc81: 0x00c3, 0xc82: 0x00c0, 0xc83: 0x00c0, 0xc85: 0x00c0, + 0xc86: 0x00c0, 0xc87: 0x00c0, 0xc88: 0x00c0, 0xc89: 0x00c0, 0xc8a: 0x00c0, 0xc8b: 0x00c0, + 0xc8c: 0x00c0, 0xc8d: 0x00c0, 0xc8e: 0x00c0, 0xc8f: 0x00c0, 0xc90: 0x00c0, 0xc91: 0x00c0, + 0xc92: 0x00c0, 0xc93: 0x00c0, 0xc94: 0x00c0, 0xc95: 0x00c0, 0xc96: 0x00c0, + 0xc9a: 0x00c0, 0xc9b: 0x00c0, 0xc9c: 0x00c0, 0xc9d: 0x00c0, + 0xc9e: 0x00c0, 0xc9f: 0x00c0, 0xca0: 0x00c0, 0xca1: 0x00c0, 0xca2: 0x00c0, 0xca3: 0x00c0, + 0xca4: 0x00c0, 0xca5: 0x00c0, 0xca6: 0x00c0, 0xca7: 0x00c0, 0xca8: 0x00c0, 0xca9: 0x00c0, + 0xcaa: 0x00c0, 0xcab: 0x00c0, 0xcac: 0x00c0, 0xcad: 0x00c0, 0xcae: 0x00c0, 0xcaf: 0x00c0, + 0xcb0: 0x00c0, 0xcb1: 0x00c0, 0xcb3: 0x00c0, 0xcb4: 0x00c0, 0xcb5: 0x00c0, + 0xcb6: 0x00c0, 0xcb7: 0x00c0, 0xcb8: 0x00c0, 0xcb9: 0x00c0, 0xcba: 0x00c0, 0xcbb: 0x00c0, + 0xcbd: 0x00c0, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x00c0, 0xcc1: 0x00c0, 0xcc2: 0x00c0, 0xcc3: 0x00c0, 0xcc4: 0x00c0, 0xcc5: 0x00c0, + 0xcc6: 0x00c0, 0xcca: 0x00c6, + 0xccf: 0x00c0, 0xcd0: 0x00c0, 0xcd1: 0x00c0, + 0xcd2: 0x00c3, 0xcd3: 0x00c3, 0xcd4: 0x00c3, 0xcd6: 0x00c3, + 0xcd8: 0x00c0, 0xcd9: 0x00c0, 0xcda: 0x00c0, 0xcdb: 0x00c0, 0xcdc: 0x00c0, 0xcdd: 0x00c0, + 0xcde: 0x00c0, 0xcdf: 0x00c0, + 0xce6: 0x00c0, 0xce7: 0x00c0, 0xce8: 0x00c0, 0xce9: 0x00c0, + 0xcea: 0x00c0, 0xceb: 0x00c0, 0xcec: 0x00c0, 0xced: 0x00c0, 0xcee: 0x00c0, 0xcef: 0x00c0, + 0xcf2: 0x00c0, 0xcf3: 0x00c0, 0xcf4: 0x0080, + // Block 0x34, offset 0xd00 + 0xd01: 0x00c0, 0xd02: 0x00c0, 0xd03: 0x00c0, 0xd04: 0x00c0, 0xd05: 0x00c0, + 0xd06: 0x00c0, 0xd07: 0x00c0, 0xd08: 0x00c0, 0xd09: 0x00c0, 0xd0a: 0x00c0, 0xd0b: 0x00c0, + 0xd0c: 0x00c0, 0xd0d: 0x00c0, 0xd0e: 0x00c0, 0xd0f: 0x00c0, 0xd10: 0x00c0, 0xd11: 0x00c0, + 0xd12: 0x00c0, 0xd13: 0x00c0, 0xd14: 0x00c0, 0xd15: 0x00c0, 0xd16: 0x00c0, 0xd17: 0x00c0, + 0xd18: 0x00c0, 0xd19: 0x00c0, 0xd1a: 0x00c0, 0xd1b: 0x00c0, 0xd1c: 0x00c0, 0xd1d: 0x00c0, + 0xd1e: 0x00c0, 0xd1f: 0x00c0, 0xd20: 0x00c0, 0xd21: 0x00c0, 0xd22: 0x00c0, 0xd23: 0x00c0, + 0xd24: 0x00c0, 0xd25: 0x00c0, 0xd26: 0x00c0, 0xd27: 0x00c0, 0xd28: 0x00c0, 0xd29: 0x00c0, + 0xd2a: 0x00c0, 0xd2b: 0x00c0, 0xd2c: 0x00c0, 0xd2d: 0x00c0, 0xd2e: 0x00c0, 0xd2f: 0x00c0, + 0xd30: 0x00c0, 0xd31: 0x00c3, 0xd32: 0x00c0, 0xd33: 0x0080, 0xd34: 0x00c3, 0xd35: 0x00c3, + 0xd36: 0x00c3, 0xd37: 0x00c3, 0xd38: 0x00c3, 0xd39: 0x00c3, 0xd3a: 0x00c6, + 0xd3f: 0x0080, + // Block 0x35, offset 0xd40 + 0xd40: 0x00c0, 0xd41: 0x00c0, 0xd42: 0x00c0, 0xd43: 0x00c0, 0xd44: 0x00c0, 0xd45: 0x00c0, + 0xd46: 0x00c0, 0xd47: 0x00c3, 0xd48: 0x00c3, 0xd49: 0x00c3, 0xd4a: 0x00c3, 0xd4b: 0x00c3, + 0xd4c: 0x00c3, 0xd4d: 0x00c3, 0xd4e: 0x00c3, 0xd4f: 0x0080, 0xd50: 0x00c0, 0xd51: 0x00c0, + 0xd52: 0x00c0, 0xd53: 0x00c0, 0xd54: 0x00c0, 0xd55: 0x00c0, 0xd56: 0x00c0, 0xd57: 0x00c0, + 0xd58: 0x00c0, 0xd59: 0x00c0, 0xd5a: 0x0080, 0xd5b: 0x0080, + // Block 0x36, offset 0xd80 + 0xd81: 0x00c0, 0xd82: 0x00c0, 0xd84: 0x00c0, + 0xd86: 0x00c0, 0xd87: 0x00c0, 0xd88: 0x00c0, 0xd89: 0x00c0, 0xd8a: 0x00c0, + 0xd8c: 0x00c0, 0xd8d: 0x00c0, 0xd8e: 0x00c0, 0xd8f: 0x00c0, 0xd90: 0x00c0, 0xd91: 0x00c0, + 0xd92: 0x00c0, 0xd93: 0x00c0, 0xd94: 0x00c0, 0xd95: 0x00c0, 0xd96: 0x00c0, 0xd97: 0x00c0, + 0xd98: 0x00c0, 0xd99: 0x00c0, 0xd9a: 0x00c0, 0xd9b: 0x00c0, 0xd9c: 0x00c0, 0xd9d: 0x00c0, + 0xd9e: 0x00c0, 0xd9f: 0x00c0, 0xda0: 0x00c0, 0xda1: 0x00c0, 0xda2: 0x00c0, 0xda3: 0x00c0, + 0xda5: 0x00c0, 0xda7: 0x00c0, 0xda8: 0x00c0, 0xda9: 0x00c0, + 0xdaa: 0x00c0, 0xdab: 0x00c0, 0xdac: 0x00c0, 0xdad: 0x00c0, 0xdae: 0x00c0, 0xdaf: 0x00c0, + 0xdb0: 0x00c0, 0xdb1: 0x00c3, 0xdb2: 0x00c0, 0xdb3: 0x0080, 0xdb4: 0x00c3, 0xdb5: 0x00c3, + 0xdb6: 0x00c3, 0xdb7: 0x00c3, 0xdb8: 0x00c3, 0xdb9: 0x00c3, 0xdba: 0x00c6, 0xdbb: 0x00c3, + 0xdbc: 0x00c3, 0xdbd: 0x00c0, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x00c0, 0xdc1: 0x00c0, 0xdc2: 0x00c0, 0xdc3: 0x00c0, 0xdc4: 0x00c0, + 0xdc6: 0x00c0, 0xdc8: 0x00c3, 0xdc9: 0x00c3, 0xdca: 0x00c3, 0xdcb: 0x00c3, + 0xdcc: 0x00c3, 0xdcd: 0x00c3, 0xdce: 0x00c3, 0xdd0: 0x00c0, 0xdd1: 0x00c0, + 0xdd2: 0x00c0, 0xdd3: 0x00c0, 0xdd4: 0x00c0, 0xdd5: 0x00c0, 0xdd6: 0x00c0, 0xdd7: 0x00c0, + 0xdd8: 0x00c0, 0xdd9: 0x00c0, 0xddc: 0x0080, 0xddd: 0x0080, + 0xdde: 0x00c0, 0xddf: 0x00c0, + // Block 0x38, offset 0xe00 + 0xe00: 0x00c0, 0xe01: 0x0080, 0xe02: 0x0080, 0xe03: 0x0080, 0xe04: 0x0080, 0xe05: 0x0080, + 0xe06: 0x0080, 0xe07: 0x0080, 0xe08: 0x0080, 0xe09: 0x0080, 0xe0a: 0x0080, 0xe0b: 0x00c0, + 0xe0c: 0x0080, 0xe0d: 0x0080, 0xe0e: 0x0080, 0xe0f: 0x0080, 0xe10: 0x0080, 0xe11: 0x0080, + 0xe12: 0x0080, 0xe13: 0x0080, 0xe14: 0x0080, 0xe15: 0x0080, 0xe16: 0x0080, 0xe17: 0x0080, + 0xe18: 0x00c3, 0xe19: 0x00c3, 0xe1a: 0x0080, 0xe1b: 0x0080, 0xe1c: 0x0080, 0xe1d: 0x0080, + 0xe1e: 0x0080, 0xe1f: 0x0080, 0xe20: 0x00c0, 0xe21: 0x00c0, 0xe22: 0x00c0, 0xe23: 0x00c0, + 0xe24: 0x00c0, 0xe25: 0x00c0, 0xe26: 0x00c0, 0xe27: 0x00c0, 0xe28: 0x00c0, 0xe29: 0x00c0, + 0xe2a: 0x0080, 0xe2b: 0x0080, 0xe2c: 0x0080, 0xe2d: 0x0080, 0xe2e: 0x0080, 0xe2f: 0x0080, + 0xe30: 0x0080, 0xe31: 0x0080, 0xe32: 0x0080, 0xe33: 0x0080, 0xe34: 0x0080, 0xe35: 0x00c3, + 0xe36: 0x0080, 0xe37: 0x00c3, 0xe38: 0x0080, 0xe39: 0x00c3, 0xe3a: 0x0080, 0xe3b: 0x0080, + 0xe3c: 0x0080, 0xe3d: 0x0080, 0xe3e: 0x00c0, 0xe3f: 0x00c0, + // Block 0x39, offset 0xe40 + 0xe40: 0x00c0, 0xe41: 0x00c0, 0xe42: 0x00c0, 0xe43: 0x0080, 0xe44: 0x00c0, 0xe45: 0x00c0, + 0xe46: 0x00c0, 0xe47: 0x00c0, 0xe49: 0x00c0, 0xe4a: 0x00c0, 0xe4b: 0x00c0, + 0xe4c: 0x00c0, 0xe4d: 0x0080, 0xe4e: 0x00c0, 0xe4f: 0x00c0, 0xe50: 0x00c0, 0xe51: 0x00c0, + 0xe52: 0x0080, 0xe53: 0x00c0, 0xe54: 0x00c0, 0xe55: 0x00c0, 0xe56: 0x00c0, 0xe57: 0x0080, + 0xe58: 0x00c0, 0xe59: 0x00c0, 0xe5a: 0x00c0, 0xe5b: 0x00c0, 0xe5c: 0x0080, 0xe5d: 0x00c0, + 0xe5e: 0x00c0, 0xe5f: 0x00c0, 0xe60: 0x00c0, 0xe61: 0x00c0, 0xe62: 0x00c0, 0xe63: 0x00c0, + 0xe64: 0x00c0, 0xe65: 0x00c0, 0xe66: 0x00c0, 0xe67: 0x00c0, 0xe68: 0x00c0, 0xe69: 0x0080, + 0xe6a: 0x00c0, 0xe6b: 0x00c0, 0xe6c: 0x00c0, + 0xe71: 0x00c3, 0xe72: 0x00c3, 0xe73: 0x0083, 0xe74: 0x00c3, 0xe75: 0x0083, + 0xe76: 0x0083, 0xe77: 0x0083, 0xe78: 0x0083, 0xe79: 0x0083, 0xe7a: 0x00c3, 0xe7b: 0x00c3, + 0xe7c: 0x00c3, 0xe7d: 0x00c3, 0xe7e: 0x00c3, 0xe7f: 0x00c0, + // Block 0x3a, offset 0xe80 + 0xe80: 0x00c3, 0xe81: 0x0083, 0xe82: 0x00c3, 0xe83: 0x00c3, 0xe84: 0x00c6, 0xe85: 0x0080, + 0xe86: 0x00c3, 0xe87: 0x00c3, 0xe88: 0x00c0, 0xe89: 0x00c0, 0xe8a: 0x00c0, 0xe8b: 0x00c0, + 0xe8c: 0x00c0, 0xe8d: 0x00c3, 0xe8e: 0x00c3, 0xe8f: 0x00c3, 0xe90: 0x00c3, 0xe91: 0x00c3, + 0xe92: 0x00c3, 0xe93: 0x0083, 0xe94: 0x00c3, 0xe95: 0x00c3, 0xe96: 0x00c3, 0xe97: 0x00c3, + 0xe99: 0x00c3, 0xe9a: 0x00c3, 0xe9b: 0x00c3, 0xe9c: 0x00c3, 0xe9d: 0x0083, + 0xe9e: 0x00c3, 0xe9f: 0x00c3, 0xea0: 0x00c3, 0xea1: 0x00c3, 0xea2: 0x0083, 0xea3: 0x00c3, + 0xea4: 0x00c3, 0xea5: 0x00c3, 0xea6: 0x00c3, 0xea7: 0x0083, 0xea8: 0x00c3, 0xea9: 0x00c3, + 0xeaa: 0x00c3, 0xeab: 0x00c3, 0xeac: 0x0083, 0xead: 0x00c3, 0xeae: 0x00c3, 0xeaf: 0x00c3, + 0xeb0: 0x00c3, 0xeb1: 0x00c3, 0xeb2: 0x00c3, 0xeb3: 0x00c3, 0xeb4: 0x00c3, 0xeb5: 0x00c3, + 0xeb6: 0x00c3, 0xeb7: 0x00c3, 0xeb8: 0x00c3, 0xeb9: 0x0083, 0xeba: 0x00c3, 0xebb: 0x00c3, + 0xebc: 0x00c3, 0xebe: 0x0080, 0xebf: 0x0080, + // Block 0x3b, offset 0xec0 + 0xec0: 0x0080, 0xec1: 0x0080, 0xec2: 0x0080, 0xec3: 0x0080, 0xec4: 0x0080, 0xec5: 0x0080, + 0xec6: 0x00c3, 0xec7: 0x0080, 0xec8: 0x0080, 0xec9: 0x0080, 0xeca: 0x0080, 0xecb: 0x0080, + 0xecc: 0x0080, 0xece: 0x0080, 0xecf: 0x0080, 0xed0: 0x0080, 0xed1: 0x0080, + 0xed2: 0x0080, 0xed3: 0x0080, 0xed4: 0x0080, 0xed5: 0x0080, 0xed6: 0x0080, 0xed7: 0x0080, + 0xed8: 0x0080, 0xed9: 0x0080, 0xeda: 0x0080, + // Block 0x3c, offset 0xf00 + 0xf00: 0x00c0, 0xf01: 0x00c0, 0xf02: 0x00c0, 0xf03: 0x00c0, 0xf04: 0x00c0, 0xf05: 0x00c0, + 0xf06: 0x00c0, 0xf07: 0x00c0, 0xf08: 0x00c0, 0xf09: 0x00c0, 0xf0a: 0x00c0, 0xf0b: 0x00c0, + 0xf0c: 0x00c0, 0xf0d: 0x00c0, 0xf0e: 0x00c0, 0xf0f: 0x00c0, 0xf10: 0x00c0, 0xf11: 0x00c0, + 0xf12: 0x00c0, 0xf13: 0x00c0, 0xf14: 0x00c0, 0xf15: 0x00c0, 0xf16: 0x00c0, 0xf17: 0x00c0, + 0xf18: 0x00c0, 0xf19: 0x00c0, 0xf1a: 0x00c0, 0xf1b: 0x00c0, 0xf1c: 0x00c0, 0xf1d: 0x00c0, + 0xf1e: 0x00c0, 0xf1f: 0x00c0, 0xf20: 0x00c0, 0xf21: 0x00c0, 0xf22: 0x00c0, 0xf23: 0x00c0, + 0xf24: 0x00c0, 0xf25: 0x00c0, 0xf26: 0x00c0, 0xf27: 0x00c0, 0xf28: 0x00c0, 0xf29: 0x00c0, + 0xf2a: 0x00c0, 0xf2b: 0x00c0, 0xf2c: 0x00c0, 0xf2d: 0x00c3, 0xf2e: 0x00c3, 0xf2f: 0x00c3, + 0xf30: 0x00c3, 0xf31: 0x00c0, 0xf32: 0x00c3, 0xf33: 0x00c3, 0xf34: 0x00c3, 0xf35: 0x00c3, + 0xf36: 0x00c3, 0xf37: 0x00c3, 0xf38: 0x00c0, 0xf39: 0x00c6, 0xf3a: 0x00c6, 0xf3b: 0x00c0, + 0xf3c: 0x00c0, 0xf3d: 0x00c3, 0xf3e: 0x00c3, 0xf3f: 0x00c0, + // Block 0x3d, offset 0xf40 + 0xf40: 0x00c0, 0xf41: 0x00c0, 0xf42: 0x00c0, 0xf43: 0x00c0, 0xf44: 0x00c0, 0xf45: 0x00c0, + 0xf46: 0x00c0, 0xf47: 0x00c0, 0xf48: 0x00c0, 0xf49: 0x00c0, 0xf4a: 0x0080, 0xf4b: 0x0080, + 0xf4c: 0x0080, 0xf4d: 0x0080, 0xf4e: 0x0080, 0xf4f: 0x0080, 0xf50: 0x00c0, 0xf51: 0x00c0, + 0xf52: 0x00c0, 0xf53: 0x00c0, 0xf54: 0x00c0, 0xf55: 0x00c0, 0xf56: 0x00c0, 0xf57: 0x00c0, + 0xf58: 0x00c3, 0xf59: 0x00c3, 0xf5a: 0x00c0, 0xf5b: 0x00c0, 0xf5c: 0x00c0, 0xf5d: 0x00c0, + 0xf5e: 0x00c3, 0xf5f: 0x00c3, 0xf60: 0x00c3, 0xf61: 0x00c0, 0xf62: 0x00c0, 0xf63: 0x00c0, + 0xf64: 0x00c0, 0xf65: 0x00c0, 0xf66: 0x00c0, 0xf67: 0x00c0, 0xf68: 0x00c0, 0xf69: 0x00c0, + 0xf6a: 0x00c0, 0xf6b: 0x00c0, 0xf6c: 0x00c0, 0xf6d: 0x00c0, 0xf6e: 0x00c0, 0xf6f: 0x00c0, + 0xf70: 0x00c0, 0xf71: 0x00c3, 0xf72: 0x00c3, 0xf73: 0x00c3, 0xf74: 0x00c3, 0xf75: 0x00c0, + 0xf76: 0x00c0, 0xf77: 0x00c0, 0xf78: 0x00c0, 0xf79: 0x00c0, 0xf7a: 0x00c0, 0xf7b: 0x00c0, + 0xf7c: 0x00c0, 0xf7d: 0x00c0, 0xf7e: 0x00c0, 0xf7f: 0x00c0, + // Block 0x3e, offset 0xf80 + 0xf80: 0x00c0, 0xf81: 0x00c0, 0xf82: 0x00c3, 0xf83: 0x00c0, 0xf84: 0x00c0, 0xf85: 0x00c3, + 0xf86: 0x00c3, 0xf87: 0x00c0, 0xf88: 0x00c0, 0xf89: 0x00c0, 0xf8a: 0x00c0, 0xf8b: 0x00c0, + 0xf8c: 0x00c0, 0xf8d: 0x00c3, 0xf8e: 0x00c0, 0xf8f: 0x00c0, 0xf90: 0x00c0, 0xf91: 0x00c0, + 0xf92: 0x00c0, 0xf93: 0x00c0, 0xf94: 0x00c0, 0xf95: 0x00c0, 0xf96: 0x00c0, 0xf97: 0x00c0, + 0xf98: 0x00c0, 0xf99: 0x00c0, 0xf9a: 0x00c0, 0xf9b: 0x00c0, 0xf9c: 0x00c0, 0xf9d: 0x00c3, + 0xf9e: 0x0080, 0xf9f: 0x0080, 0xfa0: 0x00c0, 0xfa1: 0x00c0, 0xfa2: 0x00c0, 0xfa3: 0x00c0, + 0xfa4: 0x00c0, 0xfa5: 0x00c0, 0xfa6: 0x00c0, 0xfa7: 0x00c0, 0xfa8: 0x00c0, 0xfa9: 0x00c0, + 0xfaa: 0x00c0, 0xfab: 0x00c0, 0xfac: 0x00c0, 0xfad: 0x00c0, 0xfae: 0x00c0, 0xfaf: 0x00c0, + 0xfb0: 0x00c0, 0xfb1: 0x00c0, 0xfb2: 0x00c0, 0xfb3: 0x00c0, 0xfb4: 0x00c0, 0xfb5: 0x00c0, + 0xfb6: 0x00c0, 0xfb7: 0x00c0, 0xfb8: 0x00c0, 0xfb9: 0x00c0, 0xfba: 0x00c0, 0xfbb: 0x00c0, + 0xfbc: 0x00c0, 0xfbd: 0x00c0, 0xfbe: 0x00c0, 0xfbf: 0x00c0, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x00c0, 0xfc1: 0x00c0, 0xfc2: 0x00c0, 0xfc3: 0x00c0, 0xfc4: 0x00c0, 0xfc5: 0x00c0, + 0xfc7: 0x00c0, + 0xfcd: 0x00c0, 0xfd0: 0x00c0, 0xfd1: 0x00c0, + 0xfd2: 0x00c0, 0xfd3: 0x00c0, 0xfd4: 0x00c0, 0xfd5: 0x00c0, 0xfd6: 0x00c0, 0xfd7: 0x00c0, + 0xfd8: 0x00c0, 0xfd9: 0x00c0, 0xfda: 0x00c0, 0xfdb: 0x00c0, 0xfdc: 0x00c0, 0xfdd: 0x00c0, + 0xfde: 0x00c0, 0xfdf: 0x00c0, 0xfe0: 0x00c0, 0xfe1: 0x00c0, 0xfe2: 0x00c0, 0xfe3: 0x00c0, + 0xfe4: 0x00c0, 0xfe5: 0x00c0, 0xfe6: 0x00c0, 0xfe7: 0x00c0, 0xfe8: 0x00c0, 0xfe9: 0x00c0, + 0xfea: 0x00c0, 0xfeb: 0x00c0, 0xfec: 0x00c0, 0xfed: 0x00c0, 0xfee: 0x00c0, 0xfef: 0x00c0, + 0xff0: 0x00c0, 0xff1: 0x00c0, 0xff2: 0x00c0, 0xff3: 0x00c0, 0xff4: 0x00c0, 0xff5: 0x00c0, + 0xff6: 0x00c0, 0xff7: 0x00c0, 0xff8: 0x00c0, 0xff9: 0x00c0, 0xffa: 0x00c0, 0xffb: 0x0080, + 0xffc: 0x0080, 0xffd: 0x00c0, 0xffe: 0x00c0, 0xfff: 0x00c0, + // Block 0x40, offset 0x1000 + 0x1000: 0x0040, 0x1001: 0x0040, 0x1002: 0x0040, 0x1003: 0x0040, 0x1004: 0x0040, 0x1005: 0x0040, + 0x1006: 0x0040, 0x1007: 0x0040, 0x1008: 0x0040, 0x1009: 0x0040, 0x100a: 0x0040, 0x100b: 0x0040, + 0x100c: 0x0040, 0x100d: 0x0040, 0x100e: 0x0040, 0x100f: 0x0040, 0x1010: 0x0040, 0x1011: 0x0040, + 0x1012: 0x0040, 0x1013: 0x0040, 0x1014: 0x0040, 0x1015: 0x0040, 0x1016: 0x0040, 0x1017: 0x0040, + 0x1018: 0x0040, 0x1019: 0x0040, 0x101a: 0x0040, 0x101b: 0x0040, 0x101c: 0x0040, 0x101d: 0x0040, + 0x101e: 0x0040, 0x101f: 0x0040, 0x1020: 0x0040, 0x1021: 0x0040, 0x1022: 0x0040, 0x1023: 0x0040, + 0x1024: 0x0040, 0x1025: 0x0040, 0x1026: 0x0040, 0x1027: 0x0040, 0x1028: 0x0040, 0x1029: 0x0040, + 0x102a: 0x0040, 0x102b: 0x0040, 0x102c: 0x0040, 0x102d: 0x0040, 0x102e: 0x0040, 0x102f: 0x0040, + 0x1030: 0x0040, 0x1031: 0x0040, 0x1032: 0x0040, 0x1033: 0x0040, 0x1034: 0x0040, 0x1035: 0x0040, + 0x1036: 0x0040, 0x1037: 0x0040, 0x1038: 0x0040, 0x1039: 0x0040, 0x103a: 0x0040, 0x103b: 0x0040, + 0x103c: 0x0040, 0x103d: 0x0040, 0x103e: 0x0040, 0x103f: 0x0040, + // Block 0x41, offset 0x1040 + 0x1040: 0x00c0, 0x1041: 0x00c0, 0x1042: 0x00c0, 0x1043: 0x00c0, 0x1044: 0x00c0, 0x1045: 0x00c0, + 0x1046: 0x00c0, 0x1047: 0x00c0, 0x1048: 0x00c0, 0x104a: 0x00c0, 0x104b: 0x00c0, + 0x104c: 0x00c0, 0x104d: 0x00c0, 0x1050: 0x00c0, 0x1051: 0x00c0, + 0x1052: 0x00c0, 0x1053: 0x00c0, 0x1054: 0x00c0, 0x1055: 0x00c0, 0x1056: 0x00c0, + 0x1058: 0x00c0, 0x105a: 0x00c0, 0x105b: 0x00c0, 0x105c: 0x00c0, 0x105d: 0x00c0, + 0x1060: 0x00c0, 0x1061: 0x00c0, 0x1062: 0x00c0, 0x1063: 0x00c0, + 0x1064: 0x00c0, 0x1065: 0x00c0, 0x1066: 0x00c0, 0x1067: 0x00c0, 0x1068: 0x00c0, 0x1069: 0x00c0, + 0x106a: 0x00c0, 0x106b: 0x00c0, 0x106c: 0x00c0, 0x106d: 0x00c0, 0x106e: 0x00c0, 0x106f: 0x00c0, + 0x1070: 0x00c0, 0x1071: 0x00c0, 0x1072: 0x00c0, 0x1073: 0x00c0, 0x1074: 0x00c0, 0x1075: 0x00c0, + 0x1076: 0x00c0, 0x1077: 0x00c0, 0x1078: 0x00c0, 0x1079: 0x00c0, 0x107a: 0x00c0, 0x107b: 0x00c0, + 0x107c: 0x00c0, 0x107d: 0x00c0, 0x107e: 0x00c0, 0x107f: 0x00c0, + // Block 0x42, offset 0x1080 + 0x1080: 0x00c0, 0x1081: 0x00c0, 0x1082: 0x00c0, 0x1083: 0x00c0, 0x1084: 0x00c0, 0x1085: 0x00c0, + 0x1086: 0x00c0, 0x1087: 0x00c0, 0x1088: 0x00c0, 0x108a: 0x00c0, 0x108b: 0x00c0, + 0x108c: 0x00c0, 0x108d: 0x00c0, 0x1090: 0x00c0, 0x1091: 0x00c0, + 0x1092: 0x00c0, 0x1093: 0x00c0, 0x1094: 0x00c0, 0x1095: 0x00c0, 0x1096: 0x00c0, 0x1097: 0x00c0, + 0x1098: 0x00c0, 0x1099: 0x00c0, 0x109a: 0x00c0, 0x109b: 0x00c0, 0x109c: 0x00c0, 0x109d: 0x00c0, + 0x109e: 0x00c0, 0x109f: 0x00c0, 0x10a0: 0x00c0, 0x10a1: 0x00c0, 0x10a2: 0x00c0, 0x10a3: 0x00c0, + 0x10a4: 0x00c0, 0x10a5: 0x00c0, 0x10a6: 0x00c0, 0x10a7: 0x00c0, 0x10a8: 0x00c0, 0x10a9: 0x00c0, + 0x10aa: 0x00c0, 0x10ab: 0x00c0, 0x10ac: 0x00c0, 0x10ad: 0x00c0, 0x10ae: 0x00c0, 0x10af: 0x00c0, + 0x10b0: 0x00c0, 0x10b2: 0x00c0, 0x10b3: 0x00c0, 0x10b4: 0x00c0, 0x10b5: 0x00c0, + 0x10b8: 0x00c0, 0x10b9: 0x00c0, 0x10ba: 0x00c0, 0x10bb: 0x00c0, + 0x10bc: 0x00c0, 0x10bd: 0x00c0, 0x10be: 0x00c0, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x00c0, 0x10c2: 0x00c0, 0x10c3: 0x00c0, 0x10c4: 0x00c0, 0x10c5: 0x00c0, + 0x10c8: 0x00c0, 0x10c9: 0x00c0, 0x10ca: 0x00c0, 0x10cb: 0x00c0, + 0x10cc: 0x00c0, 0x10cd: 0x00c0, 0x10ce: 0x00c0, 0x10cf: 0x00c0, 0x10d0: 0x00c0, 0x10d1: 0x00c0, + 0x10d2: 0x00c0, 0x10d3: 0x00c0, 0x10d4: 0x00c0, 0x10d5: 0x00c0, 0x10d6: 0x00c0, + 0x10d8: 0x00c0, 0x10d9: 0x00c0, 0x10da: 0x00c0, 0x10db: 0x00c0, 0x10dc: 0x00c0, 0x10dd: 0x00c0, + 0x10de: 0x00c0, 0x10df: 0x00c0, 0x10e0: 0x00c0, 0x10e1: 0x00c0, 0x10e2: 0x00c0, 0x10e3: 0x00c0, + 0x10e4: 0x00c0, 0x10e5: 0x00c0, 0x10e6: 0x00c0, 0x10e7: 0x00c0, 0x10e8: 0x00c0, 0x10e9: 0x00c0, + 0x10ea: 0x00c0, 0x10eb: 0x00c0, 0x10ec: 0x00c0, 0x10ed: 0x00c0, 0x10ee: 0x00c0, 0x10ef: 0x00c0, + 0x10f0: 0x00c0, 0x10f1: 0x00c0, 0x10f2: 0x00c0, 0x10f3: 0x00c0, 0x10f4: 0x00c0, 0x10f5: 0x00c0, + 0x10f6: 0x00c0, 0x10f7: 0x00c0, 0x10f8: 0x00c0, 0x10f9: 0x00c0, 0x10fa: 0x00c0, 0x10fb: 0x00c0, + 0x10fc: 0x00c0, 0x10fd: 0x00c0, 0x10fe: 0x00c0, 0x10ff: 0x00c0, + // Block 0x44, offset 0x1100 + 0x1100: 0x00c0, 0x1101: 0x00c0, 0x1102: 0x00c0, 0x1103: 0x00c0, 0x1104: 0x00c0, 0x1105: 0x00c0, + 0x1106: 0x00c0, 0x1107: 0x00c0, 0x1108: 0x00c0, 0x1109: 0x00c0, 0x110a: 0x00c0, 0x110b: 0x00c0, + 0x110c: 0x00c0, 0x110d: 0x00c0, 0x110e: 0x00c0, 0x110f: 0x00c0, 0x1110: 0x00c0, + 0x1112: 0x00c0, 0x1113: 0x00c0, 0x1114: 0x00c0, 0x1115: 0x00c0, + 0x1118: 0x00c0, 0x1119: 0x00c0, 0x111a: 0x00c0, 0x111b: 0x00c0, 0x111c: 0x00c0, 0x111d: 0x00c0, + 0x111e: 0x00c0, 0x111f: 0x00c0, 0x1120: 0x00c0, 0x1121: 0x00c0, 0x1122: 0x00c0, 0x1123: 0x00c0, + 0x1124: 0x00c0, 0x1125: 0x00c0, 0x1126: 0x00c0, 0x1127: 0x00c0, 0x1128: 0x00c0, 0x1129: 0x00c0, + 0x112a: 0x00c0, 0x112b: 0x00c0, 0x112c: 0x00c0, 0x112d: 0x00c0, 0x112e: 0x00c0, 0x112f: 0x00c0, + 0x1130: 0x00c0, 0x1131: 0x00c0, 0x1132: 0x00c0, 0x1133: 0x00c0, 0x1134: 0x00c0, 0x1135: 0x00c0, + 0x1136: 0x00c0, 0x1137: 0x00c0, 0x1138: 0x00c0, 0x1139: 0x00c0, 0x113a: 0x00c0, 0x113b: 0x00c0, + 0x113c: 0x00c0, 0x113d: 0x00c0, 0x113e: 0x00c0, 0x113f: 0x00c0, + // Block 0x45, offset 0x1140 + 0x1140: 0x00c0, 0x1141: 0x00c0, 0x1142: 0x00c0, 0x1143: 0x00c0, 0x1144: 0x00c0, 0x1145: 0x00c0, + 0x1146: 0x00c0, 0x1147: 0x00c0, 0x1148: 0x00c0, 0x1149: 0x00c0, 0x114a: 0x00c0, 0x114b: 0x00c0, + 0x114c: 0x00c0, 0x114d: 0x00c0, 0x114e: 0x00c0, 0x114f: 0x00c0, 0x1150: 0x00c0, 0x1151: 0x00c0, + 0x1152: 0x00c0, 0x1153: 0x00c0, 0x1154: 0x00c0, 0x1155: 0x00c0, 0x1156: 0x00c0, 0x1157: 0x00c0, + 0x1158: 0x00c0, 0x1159: 0x00c0, 0x115a: 0x00c0, 0x115d: 0x00c3, + 0x115e: 0x00c3, 0x115f: 0x00c3, 0x1160: 0x0080, 0x1161: 0x0080, 0x1162: 0x0080, 0x1163: 0x0080, + 0x1164: 0x0080, 0x1165: 0x0080, 0x1166: 0x0080, 0x1167: 0x0080, 0x1168: 0x0080, 0x1169: 0x0080, + 0x116a: 0x0080, 0x116b: 0x0080, 0x116c: 0x0080, 0x116d: 0x0080, 0x116e: 0x0080, 0x116f: 0x0080, + 0x1170: 0x0080, 0x1171: 0x0080, 0x1172: 0x0080, 0x1173: 0x0080, 0x1174: 0x0080, 0x1175: 0x0080, + 0x1176: 0x0080, 0x1177: 0x0080, 0x1178: 0x0080, 0x1179: 0x0080, 0x117a: 0x0080, 0x117b: 0x0080, + 0x117c: 0x0080, + // Block 0x46, offset 0x1180 + 0x1180: 0x00c0, 0x1181: 0x00c0, 0x1182: 0x00c0, 0x1183: 0x00c0, 0x1184: 0x00c0, 0x1185: 0x00c0, + 0x1186: 0x00c0, 0x1187: 0x00c0, 0x1188: 0x00c0, 0x1189: 0x00c0, 0x118a: 0x00c0, 0x118b: 0x00c0, + 0x118c: 0x00c0, 0x118d: 0x00c0, 0x118e: 0x00c0, 0x118f: 0x00c0, 0x1190: 0x0080, 0x1191: 0x0080, + 0x1192: 0x0080, 0x1193: 0x0080, 0x1194: 0x0080, 0x1195: 0x0080, 0x1196: 0x0080, 0x1197: 0x0080, + 0x1198: 0x0080, 0x1199: 0x0080, + 0x11a0: 0x00c0, 0x11a1: 0x00c0, 0x11a2: 0x00c0, 0x11a3: 0x00c0, + 0x11a4: 0x00c0, 0x11a5: 0x00c0, 0x11a6: 0x00c0, 0x11a7: 0x00c0, 0x11a8: 0x00c0, 0x11a9: 0x00c0, + 0x11aa: 0x00c0, 0x11ab: 0x00c0, 0x11ac: 0x00c0, 0x11ad: 0x00c0, 0x11ae: 0x00c0, 0x11af: 0x00c0, + 0x11b0: 0x00c0, 0x11b1: 0x00c0, 0x11b2: 0x00c0, 0x11b3: 0x00c0, 0x11b4: 0x00c0, 0x11b5: 0x00c0, + 0x11b6: 0x00c0, 0x11b7: 0x00c0, 0x11b8: 0x00c0, 0x11b9: 0x00c0, 0x11ba: 0x00c0, 0x11bb: 0x00c0, + 0x11bc: 0x00c0, 0x11bd: 0x00c0, 0x11be: 0x00c0, 0x11bf: 0x00c0, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x00c0, 0x11c1: 0x00c0, 0x11c2: 0x00c0, 0x11c3: 0x00c0, 0x11c4: 0x00c0, 0x11c5: 0x00c0, + 0x11c6: 0x00c0, 0x11c7: 0x00c0, 0x11c8: 0x00c0, 0x11c9: 0x00c0, 0x11ca: 0x00c0, 0x11cb: 0x00c0, + 0x11cc: 0x00c0, 0x11cd: 0x00c0, 0x11ce: 0x00c0, 0x11cf: 0x00c0, 0x11d0: 0x00c0, 0x11d1: 0x00c0, + 0x11d2: 0x00c0, 0x11d3: 0x00c0, 0x11d4: 0x00c0, 0x11d5: 0x00c0, 0x11d6: 0x00c0, 0x11d7: 0x00c0, + 0x11d8: 0x00c0, 0x11d9: 0x00c0, 0x11da: 0x00c0, 0x11db: 0x00c0, 0x11dc: 0x00c0, 0x11dd: 0x00c0, + 0x11de: 0x00c0, 0x11df: 0x00c0, 0x11e0: 0x00c0, 0x11e1: 0x00c0, 0x11e2: 0x00c0, 0x11e3: 0x00c0, + 0x11e4: 0x00c0, 0x11e5: 0x00c0, 0x11e6: 0x00c0, 0x11e7: 0x00c0, 0x11e8: 0x00c0, 0x11e9: 0x00c0, + 0x11ea: 0x00c0, 0x11eb: 0x00c0, 0x11ec: 0x00c0, 0x11ed: 0x00c0, 0x11ee: 0x00c0, 0x11ef: 0x00c0, + 0x11f0: 0x00c0, 0x11f1: 0x00c0, 0x11f2: 0x00c0, 0x11f3: 0x00c0, 0x11f4: 0x00c0, 0x11f5: 0x00c0, + 0x11f8: 0x00c0, 0x11f9: 0x00c0, 0x11fa: 0x00c0, 0x11fb: 0x00c0, + 0x11fc: 0x00c0, 0x11fd: 0x00c0, + // Block 0x48, offset 0x1200 + 0x1200: 0x0080, 0x1201: 0x00c0, 0x1202: 0x00c0, 0x1203: 0x00c0, 0x1204: 0x00c0, 0x1205: 0x00c0, + 0x1206: 0x00c0, 0x1207: 0x00c0, 0x1208: 0x00c0, 0x1209: 0x00c0, 0x120a: 0x00c0, 0x120b: 0x00c0, + 0x120c: 0x00c0, 0x120d: 0x00c0, 0x120e: 0x00c0, 0x120f: 0x00c0, 0x1210: 0x00c0, 0x1211: 0x00c0, + 0x1212: 0x00c0, 0x1213: 0x00c0, 0x1214: 0x00c0, 0x1215: 0x00c0, 0x1216: 0x00c0, 0x1217: 0x00c0, + 0x1218: 0x00c0, 0x1219: 0x00c0, 0x121a: 0x00c0, 0x121b: 0x00c0, 0x121c: 0x00c0, 0x121d: 0x00c0, + 0x121e: 0x00c0, 0x121f: 0x00c0, 0x1220: 0x00c0, 0x1221: 0x00c0, 0x1222: 0x00c0, 0x1223: 0x00c0, + 0x1224: 0x00c0, 0x1225: 0x00c0, 0x1226: 0x00c0, 0x1227: 0x00c0, 0x1228: 0x00c0, 0x1229: 0x00c0, + 0x122a: 0x00c0, 0x122b: 0x00c0, 0x122c: 0x00c0, 0x122d: 0x00c0, 0x122e: 0x00c0, 0x122f: 0x00c0, + 0x1230: 0x00c0, 0x1231: 0x00c0, 0x1232: 0x00c0, 0x1233: 0x00c0, 0x1234: 0x00c0, 0x1235: 0x00c0, + 0x1236: 0x00c0, 0x1237: 0x00c0, 0x1238: 0x00c0, 0x1239: 0x00c0, 0x123a: 0x00c0, 0x123b: 0x00c0, + 0x123c: 0x00c0, 0x123d: 0x00c0, 0x123e: 0x00c0, 0x123f: 0x00c0, + // Block 0x49, offset 0x1240 + 0x1240: 0x00c0, 0x1241: 0x00c0, 0x1242: 0x00c0, 0x1243: 0x00c0, 0x1244: 0x00c0, 0x1245: 0x00c0, + 0x1246: 0x00c0, 0x1247: 0x00c0, 0x1248: 0x00c0, 0x1249: 0x00c0, 0x124a: 0x00c0, 0x124b: 0x00c0, + 0x124c: 0x00c0, 0x124d: 0x00c0, 0x124e: 0x00c0, 0x124f: 0x00c0, 0x1250: 0x00c0, 0x1251: 0x00c0, + 0x1252: 0x00c0, 0x1253: 0x00c0, 0x1254: 0x00c0, 0x1255: 0x00c0, 0x1256: 0x00c0, 0x1257: 0x00c0, + 0x1258: 0x00c0, 0x1259: 0x00c0, 0x125a: 0x00c0, 0x125b: 0x00c0, 0x125c: 0x00c0, 0x125d: 0x00c0, + 0x125e: 0x00c0, 0x125f: 0x00c0, 0x1260: 0x00c0, 0x1261: 0x00c0, 0x1262: 0x00c0, 0x1263: 0x00c0, + 0x1264: 0x00c0, 0x1265: 0x00c0, 0x1266: 0x00c0, 0x1267: 0x00c0, 0x1268: 0x00c0, 0x1269: 0x00c0, + 0x126a: 0x00c0, 0x126b: 0x00c0, 0x126c: 0x00c0, 0x126d: 0x0080, 0x126e: 0x0080, 0x126f: 0x00c0, + 0x1270: 0x00c0, 0x1271: 0x00c0, 0x1272: 0x00c0, 0x1273: 0x00c0, 0x1274: 0x00c0, 0x1275: 0x00c0, + 0x1276: 0x00c0, 0x1277: 0x00c0, 0x1278: 0x00c0, 0x1279: 0x00c0, 0x127a: 0x00c0, 0x127b: 0x00c0, + 0x127c: 0x00c0, 0x127d: 0x00c0, 0x127e: 0x00c0, 0x127f: 0x00c0, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0080, 0x1281: 0x00c0, 0x1282: 0x00c0, 0x1283: 0x00c0, 0x1284: 0x00c0, 0x1285: 0x00c0, + 0x1286: 0x00c0, 0x1287: 0x00c0, 0x1288: 0x00c0, 0x1289: 0x00c0, 0x128a: 0x00c0, 0x128b: 0x00c0, + 0x128c: 0x00c0, 0x128d: 0x00c0, 0x128e: 0x00c0, 0x128f: 0x00c0, 0x1290: 0x00c0, 0x1291: 0x00c0, + 0x1292: 0x00c0, 0x1293: 0x00c0, 0x1294: 0x00c0, 0x1295: 0x00c0, 0x1296: 0x00c0, 0x1297: 0x00c0, + 0x1298: 0x00c0, 0x1299: 0x00c0, 0x129a: 0x00c0, 0x129b: 0x0080, 0x129c: 0x0080, + 0x12a0: 0x00c0, 0x12a1: 0x00c0, 0x12a2: 0x00c0, 0x12a3: 0x00c0, + 0x12a4: 0x00c0, 0x12a5: 0x00c0, 0x12a6: 0x00c0, 0x12a7: 0x00c0, 0x12a8: 0x00c0, 0x12a9: 0x00c0, + 0x12aa: 0x00c0, 0x12ab: 0x00c0, 0x12ac: 0x00c0, 0x12ad: 0x00c0, 0x12ae: 0x00c0, 0x12af: 0x00c0, + 0x12b0: 0x00c0, 0x12b1: 0x00c0, 0x12b2: 0x00c0, 0x12b3: 0x00c0, 0x12b4: 0x00c0, 0x12b5: 0x00c0, + 0x12b6: 0x00c0, 0x12b7: 0x00c0, 0x12b8: 0x00c0, 0x12b9: 0x00c0, 0x12ba: 0x00c0, 0x12bb: 0x00c0, + 0x12bc: 0x00c0, 0x12bd: 0x00c0, 0x12be: 0x00c0, 0x12bf: 0x00c0, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x00c0, 0x12c1: 0x00c0, 0x12c2: 0x00c0, 0x12c3: 0x00c0, 0x12c4: 0x00c0, 0x12c5: 0x00c0, + 0x12c6: 0x00c0, 0x12c7: 0x00c0, 0x12c8: 0x00c0, 0x12c9: 0x00c0, 0x12ca: 0x00c0, 0x12cb: 0x00c0, + 0x12cc: 0x00c0, 0x12cd: 0x00c0, 0x12ce: 0x00c0, 0x12cf: 0x00c0, 0x12d0: 0x00c0, 0x12d1: 0x00c0, + 0x12d2: 0x00c0, 0x12d3: 0x00c0, 0x12d4: 0x00c0, 0x12d5: 0x00c0, 0x12d6: 0x00c0, 0x12d7: 0x00c0, + 0x12d8: 0x00c0, 0x12d9: 0x00c0, 0x12da: 0x00c0, 0x12db: 0x00c0, 0x12dc: 0x00c0, 0x12dd: 0x00c0, + 0x12de: 0x00c0, 0x12df: 0x00c0, 0x12e0: 0x00c0, 0x12e1: 0x00c0, 0x12e2: 0x00c0, 0x12e3: 0x00c0, + 0x12e4: 0x00c0, 0x12e5: 0x00c0, 0x12e6: 0x00c0, 0x12e7: 0x00c0, 0x12e8: 0x00c0, 0x12e9: 0x00c0, + 0x12ea: 0x00c0, 0x12eb: 0x0080, 0x12ec: 0x0080, 0x12ed: 0x0080, 0x12ee: 0x0080, 0x12ef: 0x0080, + 0x12f0: 0x0080, 0x12f1: 0x00c0, 0x12f2: 0x00c0, 0x12f3: 0x00c0, 0x12f4: 0x00c0, 0x12f5: 0x00c0, + 0x12f6: 0x00c0, 0x12f7: 0x00c0, 0x12f8: 0x00c0, + // Block 0x4c, offset 0x1300 + 0x1300: 0x00c0, 0x1301: 0x00c0, 0x1302: 0x00c0, 0x1303: 0x00c0, 0x1304: 0x00c0, 0x1305: 0x00c0, + 0x1306: 0x00c0, 0x1307: 0x00c0, 0x1308: 0x00c0, 0x1309: 0x00c0, 0x130a: 0x00c0, 0x130b: 0x00c0, + 0x130c: 0x00c0, 0x130d: 0x00c0, 0x130e: 0x00c0, 0x130f: 0x00c0, 0x1310: 0x00c0, 0x1311: 0x00c0, + 0x1312: 0x00c3, 0x1313: 0x00c3, 0x1314: 0x00c6, 0x1315: 0x00c5, + 0x131f: 0x00c0, 0x1320: 0x00c0, 0x1321: 0x00c0, 0x1322: 0x00c0, 0x1323: 0x00c0, + 0x1324: 0x00c0, 0x1325: 0x00c0, 0x1326: 0x00c0, 0x1327: 0x00c0, 0x1328: 0x00c0, 0x1329: 0x00c0, + 0x132a: 0x00c0, 0x132b: 0x00c0, 0x132c: 0x00c0, 0x132d: 0x00c0, 0x132e: 0x00c0, 0x132f: 0x00c0, + 0x1330: 0x00c0, 0x1331: 0x00c0, 0x1332: 0x00c3, 0x1333: 0x00c3, 0x1334: 0x00c5, 0x1335: 0x0080, + 0x1336: 0x0080, + // Block 0x4d, offset 0x1340 + 0x1340: 0x00c0, 0x1341: 0x00c0, 0x1342: 0x00c0, 0x1343: 0x00c0, 0x1344: 0x00c0, 0x1345: 0x00c0, + 0x1346: 0x00c0, 0x1347: 0x00c0, 0x1348: 0x00c0, 0x1349: 0x00c0, 0x134a: 0x00c0, 0x134b: 0x00c0, + 0x134c: 0x00c0, 0x134d: 0x00c0, 0x134e: 0x00c0, 0x134f: 0x00c0, 0x1350: 0x00c0, 0x1351: 0x00c0, + 0x1352: 0x00c3, 0x1353: 0x00c3, + 0x1360: 0x00c0, 0x1361: 0x00c0, 0x1362: 0x00c0, 0x1363: 0x00c0, + 0x1364: 0x00c0, 0x1365: 0x00c0, 0x1366: 0x00c0, 0x1367: 0x00c0, 0x1368: 0x00c0, 0x1369: 0x00c0, + 0x136a: 0x00c0, 0x136b: 0x00c0, 0x136c: 0x00c0, 0x136e: 0x00c0, 0x136f: 0x00c0, + 0x1370: 0x00c0, 0x1372: 0x00c3, 0x1373: 0x00c3, + // Block 0x4e, offset 0x1380 + 0x1380: 0x00c0, 0x1381: 0x00c0, 0x1382: 0x00c0, 0x1383: 0x00c0, 0x1384: 0x00c0, 0x1385: 0x00c0, + 0x1386: 0x00c0, 0x1387: 0x00c0, 0x1388: 0x00c0, 0x1389: 0x00c0, 0x138a: 0x00c0, 0x138b: 0x00c0, + 0x138c: 0x00c0, 0x138d: 0x00c0, 0x138e: 0x00c0, 0x138f: 0x00c0, 0x1390: 0x00c0, 0x1391: 0x00c0, + 0x1392: 0x00c0, 0x1393: 0x00c0, 0x1394: 0x00c0, 0x1395: 0x00c0, 0x1396: 0x00c0, 0x1397: 0x00c0, + 0x1398: 0x00c0, 0x1399: 0x00c0, 0x139a: 0x00c0, 0x139b: 0x00c0, 0x139c: 0x00c0, 0x139d: 0x00c0, + 0x139e: 0x00c0, 0x139f: 0x00c0, 0x13a0: 0x00c0, 0x13a1: 0x00c0, 0x13a2: 0x00c0, 0x13a3: 0x00c0, + 0x13a4: 0x00c0, 0x13a5: 0x00c0, 0x13a6: 0x00c0, 0x13a7: 0x00c0, 0x13a8: 0x00c0, 0x13a9: 0x00c0, + 0x13aa: 0x00c0, 0x13ab: 0x00c0, 0x13ac: 0x00c0, 0x13ad: 0x00c0, 0x13ae: 0x00c0, 0x13af: 0x00c0, + 0x13b0: 0x00c0, 0x13b1: 0x00c0, 0x13b2: 0x00c0, 0x13b3: 0x00c0, 0x13b4: 0x0040, 0x13b5: 0x0040, + 0x13b6: 0x00c0, 0x13b7: 0x00c3, 0x13b8: 0x00c3, 0x13b9: 0x00c3, 0x13ba: 0x00c3, 0x13bb: 0x00c3, + 0x13bc: 0x00c3, 0x13bd: 0x00c3, 0x13be: 0x00c0, 0x13bf: 0x00c0, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x00c0, 0x13c1: 0x00c0, 0x13c2: 0x00c0, 0x13c3: 0x00c0, 0x13c4: 0x00c0, 0x13c5: 0x00c0, + 0x13c6: 0x00c3, 0x13c7: 0x00c0, 0x13c8: 0x00c0, 0x13c9: 0x00c3, 0x13ca: 0x00c3, 0x13cb: 0x00c3, + 0x13cc: 0x00c3, 0x13cd: 0x00c3, 0x13ce: 0x00c3, 0x13cf: 0x00c3, 0x13d0: 0x00c3, 0x13d1: 0x00c3, + 0x13d2: 0x00c6, 0x13d3: 0x00c3, 0x13d4: 0x0080, 0x13d5: 0x0080, 0x13d6: 0x0080, 0x13d7: 0x00c0, + 0x13d8: 0x0080, 0x13d9: 0x0080, 0x13da: 0x0080, 0x13db: 0x0080, 0x13dc: 0x00c0, 0x13dd: 0x00c3, + 0x13e0: 0x00c0, 0x13e1: 0x00c0, 0x13e2: 0x00c0, 0x13e3: 0x00c0, + 0x13e4: 0x00c0, 0x13e5: 0x00c0, 0x13e6: 0x00c0, 0x13e7: 0x00c0, 0x13e8: 0x00c0, 0x13e9: 0x00c0, + 0x13f0: 0x0080, 0x13f1: 0x0080, 0x13f2: 0x0080, 0x13f3: 0x0080, 0x13f4: 0x0080, 0x13f5: 0x0080, + 0x13f6: 0x0080, 0x13f7: 0x0080, 0x13f8: 0x0080, 0x13f9: 0x0080, + // Block 0x50, offset 0x1400 + 0x1400: 0x0080, 0x1401: 0x0080, 0x1402: 0x0080, 0x1403: 0x0080, 0x1404: 0x0080, 0x1405: 0x0080, + 0x1406: 0x0080, 0x1407: 0x0082, 0x1408: 0x0080, 0x1409: 0x0080, 0x140a: 0x0080, 0x140b: 0x0040, + 0x140c: 0x0040, 0x140d: 0x0040, 0x140e: 0x0040, 0x140f: 0x0040, 0x1410: 0x00c0, 0x1411: 0x00c0, + 0x1412: 0x00c0, 0x1413: 0x00c0, 0x1414: 0x00c0, 0x1415: 0x00c0, 0x1416: 0x00c0, 0x1417: 0x00c0, + 0x1418: 0x00c0, 0x1419: 0x00c0, + 0x1420: 0x00c2, 0x1421: 0x00c2, 0x1422: 0x00c2, 0x1423: 0x00c2, + 0x1424: 0x00c2, 0x1425: 0x00c2, 0x1426: 0x00c2, 0x1427: 0x00c2, 0x1428: 0x00c2, 0x1429: 0x00c2, + 0x142a: 0x00c2, 0x142b: 0x00c2, 0x142c: 0x00c2, 0x142d: 0x00c2, 0x142e: 0x00c2, 0x142f: 0x00c2, + 0x1430: 0x00c2, 0x1431: 0x00c2, 0x1432: 0x00c2, 0x1433: 0x00c2, 0x1434: 0x00c2, 0x1435: 0x00c2, + 0x1436: 0x00c2, 0x1437: 0x00c2, 0x1438: 0x00c2, 0x1439: 0x00c2, 0x143a: 0x00c2, 0x143b: 0x00c2, + 0x143c: 0x00c2, 0x143d: 0x00c2, 0x143e: 0x00c2, 0x143f: 0x00c2, + // Block 0x51, offset 0x1440 + 0x1440: 0x00c2, 0x1441: 0x00c2, 0x1442: 0x00c2, 0x1443: 0x00c2, 0x1444: 0x00c2, 0x1445: 0x00c2, + 0x1446: 0x00c2, 0x1447: 0x00c2, 0x1448: 0x00c2, 0x1449: 0x00c2, 0x144a: 0x00c2, 0x144b: 0x00c2, + 0x144c: 0x00c2, 0x144d: 0x00c2, 0x144e: 0x00c2, 0x144f: 0x00c2, 0x1450: 0x00c2, 0x1451: 0x00c2, + 0x1452: 0x00c2, 0x1453: 0x00c2, 0x1454: 0x00c2, 0x1455: 0x00c2, 0x1456: 0x00c2, 0x1457: 0x00c2, + 0x1458: 0x00c2, 0x1459: 0x00c2, 0x145a: 0x00c2, 0x145b: 0x00c2, 0x145c: 0x00c2, 0x145d: 0x00c2, + 0x145e: 0x00c2, 0x145f: 0x00c2, 0x1460: 0x00c2, 0x1461: 0x00c2, 0x1462: 0x00c2, 0x1463: 0x00c2, + 0x1464: 0x00c2, 0x1465: 0x00c2, 0x1466: 0x00c2, 0x1467: 0x00c2, 0x1468: 0x00c2, 0x1469: 0x00c2, + 0x146a: 0x00c2, 0x146b: 0x00c2, 0x146c: 0x00c2, 0x146d: 0x00c2, 0x146e: 0x00c2, 0x146f: 0x00c2, + 0x1470: 0x00c2, 0x1471: 0x00c2, 0x1472: 0x00c2, 0x1473: 0x00c2, 0x1474: 0x00c2, 0x1475: 0x00c2, + 0x1476: 0x00c2, 0x1477: 0x00c2, 0x1478: 0x00c2, + // Block 0x52, offset 0x1480 + 0x1480: 0x00c0, 0x1481: 0x00c0, 0x1482: 0x00c0, 0x1483: 0x00c0, 0x1484: 0x00c0, 0x1485: 0x00c3, + 0x1486: 0x00c3, 0x1487: 0x00c2, 0x1488: 0x00c2, 0x1489: 0x00c2, 0x148a: 0x00c2, 0x148b: 0x00c2, + 0x148c: 0x00c2, 0x148d: 0x00c2, 0x148e: 0x00c2, 0x148f: 0x00c2, 0x1490: 0x00c2, 0x1491: 0x00c2, + 0x1492: 0x00c2, 0x1493: 0x00c2, 0x1494: 0x00c2, 0x1495: 0x00c2, 0x1496: 0x00c2, 0x1497: 0x00c2, + 0x1498: 0x00c2, 0x1499: 0x00c2, 0x149a: 0x00c2, 0x149b: 0x00c2, 0x149c: 0x00c2, 0x149d: 0x00c2, + 0x149e: 0x00c2, 0x149f: 0x00c2, 0x14a0: 0x00c2, 0x14a1: 0x00c2, 0x14a2: 0x00c2, 0x14a3: 0x00c2, + 0x14a4: 0x00c2, 0x14a5: 0x00c2, 0x14a6: 0x00c2, 0x14a7: 0x00c2, 0x14a8: 0x00c2, 0x14a9: 0x00c3, + 0x14aa: 0x00c2, + 0x14b0: 0x00c0, 0x14b1: 0x00c0, 0x14b2: 0x00c0, 0x14b3: 0x00c0, 0x14b4: 0x00c0, 0x14b5: 0x00c0, + 0x14b6: 0x00c0, 0x14b7: 0x00c0, 0x14b8: 0x00c0, 0x14b9: 0x00c0, 0x14ba: 0x00c0, 0x14bb: 0x00c0, + 0x14bc: 0x00c0, 0x14bd: 0x00c0, 0x14be: 0x00c0, 0x14bf: 0x00c0, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x00c0, 0x14c1: 0x00c0, 0x14c2: 0x00c0, 0x14c3: 0x00c0, 0x14c4: 0x00c0, 0x14c5: 0x00c0, + 0x14c6: 0x00c0, 0x14c7: 0x00c0, 0x14c8: 0x00c0, 0x14c9: 0x00c0, 0x14ca: 0x00c0, 0x14cb: 0x00c0, + 0x14cc: 0x00c0, 0x14cd: 0x00c0, 0x14ce: 0x00c0, 0x14cf: 0x00c0, 0x14d0: 0x00c0, 0x14d1: 0x00c0, + 0x14d2: 0x00c0, 0x14d3: 0x00c0, 0x14d4: 0x00c0, 0x14d5: 0x00c0, 0x14d6: 0x00c0, 0x14d7: 0x00c0, + 0x14d8: 0x00c0, 0x14d9: 0x00c0, 0x14da: 0x00c0, 0x14db: 0x00c0, 0x14dc: 0x00c0, 0x14dd: 0x00c0, + 0x14de: 0x00c0, 0x14df: 0x00c0, 0x14e0: 0x00c0, 0x14e1: 0x00c0, 0x14e2: 0x00c0, 0x14e3: 0x00c0, + 0x14e4: 0x00c0, 0x14e5: 0x00c0, 0x14e6: 0x00c0, 0x14e7: 0x00c0, 0x14e8: 0x00c0, 0x14e9: 0x00c0, + 0x14ea: 0x00c0, 0x14eb: 0x00c0, 0x14ec: 0x00c0, 0x14ed: 0x00c0, 0x14ee: 0x00c0, 0x14ef: 0x00c0, + 0x14f0: 0x00c0, 0x14f1: 0x00c0, 0x14f2: 0x00c0, 0x14f3: 0x00c0, 0x14f4: 0x00c0, 0x14f5: 0x00c0, + // Block 0x54, offset 0x1500 + 0x1500: 0x00c0, 0x1501: 0x00c0, 0x1502: 0x00c0, 0x1503: 0x00c0, 0x1504: 0x00c0, 0x1505: 0x00c0, + 0x1506: 0x00c0, 0x1507: 0x00c0, 0x1508: 0x00c0, 0x1509: 0x00c0, 0x150a: 0x00c0, 0x150b: 0x00c0, + 0x150c: 0x00c0, 0x150d: 0x00c0, 0x150e: 0x00c0, 0x150f: 0x00c0, 0x1510: 0x00c0, 0x1511: 0x00c0, + 0x1512: 0x00c0, 0x1513: 0x00c0, 0x1514: 0x00c0, 0x1515: 0x00c0, 0x1516: 0x00c0, 0x1517: 0x00c0, + 0x1518: 0x00c0, 0x1519: 0x00c0, 0x151a: 0x00c0, 0x151b: 0x00c0, 0x151c: 0x00c0, 0x151d: 0x00c0, + 0x151e: 0x00c0, 0x1520: 0x00c3, 0x1521: 0x00c3, 0x1522: 0x00c3, 0x1523: 0x00c0, + 0x1524: 0x00c0, 0x1525: 0x00c0, 0x1526: 0x00c0, 0x1527: 0x00c3, 0x1528: 0x00c3, 0x1529: 0x00c0, + 0x152a: 0x00c0, 0x152b: 0x00c0, + 0x1530: 0x00c0, 0x1531: 0x00c0, 0x1532: 0x00c3, 0x1533: 0x00c0, 0x1534: 0x00c0, 0x1535: 0x00c0, + 0x1536: 0x00c0, 0x1537: 0x00c0, 0x1538: 0x00c0, 0x1539: 0x00c3, 0x153a: 0x00c3, 0x153b: 0x00c3, + // Block 0x55, offset 0x1540 + 0x1540: 0x0080, 0x1544: 0x0080, 0x1545: 0x0080, + 0x1546: 0x00c0, 0x1547: 0x00c0, 0x1548: 0x00c0, 0x1549: 0x00c0, 0x154a: 0x00c0, 0x154b: 0x00c0, + 0x154c: 0x00c0, 0x154d: 0x00c0, 0x154e: 0x00c0, 0x154f: 0x00c0, 0x1550: 0x00c0, 0x1551: 0x00c0, + 0x1552: 0x00c0, 0x1553: 0x00c0, 0x1554: 0x00c0, 0x1555: 0x00c0, 0x1556: 0x00c0, 0x1557: 0x00c0, + 0x1558: 0x00c0, 0x1559: 0x00c0, 0x155a: 0x00c0, 0x155b: 0x00c0, 0x155c: 0x00c0, 0x155d: 0x00c0, + 0x155e: 0x00c0, 0x155f: 0x00c0, 0x1560: 0x00c0, 0x1561: 0x00c0, 0x1562: 0x00c0, 0x1563: 0x00c0, + 0x1564: 0x00c0, 0x1565: 0x00c0, 0x1566: 0x00c0, 0x1567: 0x00c0, 0x1568: 0x00c0, 0x1569: 0x00c0, + 0x156a: 0x00c0, 0x156b: 0x00c0, 0x156c: 0x00c0, 0x156d: 0x00c0, + 0x1570: 0x00c0, 0x1571: 0x00c0, 0x1572: 0x00c0, 0x1573: 0x00c0, 0x1574: 0x00c0, + // Block 0x56, offset 0x1580 + 0x1580: 0x00c0, 0x1581: 0x00c0, 0x1582: 0x00c0, 0x1583: 0x00c0, 0x1584: 0x00c0, 0x1585: 0x00c0, + 0x1586: 0x00c0, 0x1587: 0x00c0, 0x1588: 0x00c0, 0x1589: 0x00c0, 0x158a: 0x00c0, 0x158b: 0x00c0, + 0x158c: 0x00c0, 0x158d: 0x00c0, 0x158e: 0x00c0, 0x158f: 0x00c0, 0x1590: 0x00c0, 0x1591: 0x00c0, + 0x1592: 0x00c0, 0x1593: 0x00c0, 0x1594: 0x00c0, 0x1595: 0x00c0, 0x1596: 0x00c0, 0x1597: 0x00c0, + 0x1598: 0x00c0, 0x1599: 0x00c0, 0x159a: 0x00c0, 0x159b: 0x00c0, 0x159c: 0x00c0, 0x159d: 0x00c0, + 0x159e: 0x00c0, 0x159f: 0x00c0, 0x15a0: 0x00c0, 0x15a1: 0x00c0, 0x15a2: 0x00c0, 0x15a3: 0x00c0, + 0x15a4: 0x00c0, 0x15a5: 0x00c0, 0x15a6: 0x00c0, 0x15a7: 0x00c0, 0x15a8: 0x00c0, 0x15a9: 0x00c0, + 0x15aa: 0x00c0, 0x15ab: 0x00c0, + 0x15b0: 0x00c0, 0x15b1: 0x00c0, 0x15b2: 0x00c0, 0x15b3: 0x00c0, 0x15b4: 0x00c0, 0x15b5: 0x00c0, + 0x15b6: 0x00c0, 0x15b7: 0x00c0, 0x15b8: 0x00c0, 0x15b9: 0x00c0, 0x15ba: 0x00c0, 0x15bb: 0x00c0, + 0x15bc: 0x00c0, 0x15bd: 0x00c0, 0x15be: 0x00c0, 0x15bf: 0x00c0, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x00c0, 0x15c1: 0x00c0, 0x15c2: 0x00c0, 0x15c3: 0x00c0, 0x15c4: 0x00c0, 0x15c5: 0x00c0, + 0x15c6: 0x00c0, 0x15c7: 0x00c0, 0x15c8: 0x00c0, 0x15c9: 0x00c0, + 0x15d0: 0x00c0, 0x15d1: 0x00c0, + 0x15d2: 0x00c0, 0x15d3: 0x00c0, 0x15d4: 0x00c0, 0x15d5: 0x00c0, 0x15d6: 0x00c0, 0x15d7: 0x00c0, + 0x15d8: 0x00c0, 0x15d9: 0x00c0, 0x15da: 0x0080, + 0x15de: 0x0080, 0x15df: 0x0080, 0x15e0: 0x0080, 0x15e1: 0x0080, 0x15e2: 0x0080, 0x15e3: 0x0080, + 0x15e4: 0x0080, 0x15e5: 0x0080, 0x15e6: 0x0080, 0x15e7: 0x0080, 0x15e8: 0x0080, 0x15e9: 0x0080, + 0x15ea: 0x0080, 0x15eb: 0x0080, 0x15ec: 0x0080, 0x15ed: 0x0080, 0x15ee: 0x0080, 0x15ef: 0x0080, + 0x15f0: 0x0080, 0x15f1: 0x0080, 0x15f2: 0x0080, 0x15f3: 0x0080, 0x15f4: 0x0080, 0x15f5: 0x0080, + 0x15f6: 0x0080, 0x15f7: 0x0080, 0x15f8: 0x0080, 0x15f9: 0x0080, 0x15fa: 0x0080, 0x15fb: 0x0080, + 0x15fc: 0x0080, 0x15fd: 0x0080, 0x15fe: 0x0080, 0x15ff: 0x0080, + // Block 0x58, offset 0x1600 + 0x1600: 0x00c0, 0x1601: 0x00c0, 0x1602: 0x00c0, 0x1603: 0x00c0, 0x1604: 0x00c0, 0x1605: 0x00c0, + 0x1606: 0x00c0, 0x1607: 0x00c0, 0x1608: 0x00c0, 0x1609: 0x00c0, 0x160a: 0x00c0, 0x160b: 0x00c0, + 0x160c: 0x00c0, 0x160d: 0x00c0, 0x160e: 0x00c0, 0x160f: 0x00c0, 0x1610: 0x00c0, 0x1611: 0x00c0, + 0x1612: 0x00c0, 0x1613: 0x00c0, 0x1614: 0x00c0, 0x1615: 0x00c0, 0x1616: 0x00c0, 0x1617: 0x00c3, + 0x1618: 0x00c3, 0x1619: 0x00c0, 0x161a: 0x00c0, 0x161b: 0x00c3, + 0x161e: 0x0080, 0x161f: 0x0080, 0x1620: 0x00c0, 0x1621: 0x00c0, 0x1622: 0x00c0, 0x1623: 0x00c0, + 0x1624: 0x00c0, 0x1625: 0x00c0, 0x1626: 0x00c0, 0x1627: 0x00c0, 0x1628: 0x00c0, 0x1629: 0x00c0, + 0x162a: 0x00c0, 0x162b: 0x00c0, 0x162c: 0x00c0, 0x162d: 0x00c0, 0x162e: 0x00c0, 0x162f: 0x00c0, + 0x1630: 0x00c0, 0x1631: 0x00c0, 0x1632: 0x00c0, 0x1633: 0x00c0, 0x1634: 0x00c0, 0x1635: 0x00c0, + 0x1636: 0x00c0, 0x1637: 0x00c0, 0x1638: 0x00c0, 0x1639: 0x00c0, 0x163a: 0x00c0, 0x163b: 0x00c0, + 0x163c: 0x00c0, 0x163d: 0x00c0, 0x163e: 0x00c0, 0x163f: 0x00c0, + // Block 0x59, offset 0x1640 + 0x1640: 0x00c0, 0x1641: 0x00c0, 0x1642: 0x00c0, 0x1643: 0x00c0, 0x1644: 0x00c0, 0x1645: 0x00c0, + 0x1646: 0x00c0, 0x1647: 0x00c0, 0x1648: 0x00c0, 0x1649: 0x00c0, 0x164a: 0x00c0, 0x164b: 0x00c0, + 0x164c: 0x00c0, 0x164d: 0x00c0, 0x164e: 0x00c0, 0x164f: 0x00c0, 0x1650: 0x00c0, 0x1651: 0x00c0, + 0x1652: 0x00c0, 0x1653: 0x00c0, 0x1654: 0x00c0, 0x1655: 0x00c0, 0x1656: 0x00c3, 0x1657: 0x00c0, + 0x1658: 0x00c3, 0x1659: 0x00c3, 0x165a: 0x00c3, 0x165b: 0x00c3, 0x165c: 0x00c3, 0x165d: 0x00c3, + 0x165e: 0x00c3, 0x1660: 0x00c6, 0x1661: 0x00c0, 0x1662: 0x00c3, 0x1663: 0x00c0, + 0x1664: 0x00c0, 0x1665: 0x00c3, 0x1666: 0x00c3, 0x1667: 0x00c3, 0x1668: 0x00c3, 0x1669: 0x00c3, + 0x166a: 0x00c3, 0x166b: 0x00c3, 0x166c: 0x00c3, 0x166d: 0x00c0, 0x166e: 0x00c0, 0x166f: 0x00c0, + 0x1670: 0x00c0, 0x1671: 0x00c0, 0x1672: 0x00c0, 0x1673: 0x00c3, 0x1674: 0x00c3, 0x1675: 0x00c3, + 0x1676: 0x00c3, 0x1677: 0x00c3, 0x1678: 0x00c3, 0x1679: 0x00c3, 0x167a: 0x00c3, 0x167b: 0x00c3, + 0x167c: 0x00c3, 0x167f: 0x00c3, + // Block 0x5a, offset 0x1680 + 0x1680: 0x00c0, 0x1681: 0x00c0, 0x1682: 0x00c0, 0x1683: 0x00c0, 0x1684: 0x00c0, 0x1685: 0x00c0, + 0x1686: 0x00c0, 0x1687: 0x00c0, 0x1688: 0x00c0, 0x1689: 0x00c0, + 0x1690: 0x00c0, 0x1691: 0x00c0, + 0x1692: 0x00c0, 0x1693: 0x00c0, 0x1694: 0x00c0, 0x1695: 0x00c0, 0x1696: 0x00c0, 0x1697: 0x00c0, + 0x1698: 0x00c0, 0x1699: 0x00c0, + 0x16a0: 0x0080, 0x16a1: 0x0080, 0x16a2: 0x0080, 0x16a3: 0x0080, + 0x16a4: 0x0080, 0x16a5: 0x0080, 0x16a6: 0x0080, 0x16a7: 0x00c0, 0x16a8: 0x0080, 0x16a9: 0x0080, + 0x16aa: 0x0080, 0x16ab: 0x0080, 0x16ac: 0x0080, 0x16ad: 0x0080, + 0x16b0: 0x00c3, 0x16b1: 0x00c3, 0x16b2: 0x00c3, 0x16b3: 0x00c3, 0x16b4: 0x00c3, 0x16b5: 0x00c3, + 0x16b6: 0x00c3, 0x16b7: 0x00c3, 0x16b8: 0x00c3, 0x16b9: 0x00c3, 0x16ba: 0x00c3, 0x16bb: 0x00c3, + 0x16bc: 0x00c3, 0x16bd: 0x00c3, 0x16be: 0x0083, 0x16bf: 0x00c3, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x00c3, 0x16c1: 0x00c3, 0x16c2: 0x00c3, 0x16c3: 0x00c3, 0x16c4: 0x00c3, 0x16c5: 0x00c3, + 0x16c6: 0x00c3, 0x16c7: 0x00c3, 0x16c8: 0x00c3, 0x16c9: 0x00c3, 0x16ca: 0x00c3, 0x16cb: 0x00c3, + 0x16cc: 0x00c3, 0x16cd: 0x00c3, 0x16ce: 0x00c3, + // Block 0x5c, offset 0x1700 + 0x1700: 0x00c3, 0x1701: 0x00c3, 0x1702: 0x00c3, 0x1703: 0x00c3, 0x1704: 0x00c0, 0x1705: 0x00c0, + 0x1706: 0x00c0, 0x1707: 0x00c0, 0x1708: 0x00c0, 0x1709: 0x00c0, 0x170a: 0x00c0, 0x170b: 0x00c0, + 0x170c: 0x00c0, 0x170d: 0x00c0, 0x170e: 0x00c0, 0x170f: 0x00c0, 0x1710: 0x00c0, 0x1711: 0x00c0, + 0x1712: 0x00c0, 0x1713: 0x00c0, 0x1714: 0x00c0, 0x1715: 0x00c0, 0x1716: 0x00c0, 0x1717: 0x00c0, + 0x1718: 0x00c0, 0x1719: 0x00c0, 0x171a: 0x00c0, 0x171b: 0x00c0, 0x171c: 0x00c0, 0x171d: 0x00c0, + 0x171e: 0x00c0, 0x171f: 0x00c0, 0x1720: 0x00c0, 0x1721: 0x00c0, 0x1722: 0x00c0, 0x1723: 0x00c0, + 0x1724: 0x00c0, 0x1725: 0x00c0, 0x1726: 0x00c0, 0x1727: 0x00c0, 0x1728: 0x00c0, 0x1729: 0x00c0, + 0x172a: 0x00c0, 0x172b: 0x00c0, 0x172c: 0x00c0, 0x172d: 0x00c0, 0x172e: 0x00c0, 0x172f: 0x00c0, + 0x1730: 0x00c0, 0x1731: 0x00c0, 0x1732: 0x00c0, 0x1733: 0x00c0, 0x1734: 0x00c3, 0x1735: 0x00c0, + 0x1736: 0x00c3, 0x1737: 0x00c3, 0x1738: 0x00c3, 0x1739: 0x00c3, 0x173a: 0x00c3, 0x173b: 0x00c0, + 0x173c: 0x00c3, 0x173d: 0x00c0, 0x173e: 0x00c0, 0x173f: 0x00c0, + // Block 0x5d, offset 0x1740 + 0x1740: 0x00c0, 0x1741: 0x00c0, 0x1742: 0x00c3, 0x1743: 0x00c0, 0x1744: 0x00c5, 0x1745: 0x00c0, + 0x1746: 0x00c0, 0x1747: 0x00c0, 0x1748: 0x00c0, 0x1749: 0x00c0, 0x174a: 0x00c0, 0x174b: 0x00c0, + 0x174c: 0x00c0, 0x1750: 0x00c0, 0x1751: 0x00c0, + 0x1752: 0x00c0, 0x1753: 0x00c0, 0x1754: 0x00c0, 0x1755: 0x00c0, 0x1756: 0x00c0, 0x1757: 0x00c0, + 0x1758: 0x00c0, 0x1759: 0x00c0, 0x175a: 0x0080, 0x175b: 0x0080, 0x175c: 0x0080, 0x175d: 0x0080, + 0x175e: 0x0080, 0x175f: 0x0080, 0x1760: 0x0080, 0x1761: 0x0080, 0x1762: 0x0080, 0x1763: 0x0080, + 0x1764: 0x0080, 0x1765: 0x0080, 0x1766: 0x0080, 0x1767: 0x0080, 0x1768: 0x0080, 0x1769: 0x0080, + 0x176a: 0x0080, 0x176b: 0x00c3, 0x176c: 0x00c3, 0x176d: 0x00c3, 0x176e: 0x00c3, 0x176f: 0x00c3, + 0x1770: 0x00c3, 0x1771: 0x00c3, 0x1772: 0x00c3, 0x1773: 0x00c3, 0x1774: 0x0080, 0x1775: 0x0080, + 0x1776: 0x0080, 0x1777: 0x0080, 0x1778: 0x0080, 0x1779: 0x0080, 0x177a: 0x0080, 0x177b: 0x0080, + 0x177c: 0x0080, 0x177d: 0x0080, 0x177e: 0x0080, + // Block 0x5e, offset 0x1780 + 0x1780: 0x00c3, 0x1781: 0x00c3, 0x1782: 0x00c0, 0x1783: 0x00c0, 0x1784: 0x00c0, 0x1785: 0x00c0, + 0x1786: 0x00c0, 0x1787: 0x00c0, 0x1788: 0x00c0, 0x1789: 0x00c0, 0x178a: 0x00c0, 0x178b: 0x00c0, + 0x178c: 0x00c0, 0x178d: 0x00c0, 0x178e: 0x00c0, 0x178f: 0x00c0, 0x1790: 0x00c0, 0x1791: 0x00c0, + 0x1792: 0x00c0, 0x1793: 0x00c0, 0x1794: 0x00c0, 0x1795: 0x00c0, 0x1796: 0x00c0, 0x1797: 0x00c0, + 0x1798: 0x00c0, 0x1799: 0x00c0, 0x179a: 0x00c0, 0x179b: 0x00c0, 0x179c: 0x00c0, 0x179d: 0x00c0, + 0x179e: 0x00c0, 0x179f: 0x00c0, 0x17a0: 0x00c0, 0x17a1: 0x00c0, 0x17a2: 0x00c3, 0x17a3: 0x00c3, + 0x17a4: 0x00c3, 0x17a5: 0x00c3, 0x17a6: 0x00c0, 0x17a7: 0x00c0, 0x17a8: 0x00c3, 0x17a9: 0x00c3, + 0x17aa: 0x00c5, 0x17ab: 0x00c6, 0x17ac: 0x00c3, 0x17ad: 0x00c3, 0x17ae: 0x00c0, 0x17af: 0x00c0, + 0x17b0: 0x00c0, 0x17b1: 0x00c0, 0x17b2: 0x00c0, 0x17b3: 0x00c0, 0x17b4: 0x00c0, 0x17b5: 0x00c0, + 0x17b6: 0x00c0, 0x17b7: 0x00c0, 0x17b8: 0x00c0, 0x17b9: 0x00c0, 0x17ba: 0x00c0, 0x17bb: 0x00c0, + 0x17bc: 0x00c0, 0x17bd: 0x00c0, 0x17be: 0x00c0, 0x17bf: 0x00c0, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x00c0, 0x17c1: 0x00c0, 0x17c2: 0x00c0, 0x17c3: 0x00c0, 0x17c4: 0x00c0, 0x17c5: 0x00c0, + 0x17c6: 0x00c0, 0x17c7: 0x00c0, 0x17c8: 0x00c0, 0x17c9: 0x00c0, 0x17ca: 0x00c0, 0x17cb: 0x00c0, + 0x17cc: 0x00c0, 0x17cd: 0x00c0, 0x17ce: 0x00c0, 0x17cf: 0x00c0, 0x17d0: 0x00c0, 0x17d1: 0x00c0, + 0x17d2: 0x00c0, 0x17d3: 0x00c0, 0x17d4: 0x00c0, 0x17d5: 0x00c0, 0x17d6: 0x00c0, 0x17d7: 0x00c0, + 0x17d8: 0x00c0, 0x17d9: 0x00c0, 0x17da: 0x00c0, 0x17db: 0x00c0, 0x17dc: 0x00c0, 0x17dd: 0x00c0, + 0x17de: 0x00c0, 0x17df: 0x00c0, 0x17e0: 0x00c0, 0x17e1: 0x00c0, 0x17e2: 0x00c0, 0x17e3: 0x00c0, + 0x17e4: 0x00c0, 0x17e5: 0x00c0, 0x17e6: 0x00c3, 0x17e7: 0x00c0, 0x17e8: 0x00c3, 0x17e9: 0x00c3, + 0x17ea: 0x00c0, 0x17eb: 0x00c0, 0x17ec: 0x00c0, 0x17ed: 0x00c3, 0x17ee: 0x00c0, 0x17ef: 0x00c3, + 0x17f0: 0x00c3, 0x17f1: 0x00c3, 0x17f2: 0x00c5, 0x17f3: 0x00c5, + 0x17fc: 0x0080, 0x17fd: 0x0080, 0x17fe: 0x0080, 0x17ff: 0x0080, + // Block 0x60, offset 0x1800 + 0x1800: 0x00c0, 0x1801: 0x00c0, 0x1802: 0x00c0, 0x1803: 0x00c0, 0x1804: 0x00c0, 0x1805: 0x00c0, + 0x1806: 0x00c0, 0x1807: 0x00c0, 0x1808: 0x00c0, 0x1809: 0x00c0, 0x180a: 0x00c0, 0x180b: 0x00c0, + 0x180c: 0x00c0, 0x180d: 0x00c0, 0x180e: 0x00c0, 0x180f: 0x00c0, 0x1810: 0x00c0, 0x1811: 0x00c0, + 0x1812: 0x00c0, 0x1813: 0x00c0, 0x1814: 0x00c0, 0x1815: 0x00c0, 0x1816: 0x00c0, 0x1817: 0x00c0, + 0x1818: 0x00c0, 0x1819: 0x00c0, 0x181a: 0x00c0, 0x181b: 0x00c0, 0x181c: 0x00c0, 0x181d: 0x00c0, + 0x181e: 0x00c0, 0x181f: 0x00c0, 0x1820: 0x00c0, 0x1821: 0x00c0, 0x1822: 0x00c0, 0x1823: 0x00c0, + 0x1824: 0x00c0, 0x1825: 0x00c0, 0x1826: 0x00c0, 0x1827: 0x00c0, 0x1828: 0x00c0, 0x1829: 0x00c0, + 0x182a: 0x00c0, 0x182b: 0x00c0, 0x182c: 0x00c3, 0x182d: 0x00c3, 0x182e: 0x00c3, 0x182f: 0x00c3, + 0x1830: 0x00c3, 0x1831: 0x00c3, 0x1832: 0x00c3, 0x1833: 0x00c3, 0x1834: 0x00c0, 0x1835: 0x00c0, + 0x1836: 0x00c3, 0x1837: 0x00c3, 0x183b: 0x0080, + 0x183c: 0x0080, 0x183d: 0x0080, 0x183e: 0x0080, 0x183f: 0x0080, + // Block 0x61, offset 0x1840 + 0x1840: 0x00c0, 0x1841: 0x00c0, 0x1842: 0x00c0, 0x1843: 0x00c0, 0x1844: 0x00c0, 0x1845: 0x00c0, + 0x1846: 0x00c0, 0x1847: 0x00c0, 0x1848: 0x00c0, 0x1849: 0x00c0, + 0x184d: 0x00c0, 0x184e: 0x00c0, 0x184f: 0x00c0, 0x1850: 0x00c0, 0x1851: 0x00c0, + 0x1852: 0x00c0, 0x1853: 0x00c0, 0x1854: 0x00c0, 0x1855: 0x00c0, 0x1856: 0x00c0, 0x1857: 0x00c0, + 0x1858: 0x00c0, 0x1859: 0x00c0, 0x185a: 0x00c0, 0x185b: 0x00c0, 0x185c: 0x00c0, 0x185d: 0x00c0, + 0x185e: 0x00c0, 0x185f: 0x00c0, 0x1860: 0x00c0, 0x1861: 0x00c0, 0x1862: 0x00c0, 0x1863: 0x00c0, + 0x1864: 0x00c0, 0x1865: 0x00c0, 0x1866: 0x00c0, 0x1867: 0x00c0, 0x1868: 0x00c0, 0x1869: 0x00c0, + 0x186a: 0x00c0, 0x186b: 0x00c0, 0x186c: 0x00c0, 0x186d: 0x00c0, 0x186e: 0x00c0, 0x186f: 0x00c0, + 0x1870: 0x00c0, 0x1871: 0x00c0, 0x1872: 0x00c0, 0x1873: 0x00c0, 0x1874: 0x00c0, 0x1875: 0x00c0, + 0x1876: 0x00c0, 0x1877: 0x00c0, 0x1878: 0x00c0, 0x1879: 0x00c0, 0x187a: 0x00c0, 0x187b: 0x00c0, + 0x187c: 0x00c0, 0x187d: 0x00c0, 0x187e: 0x0080, 0x187f: 0x0080, + // Block 0x62, offset 0x1880 + 0x1880: 0x00c0, 0x1881: 0x00c0, 0x1882: 0x00c0, 0x1883: 0x00c0, 0x1884: 0x00c0, 0x1885: 0x00c0, + 0x1886: 0x00c0, 0x1887: 0x00c0, 0x1888: 0x00c0, + 0x1890: 0x00c0, 0x1891: 0x00c0, + 0x1892: 0x00c0, 0x1893: 0x00c0, 0x1894: 0x00c0, 0x1895: 0x00c0, 0x1896: 0x00c0, 0x1897: 0x00c0, + 0x1898: 0x00c0, 0x1899: 0x00c0, 0x189a: 0x00c0, 0x189b: 0x00c0, 0x189c: 0x00c0, 0x189d: 0x00c0, + 0x189e: 0x00c0, 0x189f: 0x00c0, 0x18a0: 0x00c0, 0x18a1: 0x00c0, 0x18a2: 0x00c0, 0x18a3: 0x00c0, + 0x18a4: 0x00c0, 0x18a5: 0x00c0, 0x18a6: 0x00c0, 0x18a7: 0x00c0, 0x18a8: 0x00c0, 0x18a9: 0x00c0, + 0x18aa: 0x00c0, 0x18ab: 0x00c0, 0x18ac: 0x00c0, 0x18ad: 0x00c0, 0x18ae: 0x00c0, 0x18af: 0x00c0, + 0x18b0: 0x00c0, 0x18b1: 0x00c0, 0x18b2: 0x00c0, 0x18b3: 0x00c0, 0x18b4: 0x00c0, 0x18b5: 0x00c0, + 0x18b6: 0x00c0, 0x18b7: 0x00c0, 0x18b8: 0x00c0, 0x18b9: 0x00c0, 0x18ba: 0x00c0, + 0x18bd: 0x00c0, 0x18be: 0x00c0, 0x18bf: 0x00c0, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x0080, 0x18c1: 0x0080, 0x18c2: 0x0080, 0x18c3: 0x0080, 0x18c4: 0x0080, 0x18c5: 0x0080, + 0x18c6: 0x0080, 0x18c7: 0x0080, + 0x18d0: 0x00c3, 0x18d1: 0x00c3, + 0x18d2: 0x00c3, 0x18d3: 0x0080, 0x18d4: 0x00c3, 0x18d5: 0x00c3, 0x18d6: 0x00c3, 0x18d7: 0x00c3, + 0x18d8: 0x00c3, 0x18d9: 0x00c3, 0x18da: 0x00c3, 0x18db: 0x00c3, 0x18dc: 0x00c3, 0x18dd: 0x00c3, + 0x18de: 0x00c3, 0x18df: 0x00c3, 0x18e0: 0x00c3, 0x18e1: 0x00c0, 0x18e2: 0x00c3, 0x18e3: 0x00c3, + 0x18e4: 0x00c3, 0x18e5: 0x00c3, 0x18e6: 0x00c3, 0x18e7: 0x00c3, 0x18e8: 0x00c3, 0x18e9: 0x00c0, + 0x18ea: 0x00c0, 0x18eb: 0x00c0, 0x18ec: 0x00c0, 0x18ed: 0x00c3, 0x18ee: 0x00c0, 0x18ef: 0x00c0, + 0x18f0: 0x00c0, 0x18f1: 0x00c0, 0x18f2: 0x00c0, 0x18f3: 0x00c0, 0x18f4: 0x00c3, 0x18f5: 0x00c0, + 0x18f6: 0x00c0, 0x18f7: 0x00c0, 0x18f8: 0x00c3, 0x18f9: 0x00c3, 0x18fa: 0x00c0, + // Block 0x64, offset 0x1900 + 0x1900: 0x00c0, 0x1901: 0x00c0, 0x1902: 0x00c0, 0x1903: 0x00c0, 0x1904: 0x00c0, 0x1905: 0x00c0, + 0x1906: 0x00c0, 0x1907: 0x00c0, 0x1908: 0x00c0, 0x1909: 0x00c0, 0x190a: 0x00c0, 0x190b: 0x00c0, + 0x190c: 0x00c0, 0x190d: 0x00c0, 0x190e: 0x00c0, 0x190f: 0x00c0, 0x1910: 0x00c0, 0x1911: 0x00c0, + 0x1912: 0x00c0, 0x1913: 0x00c0, 0x1914: 0x00c0, 0x1915: 0x00c0, 0x1916: 0x00c0, 0x1917: 0x00c0, + 0x1918: 0x00c0, 0x1919: 0x00c0, 0x191a: 0x00c0, 0x191b: 0x00c0, 0x191c: 0x00c0, 0x191d: 0x00c0, + 0x191e: 0x00c0, 0x191f: 0x00c0, 0x1920: 0x00c0, 0x1921: 0x00c0, 0x1922: 0x00c0, 0x1923: 0x00c0, + 0x1924: 0x00c0, 0x1925: 0x00c0, 0x1926: 0x00c8, 0x1927: 0x00c8, 0x1928: 0x00c8, 0x1929: 0x00c8, + 0x192a: 0x00c8, 0x192b: 0x00c0, 0x192c: 0x0080, 0x192d: 0x0080, 0x192e: 0x0080, 0x192f: 0x00c0, + 0x1930: 0x0080, 0x1931: 0x0080, 0x1932: 0x0080, 0x1933: 0x0080, 0x1934: 0x0080, 0x1935: 0x0080, + 0x1936: 0x0080, 0x1937: 0x0080, 0x1938: 0x0080, 0x1939: 0x0080, 0x193a: 0x0080, 0x193b: 0x00c0, + 0x193c: 0x0080, 0x193d: 0x0080, 0x193e: 0x0080, 0x193f: 0x0080, + // Block 0x65, offset 0x1940 + 0x1940: 0x0080, 0x1941: 0x0080, 0x1942: 0x0080, 0x1943: 0x0080, 0x1944: 0x0080, 0x1945: 0x0080, + 0x1946: 0x0080, 0x1947: 0x0080, 0x1948: 0x0080, 0x1949: 0x0080, 0x194a: 0x0080, 0x194b: 0x0080, + 0x194c: 0x0080, 0x194d: 0x0080, 0x194e: 0x00c0, 0x194f: 0x0080, 0x1950: 0x0080, 0x1951: 0x0080, + 0x1952: 0x0080, 0x1953: 0x0080, 0x1954: 0x0080, 0x1955: 0x0080, 0x1956: 0x0080, 0x1957: 0x0080, + 0x1958: 0x0080, 0x1959: 0x0080, 0x195a: 0x0080, 0x195b: 0x0080, 0x195c: 0x0080, 0x195d: 0x0088, + 0x195e: 0x0088, 0x195f: 0x0088, 0x1960: 0x0088, 0x1961: 0x0088, 0x1962: 0x0080, 0x1963: 0x0080, + 0x1964: 0x0080, 0x1965: 0x0080, 0x1966: 0x0088, 0x1967: 0x0088, 0x1968: 0x0088, 0x1969: 0x0088, + 0x196a: 0x0088, 0x196b: 0x00c0, 0x196c: 0x00c0, 0x196d: 0x00c0, 0x196e: 0x00c0, 0x196f: 0x00c0, + 0x1970: 0x00c0, 0x1971: 0x00c0, 0x1972: 0x00c0, 0x1973: 0x00c0, 0x1974: 0x00c0, 0x1975: 0x00c0, + 0x1976: 0x00c0, 0x1977: 0x00c0, 0x1978: 0x0080, 0x1979: 0x00c0, 0x197a: 0x00c0, 0x197b: 0x00c0, + 0x197c: 0x00c0, 0x197d: 0x00c0, 0x197e: 0x00c0, 0x197f: 0x00c0, + // Block 0x66, offset 0x1980 + 0x1980: 0x00c0, 0x1981: 0x00c0, 0x1982: 0x00c0, 0x1983: 0x00c0, 0x1984: 0x00c0, 0x1985: 0x00c0, + 0x1986: 0x00c0, 0x1987: 0x00c0, 0x1988: 0x00c0, 0x1989: 0x00c0, 0x198a: 0x00c0, 0x198b: 0x00c0, + 0x198c: 0x00c0, 0x198d: 0x00c0, 0x198e: 0x00c0, 0x198f: 0x00c0, 0x1990: 0x00c0, 0x1991: 0x00c0, + 0x1992: 0x00c0, 0x1993: 0x00c0, 0x1994: 0x00c0, 0x1995: 0x00c0, 0x1996: 0x00c0, 0x1997: 0x00c0, + 0x1998: 0x00c0, 0x1999: 0x00c0, 0x199a: 0x00c0, 0x199b: 0x0080, 0x199c: 0x0080, 0x199d: 0x0080, + 0x199e: 0x0080, 0x199f: 0x0080, 0x19a0: 0x0080, 0x19a1: 0x0080, 0x19a2: 0x0080, 0x19a3: 0x0080, + 0x19a4: 0x0080, 0x19a5: 0x0080, 0x19a6: 0x0080, 0x19a7: 0x0080, 0x19a8: 0x0080, 0x19a9: 0x0080, + 0x19aa: 0x0080, 0x19ab: 0x0080, 0x19ac: 0x0080, 0x19ad: 0x0080, 0x19ae: 0x0080, 0x19af: 0x0080, + 0x19b0: 0x0080, 0x19b1: 0x0080, 0x19b2: 0x0080, 0x19b3: 0x0080, 0x19b4: 0x0080, 0x19b5: 0x0080, + 0x19b6: 0x0080, 0x19b7: 0x0080, 0x19b8: 0x0080, 0x19b9: 0x0080, 0x19ba: 0x0080, 0x19bb: 0x0080, + 0x19bc: 0x0080, 0x19bd: 0x0080, 0x19be: 0x0080, 0x19bf: 0x0088, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x00c0, 0x19c1: 0x00c0, 0x19c2: 0x00c0, 0x19c3: 0x00c0, 0x19c4: 0x00c0, 0x19c5: 0x00c0, + 0x19c6: 0x00c0, 0x19c7: 0x00c0, 0x19c8: 0x00c0, 0x19c9: 0x00c0, 0x19ca: 0x00c0, 0x19cb: 0x00c0, + 0x19cc: 0x00c0, 0x19cd: 0x00c0, 0x19ce: 0x00c0, 0x19cf: 0x00c0, 0x19d0: 0x00c0, 0x19d1: 0x00c0, + 0x19d2: 0x00c0, 0x19d3: 0x00c0, 0x19d4: 0x00c0, 0x19d5: 0x00c0, 0x19d6: 0x00c0, 0x19d7: 0x00c0, + 0x19d8: 0x00c0, 0x19d9: 0x00c0, 0x19da: 0x0080, 0x19db: 0x0080, 0x19dc: 0x00c0, 0x19dd: 0x00c0, + 0x19de: 0x00c0, 0x19df: 0x00c0, 0x19e0: 0x00c0, 0x19e1: 0x00c0, 0x19e2: 0x00c0, 0x19e3: 0x00c0, + 0x19e4: 0x00c0, 0x19e5: 0x00c0, 0x19e6: 0x00c0, 0x19e7: 0x00c0, 0x19e8: 0x00c0, 0x19e9: 0x00c0, + 0x19ea: 0x00c0, 0x19eb: 0x00c0, 0x19ec: 0x00c0, 0x19ed: 0x00c0, 0x19ee: 0x00c0, 0x19ef: 0x00c0, + 0x19f0: 0x00c0, 0x19f1: 0x00c0, 0x19f2: 0x00c0, 0x19f3: 0x00c0, 0x19f4: 0x00c0, 0x19f5: 0x00c0, + 0x19f6: 0x00c0, 0x19f7: 0x00c0, 0x19f8: 0x00c0, 0x19f9: 0x00c0, 0x19fa: 0x00c0, 0x19fb: 0x00c0, + 0x19fc: 0x00c0, 0x19fd: 0x00c0, 0x19fe: 0x00c0, 0x19ff: 0x00c0, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x00c8, 0x1a01: 0x00c8, 0x1a02: 0x00c8, 0x1a03: 0x00c8, 0x1a04: 0x00c8, 0x1a05: 0x00c8, + 0x1a06: 0x00c8, 0x1a07: 0x00c8, 0x1a08: 0x00c8, 0x1a09: 0x00c8, 0x1a0a: 0x00c8, 0x1a0b: 0x00c8, + 0x1a0c: 0x00c8, 0x1a0d: 0x00c8, 0x1a0e: 0x00c8, 0x1a0f: 0x00c8, 0x1a10: 0x00c8, 0x1a11: 0x00c8, + 0x1a12: 0x00c8, 0x1a13: 0x00c8, 0x1a14: 0x00c8, 0x1a15: 0x00c8, + 0x1a18: 0x00c8, 0x1a19: 0x00c8, 0x1a1a: 0x00c8, 0x1a1b: 0x00c8, 0x1a1c: 0x00c8, 0x1a1d: 0x00c8, + 0x1a20: 0x00c8, 0x1a21: 0x00c8, 0x1a22: 0x00c8, 0x1a23: 0x00c8, + 0x1a24: 0x00c8, 0x1a25: 0x00c8, 0x1a26: 0x00c8, 0x1a27: 0x00c8, 0x1a28: 0x00c8, 0x1a29: 0x00c8, + 0x1a2a: 0x00c8, 0x1a2b: 0x00c8, 0x1a2c: 0x00c8, 0x1a2d: 0x00c8, 0x1a2e: 0x00c8, 0x1a2f: 0x00c8, + 0x1a30: 0x00c8, 0x1a31: 0x00c8, 0x1a32: 0x00c8, 0x1a33: 0x00c8, 0x1a34: 0x00c8, 0x1a35: 0x00c8, + 0x1a36: 0x00c8, 0x1a37: 0x00c8, 0x1a38: 0x00c8, 0x1a39: 0x00c8, 0x1a3a: 0x00c8, 0x1a3b: 0x00c8, + 0x1a3c: 0x00c8, 0x1a3d: 0x00c8, 0x1a3e: 0x00c8, 0x1a3f: 0x00c8, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x00c8, 0x1a41: 0x00c8, 0x1a42: 0x00c8, 0x1a43: 0x00c8, 0x1a44: 0x00c8, 0x1a45: 0x00c8, + 0x1a48: 0x00c8, 0x1a49: 0x00c8, 0x1a4a: 0x00c8, 0x1a4b: 0x00c8, + 0x1a4c: 0x00c8, 0x1a4d: 0x00c8, 0x1a50: 0x00c8, 0x1a51: 0x00c8, + 0x1a52: 0x00c8, 0x1a53: 0x00c8, 0x1a54: 0x00c8, 0x1a55: 0x00c8, 0x1a56: 0x00c8, 0x1a57: 0x00c8, + 0x1a59: 0x00c8, 0x1a5b: 0x00c8, 0x1a5d: 0x00c8, + 0x1a5f: 0x00c8, 0x1a60: 0x00c8, 0x1a61: 0x00c8, 0x1a62: 0x00c8, 0x1a63: 0x00c8, + 0x1a64: 0x00c8, 0x1a65: 0x00c8, 0x1a66: 0x00c8, 0x1a67: 0x00c8, 0x1a68: 0x00c8, 0x1a69: 0x00c8, + 0x1a6a: 0x00c8, 0x1a6b: 0x00c8, 0x1a6c: 0x00c8, 0x1a6d: 0x00c8, 0x1a6e: 0x00c8, 0x1a6f: 0x00c8, + 0x1a70: 0x00c8, 0x1a71: 0x0088, 0x1a72: 0x00c8, 0x1a73: 0x0088, 0x1a74: 0x00c8, 0x1a75: 0x0088, + 0x1a76: 0x00c8, 0x1a77: 0x0088, 0x1a78: 0x00c8, 0x1a79: 0x0088, 0x1a7a: 0x00c8, 0x1a7b: 0x0088, + 0x1a7c: 0x00c8, 0x1a7d: 0x0088, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x00c8, 0x1a81: 0x00c8, 0x1a82: 0x00c8, 0x1a83: 0x00c8, 0x1a84: 0x00c8, 0x1a85: 0x00c8, + 0x1a86: 0x00c8, 0x1a87: 0x00c8, 0x1a88: 0x0088, 0x1a89: 0x0088, 0x1a8a: 0x0088, 0x1a8b: 0x0088, + 0x1a8c: 0x0088, 0x1a8d: 0x0088, 0x1a8e: 0x0088, 0x1a8f: 0x0088, 0x1a90: 0x00c8, 0x1a91: 0x00c8, + 0x1a92: 0x00c8, 0x1a93: 0x00c8, 0x1a94: 0x00c8, 0x1a95: 0x00c8, 0x1a96: 0x00c8, 0x1a97: 0x00c8, + 0x1a98: 0x0088, 0x1a99: 0x0088, 0x1a9a: 0x0088, 0x1a9b: 0x0088, 0x1a9c: 0x0088, 0x1a9d: 0x0088, + 0x1a9e: 0x0088, 0x1a9f: 0x0088, 0x1aa0: 0x00c8, 0x1aa1: 0x00c8, 0x1aa2: 0x00c8, 0x1aa3: 0x00c8, + 0x1aa4: 0x00c8, 0x1aa5: 0x00c8, 0x1aa6: 0x00c8, 0x1aa7: 0x00c8, 0x1aa8: 0x0088, 0x1aa9: 0x0088, + 0x1aaa: 0x0088, 0x1aab: 0x0088, 0x1aac: 0x0088, 0x1aad: 0x0088, 0x1aae: 0x0088, 0x1aaf: 0x0088, + 0x1ab0: 0x00c8, 0x1ab1: 0x00c8, 0x1ab2: 0x00c8, 0x1ab3: 0x00c8, 0x1ab4: 0x00c8, + 0x1ab6: 0x00c8, 0x1ab7: 0x00c8, 0x1ab8: 0x00c8, 0x1ab9: 0x00c8, 0x1aba: 0x00c8, 0x1abb: 0x0088, + 0x1abc: 0x0088, 0x1abd: 0x0088, 0x1abe: 0x0088, 0x1abf: 0x0088, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x0088, 0x1ac1: 0x0088, 0x1ac2: 0x00c8, 0x1ac3: 0x00c8, 0x1ac4: 0x00c8, + 0x1ac6: 0x00c8, 0x1ac7: 0x00c8, 0x1ac8: 0x00c8, 0x1ac9: 0x0088, 0x1aca: 0x00c8, 0x1acb: 0x0088, + 0x1acc: 0x0088, 0x1acd: 0x0088, 0x1ace: 0x0088, 0x1acf: 0x0088, 0x1ad0: 0x00c8, 0x1ad1: 0x00c8, + 0x1ad2: 0x00c8, 0x1ad3: 0x0088, 0x1ad6: 0x00c8, 0x1ad7: 0x00c8, + 0x1ad8: 0x00c8, 0x1ad9: 0x00c8, 0x1ada: 0x00c8, 0x1adb: 0x0088, 0x1add: 0x0088, + 0x1ade: 0x0088, 0x1adf: 0x0088, 0x1ae0: 0x00c8, 0x1ae1: 0x00c8, 0x1ae2: 0x00c8, 0x1ae3: 0x0088, + 0x1ae4: 0x00c8, 0x1ae5: 0x00c8, 0x1ae6: 0x00c8, 0x1ae7: 0x00c8, 0x1ae8: 0x00c8, 0x1ae9: 0x00c8, + 0x1aea: 0x00c8, 0x1aeb: 0x0088, 0x1aec: 0x00c8, 0x1aed: 0x0088, 0x1aee: 0x0088, 0x1aef: 0x0088, + 0x1af2: 0x00c8, 0x1af3: 0x00c8, 0x1af4: 0x00c8, + 0x1af6: 0x00c8, 0x1af7: 0x00c8, 0x1af8: 0x00c8, 0x1af9: 0x0088, 0x1afa: 0x00c8, 0x1afb: 0x0088, + 0x1afc: 0x0088, 0x1afd: 0x0088, 0x1afe: 0x0088, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x0080, 0x1b01: 0x0080, 0x1b02: 0x0080, 0x1b03: 0x0080, 0x1b04: 0x0080, 0x1b05: 0x0080, + 0x1b06: 0x0080, 0x1b07: 0x0080, 0x1b08: 0x0080, 0x1b09: 0x0080, 0x1b0a: 0x0080, 0x1b0b: 0x0040, + 0x1b0c: 0x004d, 0x1b0d: 0x004e, 0x1b0e: 0x0040, 0x1b0f: 0x0040, 0x1b10: 0x0080, 0x1b11: 0x0080, + 0x1b12: 0x0080, 0x1b13: 0x0080, 0x1b14: 0x0080, 0x1b15: 0x0080, 0x1b16: 0x0080, 0x1b17: 0x0080, + 0x1b18: 0x0080, 0x1b19: 0x0080, 0x1b1a: 0x0080, 0x1b1b: 0x0080, 0x1b1c: 0x0080, 0x1b1d: 0x0080, + 0x1b1e: 0x0080, 0x1b1f: 0x0080, 0x1b20: 0x0080, 0x1b21: 0x0080, 0x1b22: 0x0080, 0x1b23: 0x0080, + 0x1b24: 0x0080, 0x1b25: 0x0080, 0x1b26: 0x0080, 0x1b27: 0x0080, 0x1b28: 0x0040, 0x1b29: 0x0040, + 0x1b2a: 0x0040, 0x1b2b: 0x0040, 0x1b2c: 0x0040, 0x1b2d: 0x0040, 0x1b2e: 0x0040, 0x1b2f: 0x0080, + 0x1b30: 0x0080, 0x1b31: 0x0080, 0x1b32: 0x0080, 0x1b33: 0x0080, 0x1b34: 0x0080, 0x1b35: 0x0080, + 0x1b36: 0x0080, 0x1b37: 0x0080, 0x1b38: 0x0080, 0x1b39: 0x0080, 0x1b3a: 0x0080, 0x1b3b: 0x0080, + 0x1b3c: 0x0080, 0x1b3d: 0x0080, 0x1b3e: 0x0080, 0x1b3f: 0x0080, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x0080, 0x1b41: 0x0080, 0x1b42: 0x0080, 0x1b43: 0x0080, 0x1b44: 0x0080, 0x1b45: 0x0080, + 0x1b46: 0x0080, 0x1b47: 0x0080, 0x1b48: 0x0080, 0x1b49: 0x0080, 0x1b4a: 0x0080, 0x1b4b: 0x0080, + 0x1b4c: 0x0080, 0x1b4d: 0x0080, 0x1b4e: 0x0080, 0x1b4f: 0x0080, 0x1b50: 0x0080, 0x1b51: 0x0080, + 0x1b52: 0x0080, 0x1b53: 0x0080, 0x1b54: 0x0080, 0x1b55: 0x0080, 0x1b56: 0x0080, 0x1b57: 0x0080, + 0x1b58: 0x0080, 0x1b59: 0x0080, 0x1b5a: 0x0080, 0x1b5b: 0x0080, 0x1b5c: 0x0080, 0x1b5d: 0x0080, + 0x1b5e: 0x0080, 0x1b5f: 0x0080, 0x1b60: 0x0040, 0x1b61: 0x0040, 0x1b62: 0x0040, 0x1b63: 0x0040, + 0x1b64: 0x0040, 0x1b66: 0x0040, 0x1b67: 0x0040, 0x1b68: 0x0040, 0x1b69: 0x0040, + 0x1b6a: 0x0040, 0x1b6b: 0x0040, 0x1b6c: 0x0040, 0x1b6d: 0x0040, 0x1b6e: 0x0040, 0x1b6f: 0x0040, + 0x1b70: 0x0080, 0x1b71: 0x0080, 0x1b74: 0x0080, 0x1b75: 0x0080, + 0x1b76: 0x0080, 0x1b77: 0x0080, 0x1b78: 0x0080, 0x1b79: 0x0080, 0x1b7a: 0x0080, 0x1b7b: 0x0080, + 0x1b7c: 0x0080, 0x1b7d: 0x0080, 0x1b7e: 0x0080, 0x1b7f: 0x0080, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x0080, 0x1b81: 0x0080, 0x1b82: 0x0080, 0x1b83: 0x0080, 0x1b84: 0x0080, 0x1b85: 0x0080, + 0x1b86: 0x0080, 0x1b87: 0x0080, 0x1b88: 0x0080, 0x1b89: 0x0080, 0x1b8a: 0x0080, 0x1b8b: 0x0080, + 0x1b8c: 0x0080, 0x1b8d: 0x0080, 0x1b8e: 0x0080, 0x1b90: 0x0080, 0x1b91: 0x0080, + 0x1b92: 0x0080, 0x1b93: 0x0080, 0x1b94: 0x0080, 0x1b95: 0x0080, 0x1b96: 0x0080, 0x1b97: 0x0080, + 0x1b98: 0x0080, 0x1b99: 0x0080, 0x1b9a: 0x0080, 0x1b9b: 0x0080, 0x1b9c: 0x0080, + 0x1ba0: 0x0080, 0x1ba1: 0x0080, 0x1ba2: 0x0080, 0x1ba3: 0x0080, + 0x1ba4: 0x0080, 0x1ba5: 0x0080, 0x1ba6: 0x0080, 0x1ba7: 0x0080, 0x1ba8: 0x0080, 0x1ba9: 0x0080, + 0x1baa: 0x0080, 0x1bab: 0x0080, 0x1bac: 0x0080, 0x1bad: 0x0080, 0x1bae: 0x0080, 0x1baf: 0x0080, + 0x1bb0: 0x0080, 0x1bb1: 0x0080, 0x1bb2: 0x0080, 0x1bb3: 0x0080, 0x1bb4: 0x0080, 0x1bb5: 0x0080, + 0x1bb6: 0x0080, 0x1bb7: 0x0080, 0x1bb8: 0x0080, 0x1bb9: 0x0080, 0x1bba: 0x0080, 0x1bbb: 0x0080, + 0x1bbc: 0x0080, 0x1bbd: 0x0080, 0x1bbe: 0x0080, 0x1bbf: 0x0080, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0080, + 0x1bd0: 0x00c3, 0x1bd1: 0x00c3, + 0x1bd2: 0x00c3, 0x1bd3: 0x00c3, 0x1bd4: 0x00c3, 0x1bd5: 0x00c3, 0x1bd6: 0x00c3, 0x1bd7: 0x00c3, + 0x1bd8: 0x00c3, 0x1bd9: 0x00c3, 0x1bda: 0x00c3, 0x1bdb: 0x00c3, 0x1bdc: 0x00c3, 0x1bdd: 0x0083, + 0x1bde: 0x0083, 0x1bdf: 0x0083, 0x1be0: 0x0083, 0x1be1: 0x00c3, 0x1be2: 0x0083, 0x1be3: 0x0083, + 0x1be4: 0x0083, 0x1be5: 0x00c3, 0x1be6: 0x00c3, 0x1be7: 0x00c3, 0x1be8: 0x00c3, 0x1be9: 0x00c3, + 0x1bea: 0x00c3, 0x1beb: 0x00c3, 0x1bec: 0x00c3, 0x1bed: 0x00c3, 0x1bee: 0x00c3, 0x1bef: 0x00c3, + 0x1bf0: 0x00c3, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0080, 0x1c01: 0x0080, 0x1c02: 0x0080, 0x1c03: 0x0080, 0x1c04: 0x0080, 0x1c05: 0x0080, + 0x1c06: 0x0080, 0x1c07: 0x0080, 0x1c08: 0x0080, 0x1c09: 0x0080, 0x1c0a: 0x0080, 0x1c0b: 0x0080, + 0x1c0c: 0x0080, 0x1c0d: 0x0080, 0x1c0e: 0x0080, 0x1c0f: 0x0080, 0x1c10: 0x0080, 0x1c11: 0x0080, + 0x1c12: 0x0080, 0x1c13: 0x0080, 0x1c14: 0x0080, 0x1c15: 0x0080, 0x1c16: 0x0080, 0x1c17: 0x0080, + 0x1c18: 0x0080, 0x1c19: 0x0080, 0x1c1a: 0x0080, 0x1c1b: 0x0080, 0x1c1c: 0x0080, 0x1c1d: 0x0080, + 0x1c1e: 0x0080, 0x1c1f: 0x0080, 0x1c20: 0x0080, 0x1c21: 0x0080, 0x1c22: 0x0080, 0x1c23: 0x0080, + 0x1c24: 0x0080, 0x1c25: 0x0080, 0x1c26: 0x0088, 0x1c27: 0x0080, 0x1c28: 0x0080, 0x1c29: 0x0080, + 0x1c2a: 0x0080, 0x1c2b: 0x0080, 0x1c2c: 0x0080, 0x1c2d: 0x0080, 0x1c2e: 0x0080, 0x1c2f: 0x0080, + 0x1c30: 0x0080, 0x1c31: 0x0080, 0x1c32: 0x00c0, 0x1c33: 0x0080, 0x1c34: 0x0080, 0x1c35: 0x0080, + 0x1c36: 0x0080, 0x1c37: 0x0080, 0x1c38: 0x0080, 0x1c39: 0x0080, 0x1c3a: 0x0080, 0x1c3b: 0x0080, + 0x1c3c: 0x0080, 0x1c3d: 0x0080, 0x1c3e: 0x0080, 0x1c3f: 0x0080, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x0080, 0x1c41: 0x0080, 0x1c42: 0x0080, 0x1c43: 0x0080, 0x1c44: 0x0080, 0x1c45: 0x0080, + 0x1c46: 0x0080, 0x1c47: 0x0080, 0x1c48: 0x0080, 0x1c49: 0x0080, 0x1c4a: 0x0080, 0x1c4b: 0x0080, + 0x1c4c: 0x0080, 0x1c4d: 0x0080, 0x1c4e: 0x00c0, 0x1c4f: 0x0080, 0x1c50: 0x0080, 0x1c51: 0x0080, + 0x1c52: 0x0080, 0x1c53: 0x0080, 0x1c54: 0x0080, 0x1c55: 0x0080, 0x1c56: 0x0080, 0x1c57: 0x0080, + 0x1c58: 0x0080, 0x1c59: 0x0080, 0x1c5a: 0x0080, 0x1c5b: 0x0080, 0x1c5c: 0x0080, 0x1c5d: 0x0080, + 0x1c5e: 0x0080, 0x1c5f: 0x0080, 0x1c60: 0x0080, 0x1c61: 0x0080, 0x1c62: 0x0080, 0x1c63: 0x0080, + 0x1c64: 0x0080, 0x1c65: 0x0080, 0x1c66: 0x0080, 0x1c67: 0x0080, 0x1c68: 0x0080, 0x1c69: 0x0080, + 0x1c6a: 0x0080, 0x1c6b: 0x0080, 0x1c6c: 0x0080, 0x1c6d: 0x0080, 0x1c6e: 0x0080, 0x1c6f: 0x0080, + 0x1c70: 0x0080, 0x1c71: 0x0080, 0x1c72: 0x0080, 0x1c73: 0x0080, 0x1c74: 0x0080, 0x1c75: 0x0080, + 0x1c76: 0x0080, 0x1c77: 0x0080, 0x1c78: 0x0080, 0x1c79: 0x0080, 0x1c7a: 0x0080, 0x1c7b: 0x0080, + 0x1c7c: 0x0080, 0x1c7d: 0x0080, 0x1c7e: 0x0080, 0x1c7f: 0x0080, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x0080, 0x1c81: 0x0080, 0x1c82: 0x0080, 0x1c83: 0x00c0, 0x1c84: 0x00c0, 0x1c85: 0x0080, + 0x1c86: 0x0080, 0x1c87: 0x0080, 0x1c88: 0x0080, 0x1c89: 0x0080, 0x1c8a: 0x0080, 0x1c8b: 0x0080, + 0x1c90: 0x0080, 0x1c91: 0x0080, + 0x1c92: 0x0080, 0x1c93: 0x0080, 0x1c94: 0x0080, 0x1c95: 0x0080, 0x1c96: 0x0080, 0x1c97: 0x0080, + 0x1c98: 0x0080, 0x1c99: 0x0080, 0x1c9a: 0x0080, 0x1c9b: 0x0080, 0x1c9c: 0x0080, 0x1c9d: 0x0080, + 0x1c9e: 0x0080, 0x1c9f: 0x0080, 0x1ca0: 0x0080, 0x1ca1: 0x0080, 0x1ca2: 0x0080, 0x1ca3: 0x0080, + 0x1ca4: 0x0080, 0x1ca5: 0x0080, 0x1ca6: 0x0080, 0x1ca7: 0x0080, 0x1ca8: 0x0080, 0x1ca9: 0x0080, + 0x1caa: 0x0080, 0x1cab: 0x0080, 0x1cac: 0x0080, 0x1cad: 0x0080, 0x1cae: 0x0080, 0x1caf: 0x0080, + 0x1cb0: 0x0080, 0x1cb1: 0x0080, 0x1cb2: 0x0080, 0x1cb3: 0x0080, 0x1cb4: 0x0080, 0x1cb5: 0x0080, + 0x1cb6: 0x0080, 0x1cb7: 0x0080, 0x1cb8: 0x0080, 0x1cb9: 0x0080, 0x1cba: 0x0080, 0x1cbb: 0x0080, + 0x1cbc: 0x0080, 0x1cbd: 0x0080, 0x1cbe: 0x0080, 0x1cbf: 0x0080, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x0080, 0x1cc1: 0x0080, 0x1cc2: 0x0080, 0x1cc3: 0x0080, 0x1cc4: 0x0080, 0x1cc5: 0x0080, + 0x1cc6: 0x0080, 0x1cc7: 0x0080, 0x1cc8: 0x0080, 0x1cc9: 0x0080, 0x1cca: 0x0080, 0x1ccb: 0x0080, + 0x1ccc: 0x0080, 0x1ccd: 0x0080, 0x1cce: 0x0080, 0x1ccf: 0x0080, 0x1cd0: 0x0080, 0x1cd1: 0x0080, + 0x1cd2: 0x0080, 0x1cd3: 0x0080, 0x1cd4: 0x0080, 0x1cd5: 0x0080, 0x1cd6: 0x0080, 0x1cd7: 0x0080, + 0x1cd8: 0x0080, 0x1cd9: 0x0080, 0x1cda: 0x0080, 0x1cdb: 0x0080, 0x1cdc: 0x0080, 0x1cdd: 0x0080, + 0x1cde: 0x0080, 0x1cdf: 0x0080, 0x1ce0: 0x0080, 0x1ce1: 0x0080, 0x1ce2: 0x0080, 0x1ce3: 0x0080, + 0x1ce4: 0x0080, 0x1ce5: 0x0080, 0x1ce6: 0x0080, 0x1ce7: 0x0080, 0x1ce8: 0x0080, 0x1ce9: 0x0080, + 0x1cea: 0x0080, 0x1ceb: 0x0080, 0x1cec: 0x0080, 0x1ced: 0x0080, 0x1cee: 0x0080, 0x1cef: 0x0080, + 0x1cf0: 0x0080, 0x1cf1: 0x0080, 0x1cf2: 0x0080, 0x1cf3: 0x0080, 0x1cf4: 0x0080, 0x1cf5: 0x0080, + 0x1cf6: 0x0080, 0x1cf7: 0x0080, 0x1cf8: 0x0080, 0x1cf9: 0x0080, 0x1cfa: 0x0080, 0x1cfb: 0x0080, + 0x1cfc: 0x0080, 0x1cfd: 0x0080, 0x1cfe: 0x0080, 0x1cff: 0x0080, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x0080, 0x1d01: 0x0080, 0x1d02: 0x0080, 0x1d03: 0x0080, 0x1d04: 0x0080, 0x1d05: 0x0080, + 0x1d06: 0x0080, 0x1d07: 0x0080, 0x1d08: 0x0080, 0x1d09: 0x0080, 0x1d0a: 0x0080, 0x1d0b: 0x0080, + 0x1d0c: 0x0080, 0x1d0d: 0x0080, 0x1d0e: 0x0080, 0x1d0f: 0x0080, 0x1d10: 0x0080, 0x1d11: 0x0080, + 0x1d12: 0x0080, 0x1d13: 0x0080, 0x1d14: 0x0080, 0x1d15: 0x0080, 0x1d16: 0x0080, 0x1d17: 0x0080, + 0x1d18: 0x0080, 0x1d19: 0x0080, 0x1d1a: 0x0080, 0x1d1b: 0x0080, 0x1d1c: 0x0080, 0x1d1d: 0x0080, + 0x1d1e: 0x0080, 0x1d1f: 0x0080, 0x1d20: 0x0080, 0x1d21: 0x0080, 0x1d22: 0x0080, 0x1d23: 0x0080, + 0x1d24: 0x0080, 0x1d25: 0x0080, 0x1d26: 0x0080, + // Block 0x75, offset 0x1d40 + 0x1d40: 0x0080, 0x1d41: 0x0080, 0x1d42: 0x0080, 0x1d43: 0x0080, 0x1d44: 0x0080, 0x1d45: 0x0080, + 0x1d46: 0x0080, 0x1d47: 0x0080, 0x1d48: 0x0080, 0x1d49: 0x0080, 0x1d4a: 0x0080, + 0x1d60: 0x0080, 0x1d61: 0x0080, 0x1d62: 0x0080, 0x1d63: 0x0080, + 0x1d64: 0x0080, 0x1d65: 0x0080, 0x1d66: 0x0080, 0x1d67: 0x0080, 0x1d68: 0x0080, 0x1d69: 0x0080, + 0x1d6a: 0x0080, 0x1d6b: 0x0080, 0x1d6c: 0x0080, 0x1d6d: 0x0080, 0x1d6e: 0x0080, 0x1d6f: 0x0080, + 0x1d70: 0x0080, 0x1d71: 0x0080, 0x1d72: 0x0080, 0x1d73: 0x0080, 0x1d74: 0x0080, 0x1d75: 0x0080, + 0x1d76: 0x0080, 0x1d77: 0x0080, 0x1d78: 0x0080, 0x1d79: 0x0080, 0x1d7a: 0x0080, 0x1d7b: 0x0080, + 0x1d7c: 0x0080, 0x1d7d: 0x0080, 0x1d7e: 0x0080, 0x1d7f: 0x0080, + // Block 0x76, offset 0x1d80 + 0x1d80: 0x0080, 0x1d81: 0x0080, 0x1d82: 0x0080, 0x1d83: 0x0080, 0x1d84: 0x0080, 0x1d85: 0x0080, + 0x1d86: 0x0080, 0x1d87: 0x0080, 0x1d88: 0x0080, 0x1d89: 0x0080, 0x1d8a: 0x0080, 0x1d8b: 0x0080, + 0x1d8c: 0x0080, 0x1d8d: 0x0080, 0x1d8e: 0x0080, 0x1d8f: 0x0080, 0x1d90: 0x0080, 0x1d91: 0x0080, + 0x1d92: 0x0080, 0x1d93: 0x0080, 0x1d94: 0x0080, 0x1d95: 0x0080, 0x1d96: 0x0080, 0x1d97: 0x0080, + 0x1d98: 0x0080, 0x1d99: 0x0080, 0x1d9a: 0x0080, 0x1d9b: 0x0080, 0x1d9c: 0x0080, 0x1d9d: 0x0080, + 0x1d9e: 0x0080, 0x1d9f: 0x0080, 0x1da0: 0x0080, 0x1da1: 0x0080, 0x1da2: 0x0080, 0x1da3: 0x0080, + 0x1da4: 0x0080, 0x1da5: 0x0080, 0x1da6: 0x0080, 0x1da7: 0x0080, 0x1da8: 0x0080, 0x1da9: 0x0080, + 0x1daa: 0x0080, 0x1dab: 0x0080, 0x1dac: 0x0080, 0x1dad: 0x0080, 0x1dae: 0x0080, 0x1daf: 0x0080, + 0x1db0: 0x0080, 0x1db1: 0x0080, 0x1db2: 0x0080, 0x1db3: 0x0080, + 0x1db6: 0x0080, 0x1db7: 0x0080, 0x1db8: 0x0080, 0x1db9: 0x0080, 0x1dba: 0x0080, 0x1dbb: 0x0080, + 0x1dbc: 0x0080, 0x1dbd: 0x0080, 0x1dbe: 0x0080, 0x1dbf: 0x0080, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0x0080, 0x1dc1: 0x0080, 0x1dc2: 0x0080, 0x1dc3: 0x0080, 0x1dc4: 0x0080, 0x1dc5: 0x0080, + 0x1dc6: 0x0080, 0x1dc7: 0x0080, 0x1dc8: 0x0080, 0x1dc9: 0x0080, 0x1dca: 0x0080, 0x1dcb: 0x0080, + 0x1dcc: 0x0080, 0x1dcd: 0x0080, 0x1dce: 0x0080, 0x1dcf: 0x0080, 0x1dd0: 0x0080, 0x1dd1: 0x0080, + 0x1dd2: 0x0080, 0x1dd3: 0x0080, 0x1dd4: 0x0080, 0x1dd5: 0x0080, 0x1dd7: 0x0080, + 0x1dd8: 0x0080, 0x1dd9: 0x0080, 0x1dda: 0x0080, 0x1ddb: 0x0080, 0x1ddc: 0x0080, 0x1ddd: 0x0080, + 0x1dde: 0x0080, 0x1ddf: 0x0080, 0x1de0: 0x0080, 0x1de1: 0x0080, 0x1de2: 0x0080, 0x1de3: 0x0080, + 0x1de4: 0x0080, 0x1de5: 0x0080, 0x1de6: 0x0080, 0x1de7: 0x0080, 0x1de8: 0x0080, 0x1de9: 0x0080, + 0x1dea: 0x0080, 0x1deb: 0x0080, 0x1dec: 0x0080, 0x1ded: 0x0080, 0x1dee: 0x0080, 0x1def: 0x0080, + 0x1df0: 0x0080, 0x1df1: 0x0080, 0x1df2: 0x0080, 0x1df3: 0x0080, 0x1df4: 0x0080, 0x1df5: 0x0080, + 0x1df6: 0x0080, 0x1df7: 0x0080, 0x1df8: 0x0080, 0x1df9: 0x0080, 0x1dfa: 0x0080, 0x1dfb: 0x0080, + 0x1dfc: 0x0080, 0x1dfd: 0x0080, 0x1dfe: 0x0080, 0x1dff: 0x0080, + // Block 0x78, offset 0x1e00 + 0x1e00: 0x00c0, 0x1e01: 0x00c0, 0x1e02: 0x00c0, 0x1e03: 0x00c0, 0x1e04: 0x00c0, 0x1e05: 0x00c0, + 0x1e06: 0x00c0, 0x1e07: 0x00c0, 0x1e08: 0x00c0, 0x1e09: 0x00c0, 0x1e0a: 0x00c0, 0x1e0b: 0x00c0, + 0x1e0c: 0x00c0, 0x1e0d: 0x00c0, 0x1e0e: 0x00c0, 0x1e0f: 0x00c0, 0x1e10: 0x00c0, 0x1e11: 0x00c0, + 0x1e12: 0x00c0, 0x1e13: 0x00c0, 0x1e14: 0x00c0, 0x1e15: 0x00c0, 0x1e16: 0x00c0, 0x1e17: 0x00c0, + 0x1e18: 0x00c0, 0x1e19: 0x00c0, 0x1e1a: 0x00c0, 0x1e1b: 0x00c0, 0x1e1c: 0x00c0, 0x1e1d: 0x00c0, + 0x1e1e: 0x00c0, 0x1e1f: 0x00c0, 0x1e20: 0x00c0, 0x1e21: 0x00c0, 0x1e22: 0x00c0, 0x1e23: 0x00c0, + 0x1e24: 0x00c0, 0x1e25: 0x00c0, 0x1e26: 0x00c0, 0x1e27: 0x00c0, 0x1e28: 0x00c0, 0x1e29: 0x00c0, + 0x1e2a: 0x00c0, 0x1e2b: 0x00c0, 0x1e2c: 0x00c0, 0x1e2d: 0x00c0, 0x1e2e: 0x00c0, 0x1e2f: 0x00c0, + 0x1e30: 0x00c0, 0x1e31: 0x00c0, 0x1e32: 0x00c0, 0x1e33: 0x00c0, 0x1e34: 0x00c0, 0x1e35: 0x00c0, + 0x1e36: 0x00c0, 0x1e37: 0x00c0, 0x1e38: 0x00c0, 0x1e39: 0x00c0, 0x1e3a: 0x00c0, 0x1e3b: 0x00c0, + 0x1e3c: 0x0080, 0x1e3d: 0x0080, 0x1e3e: 0x00c0, 0x1e3f: 0x00c0, + // Block 0x79, offset 0x1e40 + 0x1e40: 0x00c0, 0x1e41: 0x00c0, 0x1e42: 0x00c0, 0x1e43: 0x00c0, 0x1e44: 0x00c0, 0x1e45: 0x00c0, + 0x1e46: 0x00c0, 0x1e47: 0x00c0, 0x1e48: 0x00c0, 0x1e49: 0x00c0, 0x1e4a: 0x00c0, 0x1e4b: 0x00c0, + 0x1e4c: 0x00c0, 0x1e4d: 0x00c0, 0x1e4e: 0x00c0, 0x1e4f: 0x00c0, 0x1e50: 0x00c0, 0x1e51: 0x00c0, + 0x1e52: 0x00c0, 0x1e53: 0x00c0, 0x1e54: 0x00c0, 0x1e55: 0x00c0, 0x1e56: 0x00c0, 0x1e57: 0x00c0, + 0x1e58: 0x00c0, 0x1e59: 0x00c0, 0x1e5a: 0x00c0, 0x1e5b: 0x00c0, 0x1e5c: 0x00c0, 0x1e5d: 0x00c0, + 0x1e5e: 0x00c0, 0x1e5f: 0x00c0, 0x1e60: 0x00c0, 0x1e61: 0x00c0, 0x1e62: 0x00c0, 0x1e63: 0x00c0, + 0x1e64: 0x00c0, 0x1e65: 0x0080, 0x1e66: 0x0080, 0x1e67: 0x0080, 0x1e68: 0x0080, 0x1e69: 0x0080, + 0x1e6a: 0x0080, 0x1e6b: 0x00c0, 0x1e6c: 0x00c0, 0x1e6d: 0x00c0, 0x1e6e: 0x00c0, 0x1e6f: 0x00c3, + 0x1e70: 0x00c3, 0x1e71: 0x00c3, 0x1e72: 0x00c0, 0x1e73: 0x00c0, + 0x1e79: 0x0080, 0x1e7a: 0x0080, 0x1e7b: 0x0080, + 0x1e7c: 0x0080, 0x1e7d: 0x0080, 0x1e7e: 0x0080, 0x1e7f: 0x0080, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x00c0, 0x1e81: 0x00c0, 0x1e82: 0x00c0, 0x1e83: 0x00c0, 0x1e84: 0x00c0, 0x1e85: 0x00c0, + 0x1e86: 0x00c0, 0x1e87: 0x00c0, 0x1e88: 0x00c0, 0x1e89: 0x00c0, 0x1e8a: 0x00c0, 0x1e8b: 0x00c0, + 0x1e8c: 0x00c0, 0x1e8d: 0x00c0, 0x1e8e: 0x00c0, 0x1e8f: 0x00c0, 0x1e90: 0x00c0, 0x1e91: 0x00c0, + 0x1e92: 0x00c0, 0x1e93: 0x00c0, 0x1e94: 0x00c0, 0x1e95: 0x00c0, 0x1e96: 0x00c0, 0x1e97: 0x00c0, + 0x1e98: 0x00c0, 0x1e99: 0x00c0, 0x1e9a: 0x00c0, 0x1e9b: 0x00c0, 0x1e9c: 0x00c0, 0x1e9d: 0x00c0, + 0x1e9e: 0x00c0, 0x1e9f: 0x00c0, 0x1ea0: 0x00c0, 0x1ea1: 0x00c0, 0x1ea2: 0x00c0, 0x1ea3: 0x00c0, + 0x1ea4: 0x00c0, 0x1ea5: 0x00c0, 0x1ea7: 0x00c0, + 0x1ead: 0x00c0, + 0x1eb0: 0x00c0, 0x1eb1: 0x00c0, 0x1eb2: 0x00c0, 0x1eb3: 0x00c0, 0x1eb4: 0x00c0, 0x1eb5: 0x00c0, + 0x1eb6: 0x00c0, 0x1eb7: 0x00c0, 0x1eb8: 0x00c0, 0x1eb9: 0x00c0, 0x1eba: 0x00c0, 0x1ebb: 0x00c0, + 0x1ebc: 0x00c0, 0x1ebd: 0x00c0, 0x1ebe: 0x00c0, 0x1ebf: 0x00c0, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x00c0, 0x1ec1: 0x00c0, 0x1ec2: 0x00c0, 0x1ec3: 0x00c0, 0x1ec4: 0x00c0, 0x1ec5: 0x00c0, + 0x1ec6: 0x00c0, 0x1ec7: 0x00c0, 0x1ec8: 0x00c0, 0x1ec9: 0x00c0, 0x1eca: 0x00c0, 0x1ecb: 0x00c0, + 0x1ecc: 0x00c0, 0x1ecd: 0x00c0, 0x1ece: 0x00c0, 0x1ecf: 0x00c0, 0x1ed0: 0x00c0, 0x1ed1: 0x00c0, + 0x1ed2: 0x00c0, 0x1ed3: 0x00c0, 0x1ed4: 0x00c0, 0x1ed5: 0x00c0, 0x1ed6: 0x00c0, 0x1ed7: 0x00c0, + 0x1ed8: 0x00c0, 0x1ed9: 0x00c0, 0x1eda: 0x00c0, 0x1edb: 0x00c0, 0x1edc: 0x00c0, 0x1edd: 0x00c0, + 0x1ede: 0x00c0, 0x1edf: 0x00c0, 0x1ee0: 0x00c0, 0x1ee1: 0x00c0, 0x1ee2: 0x00c0, 0x1ee3: 0x00c0, + 0x1ee4: 0x00c0, 0x1ee5: 0x00c0, 0x1ee6: 0x00c0, 0x1ee7: 0x00c0, + 0x1eef: 0x0080, + 0x1ef0: 0x0080, + 0x1eff: 0x00c6, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0x00c0, 0x1f01: 0x00c0, 0x1f02: 0x00c0, 0x1f03: 0x00c0, 0x1f04: 0x00c0, 0x1f05: 0x00c0, + 0x1f06: 0x00c0, 0x1f07: 0x00c0, 0x1f08: 0x00c0, 0x1f09: 0x00c0, 0x1f0a: 0x00c0, 0x1f0b: 0x00c0, + 0x1f0c: 0x00c0, 0x1f0d: 0x00c0, 0x1f0e: 0x00c0, 0x1f0f: 0x00c0, 0x1f10: 0x00c0, 0x1f11: 0x00c0, + 0x1f12: 0x00c0, 0x1f13: 0x00c0, 0x1f14: 0x00c0, 0x1f15: 0x00c0, 0x1f16: 0x00c0, + 0x1f20: 0x00c0, 0x1f21: 0x00c0, 0x1f22: 0x00c0, 0x1f23: 0x00c0, + 0x1f24: 0x00c0, 0x1f25: 0x00c0, 0x1f26: 0x00c0, 0x1f28: 0x00c0, 0x1f29: 0x00c0, + 0x1f2a: 0x00c0, 0x1f2b: 0x00c0, 0x1f2c: 0x00c0, 0x1f2d: 0x00c0, 0x1f2e: 0x00c0, + 0x1f30: 0x00c0, 0x1f31: 0x00c0, 0x1f32: 0x00c0, 0x1f33: 0x00c0, 0x1f34: 0x00c0, 0x1f35: 0x00c0, + 0x1f36: 0x00c0, 0x1f38: 0x00c0, 0x1f39: 0x00c0, 0x1f3a: 0x00c0, 0x1f3b: 0x00c0, + 0x1f3c: 0x00c0, 0x1f3d: 0x00c0, 0x1f3e: 0x00c0, + // Block 0x7d, offset 0x1f40 + 0x1f40: 0x00c0, 0x1f41: 0x00c0, 0x1f42: 0x00c0, 0x1f43: 0x00c0, 0x1f44: 0x00c0, 0x1f45: 0x00c0, + 0x1f46: 0x00c0, 0x1f48: 0x00c0, 0x1f49: 0x00c0, 0x1f4a: 0x00c0, 0x1f4b: 0x00c0, + 0x1f4c: 0x00c0, 0x1f4d: 0x00c0, 0x1f4e: 0x00c0, 0x1f50: 0x00c0, 0x1f51: 0x00c0, + 0x1f52: 0x00c0, 0x1f53: 0x00c0, 0x1f54: 0x00c0, 0x1f55: 0x00c0, 0x1f56: 0x00c0, + 0x1f58: 0x00c0, 0x1f59: 0x00c0, 0x1f5a: 0x00c0, 0x1f5b: 0x00c0, 0x1f5c: 0x00c0, 0x1f5d: 0x00c0, + 0x1f5e: 0x00c0, 0x1f60: 0x00c3, 0x1f61: 0x00c3, 0x1f62: 0x00c3, 0x1f63: 0x00c3, + 0x1f64: 0x00c3, 0x1f65: 0x00c3, 0x1f66: 0x00c3, 0x1f67: 0x00c3, 0x1f68: 0x00c3, 0x1f69: 0x00c3, + 0x1f6a: 0x00c3, 0x1f6b: 0x00c3, 0x1f6c: 0x00c3, 0x1f6d: 0x00c3, 0x1f6e: 0x00c3, 0x1f6f: 0x00c3, + 0x1f70: 0x00c3, 0x1f71: 0x00c3, 0x1f72: 0x00c3, 0x1f73: 0x00c3, 0x1f74: 0x00c3, 0x1f75: 0x00c3, + 0x1f76: 0x00c3, 0x1f77: 0x00c3, 0x1f78: 0x00c3, 0x1f79: 0x00c3, 0x1f7a: 0x00c3, 0x1f7b: 0x00c3, + 0x1f7c: 0x00c3, 0x1f7d: 0x00c3, 0x1f7e: 0x00c3, 0x1f7f: 0x00c3, + // Block 0x7e, offset 0x1f80 + 0x1f80: 0x0080, 0x1f81: 0x0080, 0x1f82: 0x0080, 0x1f83: 0x0080, 0x1f84: 0x0080, 0x1f85: 0x0080, + 0x1f86: 0x0080, 0x1f87: 0x0080, 0x1f88: 0x0080, 0x1f89: 0x0080, 0x1f8a: 0x0080, 0x1f8b: 0x0080, + 0x1f8c: 0x0080, 0x1f8d: 0x0080, 0x1f8e: 0x0080, 0x1f8f: 0x0080, 0x1f90: 0x0080, 0x1f91: 0x0080, + 0x1f92: 0x0080, 0x1f93: 0x0080, 0x1f94: 0x0080, 0x1f95: 0x0080, 0x1f96: 0x0080, 0x1f97: 0x0080, + 0x1f98: 0x0080, 0x1f99: 0x0080, 0x1f9a: 0x0080, 0x1f9b: 0x0080, 0x1f9c: 0x0080, 0x1f9d: 0x0080, + 0x1f9e: 0x0080, 0x1f9f: 0x0080, 0x1fa0: 0x0080, 0x1fa1: 0x0080, 0x1fa2: 0x0080, 0x1fa3: 0x0080, + 0x1fa4: 0x0080, 0x1fa5: 0x0080, 0x1fa6: 0x0080, 0x1fa7: 0x0080, 0x1fa8: 0x0080, 0x1fa9: 0x0080, + 0x1faa: 0x0080, 0x1fab: 0x0080, 0x1fac: 0x0080, 0x1fad: 0x0080, 0x1fae: 0x0080, 0x1faf: 0x00c0, + 0x1fb0: 0x0080, 0x1fb1: 0x0080, 0x1fb2: 0x0080, 0x1fb3: 0x0080, 0x1fb4: 0x0080, 0x1fb5: 0x0080, + 0x1fb6: 0x0080, 0x1fb7: 0x0080, 0x1fb8: 0x0080, 0x1fb9: 0x0080, 0x1fba: 0x0080, 0x1fbb: 0x0080, + 0x1fbc: 0x0080, 0x1fbd: 0x0080, 0x1fbe: 0x0080, 0x1fbf: 0x0080, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x0080, 0x1fc1: 0x0080, 0x1fc2: 0x0080, 0x1fc3: 0x0080, 0x1fc4: 0x0080, 0x1fc5: 0x0080, + 0x1fc6: 0x0080, 0x1fc7: 0x0080, 0x1fc8: 0x0080, 0x1fc9: 0x0080, 0x1fca: 0x0080, 0x1fcb: 0x0080, + 0x1fcc: 0x0080, 0x1fcd: 0x0080, 0x1fce: 0x0080, 0x1fcf: 0x0080, 0x1fd0: 0x0080, 0x1fd1: 0x0080, + 0x1fd2: 0x0080, 0x1fd3: 0x0080, 0x1fd4: 0x0080, 0x1fd5: 0x0080, 0x1fd6: 0x0080, 0x1fd7: 0x0080, + 0x1fd8: 0x0080, 0x1fd9: 0x0080, 0x1fda: 0x0080, 0x1fdb: 0x0080, 0x1fdc: 0x0080, 0x1fdd: 0x0080, + // Block 0x80, offset 0x2000 + 0x2000: 0x008c, 0x2001: 0x008c, 0x2002: 0x008c, 0x2003: 0x008c, 0x2004: 0x008c, 0x2005: 0x008c, + 0x2006: 0x008c, 0x2007: 0x008c, 0x2008: 0x008c, 0x2009: 0x008c, 0x200a: 0x008c, 0x200b: 0x008c, + 0x200c: 0x008c, 0x200d: 0x008c, 0x200e: 0x008c, 0x200f: 0x008c, 0x2010: 0x008c, 0x2011: 0x008c, + 0x2012: 0x008c, 0x2013: 0x008c, 0x2014: 0x008c, 0x2015: 0x008c, 0x2016: 0x008c, 0x2017: 0x008c, + 0x2018: 0x008c, 0x2019: 0x008c, 0x201b: 0x008c, 0x201c: 0x008c, 0x201d: 0x008c, + 0x201e: 0x008c, 0x201f: 0x008c, 0x2020: 0x008c, 0x2021: 0x008c, 0x2022: 0x008c, 0x2023: 0x008c, + 0x2024: 0x008c, 0x2025: 0x008c, 0x2026: 0x008c, 0x2027: 0x008c, 0x2028: 0x008c, 0x2029: 0x008c, + 0x202a: 0x008c, 0x202b: 0x008c, 0x202c: 0x008c, 0x202d: 0x008c, 0x202e: 0x008c, 0x202f: 0x008c, + 0x2030: 0x008c, 0x2031: 0x008c, 0x2032: 0x008c, 0x2033: 0x008c, 0x2034: 0x008c, 0x2035: 0x008c, + 0x2036: 0x008c, 0x2037: 0x008c, 0x2038: 0x008c, 0x2039: 0x008c, 0x203a: 0x008c, 0x203b: 0x008c, + 0x203c: 0x008c, 0x203d: 0x008c, 0x203e: 0x008c, 0x203f: 0x008c, + // Block 0x81, offset 0x2040 + 0x2040: 0x008c, 0x2041: 0x008c, 0x2042: 0x008c, 0x2043: 0x008c, 0x2044: 0x008c, 0x2045: 0x008c, + 0x2046: 0x008c, 0x2047: 0x008c, 0x2048: 0x008c, 0x2049: 0x008c, 0x204a: 0x008c, 0x204b: 0x008c, + 0x204c: 0x008c, 0x204d: 0x008c, 0x204e: 0x008c, 0x204f: 0x008c, 0x2050: 0x008c, 0x2051: 0x008c, + 0x2052: 0x008c, 0x2053: 0x008c, 0x2054: 0x008c, 0x2055: 0x008c, 0x2056: 0x008c, 0x2057: 0x008c, + 0x2058: 0x008c, 0x2059: 0x008c, 0x205a: 0x008c, 0x205b: 0x008c, 0x205c: 0x008c, 0x205d: 0x008c, + 0x205e: 0x008c, 0x205f: 0x008c, 0x2060: 0x008c, 0x2061: 0x008c, 0x2062: 0x008c, 0x2063: 0x008c, + 0x2064: 0x008c, 0x2065: 0x008c, 0x2066: 0x008c, 0x2067: 0x008c, 0x2068: 0x008c, 0x2069: 0x008c, + 0x206a: 0x008c, 0x206b: 0x008c, 0x206c: 0x008c, 0x206d: 0x008c, 0x206e: 0x008c, 0x206f: 0x008c, + 0x2070: 0x008c, 0x2071: 0x008c, 0x2072: 0x008c, 0x2073: 0x008c, + // Block 0x82, offset 0x2080 + 0x2080: 0x008c, 0x2081: 0x008c, 0x2082: 0x008c, 0x2083: 0x008c, 0x2084: 0x008c, 0x2085: 0x008c, + 0x2086: 0x008c, 0x2087: 0x008c, 0x2088: 0x008c, 0x2089: 0x008c, 0x208a: 0x008c, 0x208b: 0x008c, + 0x208c: 0x008c, 0x208d: 0x008c, 0x208e: 0x008c, 0x208f: 0x008c, 0x2090: 0x008c, 0x2091: 0x008c, + 0x2092: 0x008c, 0x2093: 0x008c, 0x2094: 0x008c, 0x2095: 0x008c, 0x2096: 0x008c, 0x2097: 0x008c, + 0x2098: 0x008c, 0x2099: 0x008c, 0x209a: 0x008c, 0x209b: 0x008c, 0x209c: 0x008c, 0x209d: 0x008c, + 0x209e: 0x008c, 0x209f: 0x008c, 0x20a0: 0x008c, 0x20a1: 0x008c, 0x20a2: 0x008c, 0x20a3: 0x008c, + 0x20a4: 0x008c, 0x20a5: 0x008c, 0x20a6: 0x008c, 0x20a7: 0x008c, 0x20a8: 0x008c, 0x20a9: 0x008c, + 0x20aa: 0x008c, 0x20ab: 0x008c, 0x20ac: 0x008c, 0x20ad: 0x008c, 0x20ae: 0x008c, 0x20af: 0x008c, + 0x20b0: 0x008c, 0x20b1: 0x008c, 0x20b2: 0x008c, 0x20b3: 0x008c, 0x20b4: 0x008c, 0x20b5: 0x008c, + 0x20b6: 0x008c, 0x20b7: 0x008c, 0x20b8: 0x008c, 0x20b9: 0x008c, 0x20ba: 0x008c, 0x20bb: 0x008c, + 0x20bc: 0x008c, 0x20bd: 0x008c, 0x20be: 0x008c, 0x20bf: 0x008c, + // Block 0x83, offset 0x20c0 + 0x20c0: 0x008c, 0x20c1: 0x008c, 0x20c2: 0x008c, 0x20c3: 0x008c, 0x20c4: 0x008c, 0x20c5: 0x008c, + 0x20c6: 0x008c, 0x20c7: 0x008c, 0x20c8: 0x008c, 0x20c9: 0x008c, 0x20ca: 0x008c, 0x20cb: 0x008c, + 0x20cc: 0x008c, 0x20cd: 0x008c, 0x20ce: 0x008c, 0x20cf: 0x008c, 0x20d0: 0x008c, 0x20d1: 0x008c, + 0x20d2: 0x008c, 0x20d3: 0x008c, 0x20d4: 0x008c, 0x20d5: 0x008c, + 0x20f0: 0x0080, 0x20f1: 0x0080, 0x20f2: 0x0080, 0x20f3: 0x0080, 0x20f4: 0x0080, 0x20f5: 0x0080, + 0x20f6: 0x0080, 0x20f7: 0x0080, 0x20f8: 0x0080, 0x20f9: 0x0080, 0x20fa: 0x0080, 0x20fb: 0x0080, + // Block 0x84, offset 0x2100 + 0x2100: 0x0080, 0x2101: 0x0080, 0x2102: 0x0080, 0x2103: 0x0080, 0x2104: 0x0080, 0x2105: 0x00cc, + 0x2106: 0x00c0, 0x2107: 0x00cc, 0x2108: 0x0080, 0x2109: 0x0080, 0x210a: 0x0080, 0x210b: 0x0080, + 0x210c: 0x0080, 0x210d: 0x0080, 0x210e: 0x0080, 0x210f: 0x0080, 0x2110: 0x0080, 0x2111: 0x0080, + 0x2112: 0x0080, 0x2113: 0x0080, 0x2114: 0x0080, 0x2115: 0x0080, 0x2116: 0x0080, 0x2117: 0x0080, + 0x2118: 0x0080, 0x2119: 0x0080, 0x211a: 0x0080, 0x211b: 0x0080, 0x211c: 0x0080, 0x211d: 0x0080, + 0x211e: 0x0080, 0x211f: 0x0080, 0x2120: 0x0080, 0x2121: 0x008c, 0x2122: 0x008c, 0x2123: 0x008c, + 0x2124: 0x008c, 0x2125: 0x008c, 0x2126: 0x008c, 0x2127: 0x008c, 0x2128: 0x008c, 0x2129: 0x008c, + 0x212a: 0x00c3, 0x212b: 0x00c3, 0x212c: 0x00c3, 0x212d: 0x00c3, 0x212e: 0x0040, 0x212f: 0x0040, + 0x2130: 0x0080, 0x2131: 0x0040, 0x2132: 0x0040, 0x2133: 0x0040, 0x2134: 0x0040, 0x2135: 0x0040, + 0x2136: 0x0080, 0x2137: 0x0080, 0x2138: 0x008c, 0x2139: 0x008c, 0x213a: 0x008c, 0x213b: 0x0040, + 0x213c: 0x00c0, 0x213d: 0x0080, 0x213e: 0x0080, 0x213f: 0x0080, + // Block 0x85, offset 0x2140 + 0x2141: 0x00cc, 0x2142: 0x00cc, 0x2143: 0x00cc, 0x2144: 0x00cc, 0x2145: 0x00cc, + 0x2146: 0x00cc, 0x2147: 0x00cc, 0x2148: 0x00cc, 0x2149: 0x00cc, 0x214a: 0x00cc, 0x214b: 0x00cc, + 0x214c: 0x00cc, 0x214d: 0x00cc, 0x214e: 0x00cc, 0x214f: 0x00cc, 0x2150: 0x00cc, 0x2151: 0x00cc, + 0x2152: 0x00cc, 0x2153: 0x00cc, 0x2154: 0x00cc, 0x2155: 0x00cc, 0x2156: 0x00cc, 0x2157: 0x00cc, + 0x2158: 0x00cc, 0x2159: 0x00cc, 0x215a: 0x00cc, 0x215b: 0x00cc, 0x215c: 0x00cc, 0x215d: 0x00cc, + 0x215e: 0x00cc, 0x215f: 0x00cc, 0x2160: 0x00cc, 0x2161: 0x00cc, 0x2162: 0x00cc, 0x2163: 0x00cc, + 0x2164: 0x00cc, 0x2165: 0x00cc, 0x2166: 0x00cc, 0x2167: 0x00cc, 0x2168: 0x00cc, 0x2169: 0x00cc, + 0x216a: 0x00cc, 0x216b: 0x00cc, 0x216c: 0x00cc, 0x216d: 0x00cc, 0x216e: 0x00cc, 0x216f: 0x00cc, + 0x2170: 0x00cc, 0x2171: 0x00cc, 0x2172: 0x00cc, 0x2173: 0x00cc, 0x2174: 0x00cc, 0x2175: 0x00cc, + 0x2176: 0x00cc, 0x2177: 0x00cc, 0x2178: 0x00cc, 0x2179: 0x00cc, 0x217a: 0x00cc, 0x217b: 0x00cc, + 0x217c: 0x00cc, 0x217d: 0x00cc, 0x217e: 0x00cc, 0x217f: 0x00cc, + // Block 0x86, offset 0x2180 + 0x2180: 0x00cc, 0x2181: 0x00cc, 0x2182: 0x00cc, 0x2183: 0x00cc, 0x2184: 0x00cc, 0x2185: 0x00cc, + 0x2186: 0x00cc, 0x2187: 0x00cc, 0x2188: 0x00cc, 0x2189: 0x00cc, 0x218a: 0x00cc, 0x218b: 0x00cc, + 0x218c: 0x00cc, 0x218d: 0x00cc, 0x218e: 0x00cc, 0x218f: 0x00cc, 0x2190: 0x00cc, 0x2191: 0x00cc, + 0x2192: 0x00cc, 0x2193: 0x00cc, 0x2194: 0x00cc, 0x2195: 0x00cc, 0x2196: 0x00cc, + 0x2199: 0x00c3, 0x219a: 0x00c3, 0x219b: 0x0080, 0x219c: 0x0080, 0x219d: 0x00cc, + 0x219e: 0x00cc, 0x219f: 0x008c, 0x21a0: 0x0080, 0x21a1: 0x00cc, 0x21a2: 0x00cc, 0x21a3: 0x00cc, + 0x21a4: 0x00cc, 0x21a5: 0x00cc, 0x21a6: 0x00cc, 0x21a7: 0x00cc, 0x21a8: 0x00cc, 0x21a9: 0x00cc, + 0x21aa: 0x00cc, 0x21ab: 0x00cc, 0x21ac: 0x00cc, 0x21ad: 0x00cc, 0x21ae: 0x00cc, 0x21af: 0x00cc, + 0x21b0: 0x00cc, 0x21b1: 0x00cc, 0x21b2: 0x00cc, 0x21b3: 0x00cc, 0x21b4: 0x00cc, 0x21b5: 0x00cc, + 0x21b6: 0x00cc, 0x21b7: 0x00cc, 0x21b8: 0x00cc, 0x21b9: 0x00cc, 0x21ba: 0x00cc, 0x21bb: 0x00cc, + 0x21bc: 0x00cc, 0x21bd: 0x00cc, 0x21be: 0x00cc, 0x21bf: 0x00cc, + // Block 0x87, offset 0x21c0 + 0x21c0: 0x00cc, 0x21c1: 0x00cc, 0x21c2: 0x00cc, 0x21c3: 0x00cc, 0x21c4: 0x00cc, 0x21c5: 0x00cc, + 0x21c6: 0x00cc, 0x21c7: 0x00cc, 0x21c8: 0x00cc, 0x21c9: 0x00cc, 0x21ca: 0x00cc, 0x21cb: 0x00cc, + 0x21cc: 0x00cc, 0x21cd: 0x00cc, 0x21ce: 0x00cc, 0x21cf: 0x00cc, 0x21d0: 0x00cc, 0x21d1: 0x00cc, + 0x21d2: 0x00cc, 0x21d3: 0x00cc, 0x21d4: 0x00cc, 0x21d5: 0x00cc, 0x21d6: 0x00cc, 0x21d7: 0x00cc, + 0x21d8: 0x00cc, 0x21d9: 0x00cc, 0x21da: 0x00cc, 0x21db: 0x00cc, 0x21dc: 0x00cc, 0x21dd: 0x00cc, + 0x21de: 0x00cc, 0x21df: 0x00cc, 0x21e0: 0x00cc, 0x21e1: 0x00cc, 0x21e2: 0x00cc, 0x21e3: 0x00cc, + 0x21e4: 0x00cc, 0x21e5: 0x00cc, 0x21e6: 0x00cc, 0x21e7: 0x00cc, 0x21e8: 0x00cc, 0x21e9: 0x00cc, + 0x21ea: 0x00cc, 0x21eb: 0x00cc, 0x21ec: 0x00cc, 0x21ed: 0x00cc, 0x21ee: 0x00cc, 0x21ef: 0x00cc, + 0x21f0: 0x00cc, 0x21f1: 0x00cc, 0x21f2: 0x00cc, 0x21f3: 0x00cc, 0x21f4: 0x00cc, 0x21f5: 0x00cc, + 0x21f6: 0x00cc, 0x21f7: 0x00cc, 0x21f8: 0x00cc, 0x21f9: 0x00cc, 0x21fa: 0x00cc, 0x21fb: 0x00d2, + 0x21fc: 0x00c0, 0x21fd: 0x00cc, 0x21fe: 0x00cc, 0x21ff: 0x008c, + // Block 0x88, offset 0x2200 + 0x2205: 0x00c0, + 0x2206: 0x00c0, 0x2207: 0x00c0, 0x2208: 0x00c0, 0x2209: 0x00c0, 0x220a: 0x00c0, 0x220b: 0x00c0, + 0x220c: 0x00c0, 0x220d: 0x00c0, 0x220e: 0x00c0, 0x220f: 0x00c0, 0x2210: 0x00c0, 0x2211: 0x00c0, + 0x2212: 0x00c0, 0x2213: 0x00c0, 0x2214: 0x00c0, 0x2215: 0x00c0, 0x2216: 0x00c0, 0x2217: 0x00c0, + 0x2218: 0x00c0, 0x2219: 0x00c0, 0x221a: 0x00c0, 0x221b: 0x00c0, 0x221c: 0x00c0, 0x221d: 0x00c0, + 0x221e: 0x00c0, 0x221f: 0x00c0, 0x2220: 0x00c0, 0x2221: 0x00c0, 0x2222: 0x00c0, 0x2223: 0x00c0, + 0x2224: 0x00c0, 0x2225: 0x00c0, 0x2226: 0x00c0, 0x2227: 0x00c0, 0x2228: 0x00c0, 0x2229: 0x00c0, + 0x222a: 0x00c0, 0x222b: 0x00c0, 0x222c: 0x00c0, 0x222d: 0x00c0, 0x222e: 0x00c0, 0x222f: 0x00c0, + 0x2231: 0x0080, 0x2232: 0x0080, 0x2233: 0x0080, 0x2234: 0x0080, 0x2235: 0x0080, + 0x2236: 0x0080, 0x2237: 0x0080, 0x2238: 0x0080, 0x2239: 0x0080, 0x223a: 0x0080, 0x223b: 0x0080, + 0x223c: 0x0080, 0x223d: 0x0080, 0x223e: 0x0080, 0x223f: 0x0080, + // Block 0x89, offset 0x2240 + 0x2240: 0x0080, 0x2241: 0x0080, 0x2242: 0x0080, 0x2243: 0x0080, 0x2244: 0x0080, 0x2245: 0x0080, + 0x2246: 0x0080, 0x2247: 0x0080, 0x2248: 0x0080, 0x2249: 0x0080, 0x224a: 0x0080, 0x224b: 0x0080, + 0x224c: 0x0080, 0x224d: 0x0080, 0x224e: 0x0080, 0x224f: 0x0080, 0x2250: 0x0080, 0x2251: 0x0080, + 0x2252: 0x0080, 0x2253: 0x0080, 0x2254: 0x0080, 0x2255: 0x0080, 0x2256: 0x0080, 0x2257: 0x0080, + 0x2258: 0x0080, 0x2259: 0x0080, 0x225a: 0x0080, 0x225b: 0x0080, 0x225c: 0x0080, 0x225d: 0x0080, + 0x225e: 0x0080, 0x225f: 0x0080, 0x2260: 0x0080, 0x2261: 0x0080, 0x2262: 0x0080, 0x2263: 0x0080, + 0x2264: 0x0040, 0x2265: 0x0080, 0x2266: 0x0080, 0x2267: 0x0080, 0x2268: 0x0080, 0x2269: 0x0080, + 0x226a: 0x0080, 0x226b: 0x0080, 0x226c: 0x0080, 0x226d: 0x0080, 0x226e: 0x0080, 0x226f: 0x0080, + 0x2270: 0x0080, 0x2271: 0x0080, 0x2272: 0x0080, 0x2273: 0x0080, 0x2274: 0x0080, 0x2275: 0x0080, + 0x2276: 0x0080, 0x2277: 0x0080, 0x2278: 0x0080, 0x2279: 0x0080, 0x227a: 0x0080, 0x227b: 0x0080, + 0x227c: 0x0080, 0x227d: 0x0080, 0x227e: 0x0080, 0x227f: 0x0080, + // Block 0x8a, offset 0x2280 + 0x2280: 0x0080, 0x2281: 0x0080, 0x2282: 0x0080, 0x2283: 0x0080, 0x2284: 0x0080, 0x2285: 0x0080, + 0x2286: 0x0080, 0x2287: 0x0080, 0x2288: 0x0080, 0x2289: 0x0080, 0x228a: 0x0080, 0x228b: 0x0080, + 0x228c: 0x0080, 0x228d: 0x0080, 0x228e: 0x0080, 0x2290: 0x0080, 0x2291: 0x0080, + 0x2292: 0x0080, 0x2293: 0x0080, 0x2294: 0x0080, 0x2295: 0x0080, 0x2296: 0x0080, 0x2297: 0x0080, + 0x2298: 0x0080, 0x2299: 0x0080, 0x229a: 0x0080, 0x229b: 0x0080, 0x229c: 0x0080, 0x229d: 0x0080, + 0x229e: 0x0080, 0x229f: 0x0080, 0x22a0: 0x00c0, 0x22a1: 0x00c0, 0x22a2: 0x00c0, 0x22a3: 0x00c0, + 0x22a4: 0x00c0, 0x22a5: 0x00c0, 0x22a6: 0x00c0, 0x22a7: 0x00c0, 0x22a8: 0x00c0, 0x22a9: 0x00c0, + 0x22aa: 0x00c0, 0x22ab: 0x00c0, 0x22ac: 0x00c0, 0x22ad: 0x00c0, 0x22ae: 0x00c0, 0x22af: 0x00c0, + 0x22b0: 0x00c0, 0x22b1: 0x00c0, 0x22b2: 0x00c0, 0x22b3: 0x00c0, 0x22b4: 0x00c0, 0x22b5: 0x00c0, + 0x22b6: 0x00c0, 0x22b7: 0x00c0, 0x22b8: 0x00c0, 0x22b9: 0x00c0, 0x22ba: 0x00c0, 0x22bb: 0x00c0, + 0x22bc: 0x00c0, 0x22bd: 0x00c0, 0x22be: 0x00c0, 0x22bf: 0x00c0, + // Block 0x8b, offset 0x22c0 + 0x22c0: 0x0080, 0x22c1: 0x0080, 0x22c2: 0x0080, 0x22c3: 0x0080, 0x22c4: 0x0080, 0x22c5: 0x0080, + 0x22c6: 0x0080, 0x22c7: 0x0080, 0x22c8: 0x0080, 0x22c9: 0x0080, 0x22ca: 0x0080, 0x22cb: 0x0080, + 0x22cc: 0x0080, 0x22cd: 0x0080, 0x22ce: 0x0080, 0x22cf: 0x0080, 0x22d0: 0x0080, 0x22d1: 0x0080, + 0x22d2: 0x0080, 0x22d3: 0x0080, 0x22d4: 0x0080, 0x22d5: 0x0080, 0x22d6: 0x0080, 0x22d7: 0x0080, + 0x22d8: 0x0080, 0x22d9: 0x0080, 0x22da: 0x0080, 0x22db: 0x0080, 0x22dc: 0x0080, 0x22dd: 0x0080, + 0x22de: 0x0080, 0x22df: 0x0080, 0x22e0: 0x0080, 0x22e1: 0x0080, 0x22e2: 0x0080, 0x22e3: 0x0080, + 0x22f0: 0x00cc, 0x22f1: 0x00cc, 0x22f2: 0x00cc, 0x22f3: 0x00cc, 0x22f4: 0x00cc, 0x22f5: 0x00cc, + 0x22f6: 0x00cc, 0x22f7: 0x00cc, 0x22f8: 0x00cc, 0x22f9: 0x00cc, 0x22fa: 0x00cc, 0x22fb: 0x00cc, + 0x22fc: 0x00cc, 0x22fd: 0x00cc, 0x22fe: 0x00cc, 0x22ff: 0x00cc, + // Block 0x8c, offset 0x2300 + 0x2300: 0x0080, 0x2301: 0x0080, 0x2302: 0x0080, 0x2303: 0x0080, 0x2304: 0x0080, 0x2305: 0x0080, + 0x2306: 0x0080, 0x2307: 0x0080, 0x2308: 0x0080, 0x2309: 0x0080, 0x230a: 0x0080, 0x230b: 0x0080, + 0x230c: 0x0080, 0x230d: 0x0080, 0x230e: 0x0080, 0x230f: 0x0080, 0x2310: 0x0080, 0x2311: 0x0080, + 0x2312: 0x0080, 0x2313: 0x0080, 0x2314: 0x0080, 0x2315: 0x0080, 0x2316: 0x0080, 0x2317: 0x0080, + 0x2318: 0x0080, 0x2319: 0x0080, 0x231a: 0x0080, 0x231b: 0x0080, 0x231c: 0x0080, 0x231d: 0x0080, + 0x231e: 0x0080, 0x2320: 0x0080, 0x2321: 0x0080, 0x2322: 0x0080, 0x2323: 0x0080, + 0x2324: 0x0080, 0x2325: 0x0080, 0x2326: 0x0080, 0x2327: 0x0080, 0x2328: 0x0080, 0x2329: 0x0080, + 0x232a: 0x0080, 0x232b: 0x0080, 0x232c: 0x0080, 0x232d: 0x0080, 0x232e: 0x0080, 0x232f: 0x0080, + 0x2330: 0x0080, 0x2331: 0x0080, 0x2332: 0x0080, 0x2333: 0x0080, 0x2334: 0x0080, 0x2335: 0x0080, + 0x2336: 0x0080, 0x2337: 0x0080, 0x2338: 0x0080, 0x2339: 0x0080, 0x233a: 0x0080, 0x233b: 0x0080, + 0x233c: 0x0080, 0x233d: 0x0080, 0x233e: 0x0080, 0x233f: 0x0080, + // Block 0x8d, offset 0x2340 + 0x2340: 0x0080, 0x2341: 0x0080, 0x2342: 0x0080, 0x2343: 0x0080, 0x2344: 0x0080, 0x2345: 0x0080, + 0x2346: 0x0080, 0x2347: 0x0080, 0x2348: 0x0080, 0x2349: 0x0080, 0x234a: 0x0080, 0x234b: 0x0080, + 0x234c: 0x0080, 0x234d: 0x0080, 0x234e: 0x0080, 0x234f: 0x0080, 0x2350: 0x008c, 0x2351: 0x008c, + 0x2352: 0x008c, 0x2353: 0x008c, 0x2354: 0x008c, 0x2355: 0x008c, 0x2356: 0x008c, 0x2357: 0x008c, + 0x2358: 0x008c, 0x2359: 0x008c, 0x235a: 0x008c, 0x235b: 0x008c, 0x235c: 0x008c, 0x235d: 0x008c, + 0x235e: 0x008c, 0x235f: 0x008c, 0x2360: 0x008c, 0x2361: 0x008c, 0x2362: 0x008c, 0x2363: 0x008c, + 0x2364: 0x008c, 0x2365: 0x008c, 0x2366: 0x008c, 0x2367: 0x008c, 0x2368: 0x008c, 0x2369: 0x008c, + 0x236a: 0x008c, 0x236b: 0x008c, 0x236c: 0x008c, 0x236d: 0x008c, 0x236e: 0x008c, 0x236f: 0x008c, + 0x2370: 0x008c, 0x2371: 0x008c, 0x2372: 0x008c, 0x2373: 0x008c, 0x2374: 0x008c, 0x2375: 0x008c, + 0x2376: 0x008c, 0x2377: 0x008c, 0x2378: 0x008c, 0x2379: 0x008c, 0x237a: 0x008c, 0x237b: 0x008c, + 0x237c: 0x008c, 0x237d: 0x008c, 0x237e: 0x008c, 0x237f: 0x0080, + // Block 0x8e, offset 0x2380 + 0x2380: 0x008c, 0x2381: 0x008c, 0x2382: 0x008c, 0x2383: 0x008c, 0x2384: 0x008c, 0x2385: 0x008c, + 0x2386: 0x008c, 0x2387: 0x008c, 0x2388: 0x008c, 0x2389: 0x008c, 0x238a: 0x008c, 0x238b: 0x008c, + 0x238c: 0x008c, 0x238d: 0x008c, 0x238e: 0x008c, 0x238f: 0x008c, 0x2390: 0x008c, 0x2391: 0x008c, + 0x2392: 0x008c, 0x2393: 0x008c, 0x2394: 0x008c, 0x2395: 0x008c, 0x2396: 0x008c, 0x2397: 0x008c, + 0x2398: 0x0080, 0x2399: 0x0080, 0x239a: 0x0080, 0x239b: 0x0080, 0x239c: 0x0080, 0x239d: 0x0080, + 0x239e: 0x0080, 0x239f: 0x0080, 0x23a0: 0x0080, 0x23a1: 0x0080, 0x23a2: 0x0080, 0x23a3: 0x0080, + 0x23a4: 0x0080, 0x23a5: 0x0080, 0x23a6: 0x0080, 0x23a7: 0x0080, 0x23a8: 0x0080, 0x23a9: 0x0080, + 0x23aa: 0x0080, 0x23ab: 0x0080, 0x23ac: 0x0080, 0x23ad: 0x0080, 0x23ae: 0x0080, 0x23af: 0x0080, + 0x23b0: 0x0080, 0x23b1: 0x0080, 0x23b2: 0x0080, 0x23b3: 0x0080, 0x23b4: 0x0080, 0x23b5: 0x0080, + 0x23b6: 0x0080, 0x23b7: 0x0080, 0x23b8: 0x0080, 0x23b9: 0x0080, 0x23ba: 0x0080, 0x23bb: 0x0080, + 0x23bc: 0x0080, 0x23bd: 0x0080, 0x23be: 0x0080, 0x23bf: 0x0080, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x00cc, 0x23c1: 0x00cc, 0x23c2: 0x00cc, 0x23c3: 0x00cc, 0x23c4: 0x00cc, 0x23c5: 0x00cc, + 0x23c6: 0x00cc, 0x23c7: 0x00cc, 0x23c8: 0x00cc, 0x23c9: 0x00cc, 0x23ca: 0x00cc, 0x23cb: 0x00cc, + 0x23cc: 0x00cc, 0x23cd: 0x00cc, 0x23ce: 0x00cc, 0x23cf: 0x00cc, 0x23d0: 0x00cc, 0x23d1: 0x00cc, + 0x23d2: 0x00cc, 0x23d3: 0x00cc, 0x23d4: 0x00cc, 0x23d5: 0x00cc, 0x23d6: 0x00cc, 0x23d7: 0x00cc, + 0x23d8: 0x00cc, 0x23d9: 0x00cc, 0x23da: 0x00cc, 0x23db: 0x00cc, 0x23dc: 0x00cc, 0x23dd: 0x00cc, + 0x23de: 0x00cc, 0x23df: 0x00cc, 0x23e0: 0x00cc, 0x23e1: 0x00cc, 0x23e2: 0x00cc, 0x23e3: 0x00cc, + 0x23e4: 0x00cc, 0x23e5: 0x00cc, 0x23e6: 0x00cc, 0x23e7: 0x00cc, 0x23e8: 0x00cc, 0x23e9: 0x00cc, + 0x23ea: 0x00cc, 0x23eb: 0x00cc, 0x23ec: 0x00cc, 0x23ed: 0x00cc, 0x23ee: 0x00cc, 0x23ef: 0x00cc, + 0x23f0: 0x00cc, 0x23f1: 0x00cc, 0x23f2: 0x00cc, 0x23f3: 0x00cc, 0x23f4: 0x00cc, 0x23f5: 0x00cc, + 0x23f6: 0x00cc, 0x23f7: 0x00cc, 0x23f8: 0x00cc, 0x23f9: 0x00cc, 0x23fa: 0x00cc, 0x23fb: 0x00cc, + 0x23fc: 0x00cc, 0x23fd: 0x00cc, 0x23fe: 0x00cc, 0x23ff: 0x00cc, + // Block 0x90, offset 0x2400 + 0x2400: 0x00c0, 0x2401: 0x00c0, 0x2402: 0x00c0, 0x2403: 0x00c0, 0x2404: 0x00c0, 0x2405: 0x00c0, + 0x2406: 0x00c0, 0x2407: 0x00c0, 0x2408: 0x00c0, 0x2409: 0x00c0, 0x240a: 0x00c0, 0x240b: 0x00c0, + 0x240c: 0x00c0, 0x2410: 0x0080, 0x2411: 0x0080, + 0x2412: 0x0080, 0x2413: 0x0080, 0x2414: 0x0080, 0x2415: 0x0080, 0x2416: 0x0080, 0x2417: 0x0080, + 0x2418: 0x0080, 0x2419: 0x0080, 0x241a: 0x0080, 0x241b: 0x0080, 0x241c: 0x0080, 0x241d: 0x0080, + 0x241e: 0x0080, 0x241f: 0x0080, 0x2420: 0x0080, 0x2421: 0x0080, 0x2422: 0x0080, 0x2423: 0x0080, + 0x2424: 0x0080, 0x2425: 0x0080, 0x2426: 0x0080, 0x2427: 0x0080, 0x2428: 0x0080, 0x2429: 0x0080, + 0x242a: 0x0080, 0x242b: 0x0080, 0x242c: 0x0080, 0x242d: 0x0080, 0x242e: 0x0080, 0x242f: 0x0080, + 0x2430: 0x0080, 0x2431: 0x0080, 0x2432: 0x0080, 0x2433: 0x0080, 0x2434: 0x0080, 0x2435: 0x0080, + 0x2436: 0x0080, 0x2437: 0x0080, 0x2438: 0x0080, 0x2439: 0x0080, 0x243a: 0x0080, 0x243b: 0x0080, + 0x243c: 0x0080, 0x243d: 0x0080, 0x243e: 0x0080, 0x243f: 0x0080, + // Block 0x91, offset 0x2440 + 0x2440: 0x0080, 0x2441: 0x0080, 0x2442: 0x0080, 0x2443: 0x0080, 0x2444: 0x0080, 0x2445: 0x0080, + 0x2446: 0x0080, + 0x2450: 0x00c0, 0x2451: 0x00c0, + 0x2452: 0x00c0, 0x2453: 0x00c0, 0x2454: 0x00c0, 0x2455: 0x00c0, 0x2456: 0x00c0, 0x2457: 0x00c0, + 0x2458: 0x00c0, 0x2459: 0x00c0, 0x245a: 0x00c0, 0x245b: 0x00c0, 0x245c: 0x00c0, 0x245d: 0x00c0, + 0x245e: 0x00c0, 0x245f: 0x00c0, 0x2460: 0x00c0, 0x2461: 0x00c0, 0x2462: 0x00c0, 0x2463: 0x00c0, + 0x2464: 0x00c0, 0x2465: 0x00c0, 0x2466: 0x00c0, 0x2467: 0x00c0, 0x2468: 0x00c0, 0x2469: 0x00c0, + 0x246a: 0x00c0, 0x246b: 0x00c0, 0x246c: 0x00c0, 0x246d: 0x00c0, 0x246e: 0x00c0, 0x246f: 0x00c0, + 0x2470: 0x00c0, 0x2471: 0x00c0, 0x2472: 0x00c0, 0x2473: 0x00c0, 0x2474: 0x00c0, 0x2475: 0x00c0, + 0x2476: 0x00c0, 0x2477: 0x00c0, 0x2478: 0x00c0, 0x2479: 0x00c0, 0x247a: 0x00c0, 0x247b: 0x00c0, + 0x247c: 0x00c0, 0x247d: 0x00c0, 0x247e: 0x0080, 0x247f: 0x0080, + // Block 0x92, offset 0x2480 + 0x2480: 0x00c0, 0x2481: 0x00c0, 0x2482: 0x00c0, 0x2483: 0x00c0, 0x2484: 0x00c0, 0x2485: 0x00c0, + 0x2486: 0x00c0, 0x2487: 0x00c0, 0x2488: 0x00c0, 0x2489: 0x00c0, 0x248a: 0x00c0, 0x248b: 0x00c0, + 0x248c: 0x00c0, 0x248d: 0x0080, 0x248e: 0x0080, 0x248f: 0x0080, 0x2490: 0x00c0, 0x2491: 0x00c0, + 0x2492: 0x00c0, 0x2493: 0x00c0, 0x2494: 0x00c0, 0x2495: 0x00c0, 0x2496: 0x00c0, 0x2497: 0x00c0, + 0x2498: 0x00c0, 0x2499: 0x00c0, 0x249a: 0x00c0, 0x249b: 0x00c0, 0x249c: 0x00c0, 0x249d: 0x00c0, + 0x249e: 0x00c0, 0x249f: 0x00c0, 0x24a0: 0x00c0, 0x24a1: 0x00c0, 0x24a2: 0x00c0, 0x24a3: 0x00c0, + 0x24a4: 0x00c0, 0x24a5: 0x00c0, 0x24a6: 0x00c0, 0x24a7: 0x00c0, 0x24a8: 0x00c0, 0x24a9: 0x00c0, + 0x24aa: 0x00c0, 0x24ab: 0x00c0, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x00c0, 0x24c1: 0x00c0, 0x24c2: 0x00c0, 0x24c3: 0x00c0, 0x24c4: 0x00c0, 0x24c5: 0x00c0, + 0x24c6: 0x00c0, 0x24c7: 0x00c0, 0x24c8: 0x00c0, 0x24c9: 0x00c0, 0x24ca: 0x00c0, 0x24cb: 0x00c0, + 0x24cc: 0x00c0, 0x24cd: 0x00c0, 0x24ce: 0x00c0, 0x24cf: 0x00c0, 0x24d0: 0x00c0, 0x24d1: 0x00c0, + 0x24d2: 0x00c0, 0x24d3: 0x00c0, 0x24d4: 0x00c0, 0x24d5: 0x00c0, 0x24d6: 0x00c0, 0x24d7: 0x00c0, + 0x24d8: 0x00c0, 0x24d9: 0x00c0, 0x24da: 0x00c0, 0x24db: 0x00c0, 0x24dc: 0x00c0, 0x24dd: 0x00c0, + 0x24de: 0x00c0, 0x24df: 0x00c0, 0x24e0: 0x00c0, 0x24e1: 0x00c0, 0x24e2: 0x00c0, 0x24e3: 0x00c0, + 0x24e4: 0x00c0, 0x24e5: 0x00c0, 0x24e6: 0x00c0, 0x24e7: 0x00c0, 0x24e8: 0x00c0, 0x24e9: 0x00c0, + 0x24ea: 0x00c0, 0x24eb: 0x00c0, 0x24ec: 0x00c0, 0x24ed: 0x00c0, 0x24ee: 0x00c0, 0x24ef: 0x00c3, + 0x24f0: 0x0083, 0x24f1: 0x0083, 0x24f2: 0x0083, 0x24f3: 0x0080, 0x24f4: 0x00c3, 0x24f5: 0x00c3, + 0x24f6: 0x00c3, 0x24f7: 0x00c3, 0x24f8: 0x00c3, 0x24f9: 0x00c3, 0x24fa: 0x00c3, 0x24fb: 0x00c3, + 0x24fc: 0x00c3, 0x24fd: 0x00c3, 0x24fe: 0x0080, 0x24ff: 0x00c0, + // Block 0x94, offset 0x2500 + 0x2500: 0x00c0, 0x2501: 0x00c0, 0x2502: 0x00c0, 0x2503: 0x00c0, 0x2504: 0x00c0, 0x2505: 0x00c0, + 0x2506: 0x00c0, 0x2507: 0x00c0, 0x2508: 0x00c0, 0x2509: 0x00c0, 0x250a: 0x00c0, 0x250b: 0x00c0, + 0x250c: 0x00c0, 0x250d: 0x00c0, 0x250e: 0x00c0, 0x250f: 0x00c0, 0x2510: 0x00c0, 0x2511: 0x00c0, + 0x2512: 0x00c0, 0x2513: 0x00c0, 0x2514: 0x00c0, 0x2515: 0x00c0, 0x2516: 0x00c0, 0x2517: 0x00c0, + 0x2518: 0x00c0, 0x2519: 0x00c0, 0x251a: 0x00c0, 0x251b: 0x00c0, 0x251c: 0x0080, 0x251d: 0x0080, + 0x251e: 0x00c3, 0x251f: 0x00c3, 0x2520: 0x00c0, 0x2521: 0x00c0, 0x2522: 0x00c0, 0x2523: 0x00c0, + 0x2524: 0x00c0, 0x2525: 0x00c0, 0x2526: 0x00c0, 0x2527: 0x00c0, 0x2528: 0x00c0, 0x2529: 0x00c0, + 0x252a: 0x00c0, 0x252b: 0x00c0, 0x252c: 0x00c0, 0x252d: 0x00c0, 0x252e: 0x00c0, 0x252f: 0x00c0, + 0x2530: 0x00c0, 0x2531: 0x00c0, 0x2532: 0x00c0, 0x2533: 0x00c0, 0x2534: 0x00c0, 0x2535: 0x00c0, + 0x2536: 0x00c0, 0x2537: 0x00c0, 0x2538: 0x00c0, 0x2539: 0x00c0, 0x253a: 0x00c0, 0x253b: 0x00c0, + 0x253c: 0x00c0, 0x253d: 0x00c0, 0x253e: 0x00c0, 0x253f: 0x00c0, + // Block 0x95, offset 0x2540 + 0x2540: 0x00c0, 0x2541: 0x00c0, 0x2542: 0x00c0, 0x2543: 0x00c0, 0x2544: 0x00c0, 0x2545: 0x00c0, + 0x2546: 0x00c0, 0x2547: 0x00c0, 0x2548: 0x00c0, 0x2549: 0x00c0, 0x254a: 0x00c0, 0x254b: 0x00c0, + 0x254c: 0x00c0, 0x254d: 0x00c0, 0x254e: 0x00c0, 0x254f: 0x00c0, 0x2550: 0x00c0, 0x2551: 0x00c0, + 0x2552: 0x00c0, 0x2553: 0x00c0, 0x2554: 0x00c0, 0x2555: 0x00c0, 0x2556: 0x00c0, 0x2557: 0x00c0, + 0x2558: 0x00c0, 0x2559: 0x00c0, 0x255a: 0x00c0, 0x255b: 0x00c0, 0x255c: 0x00c0, 0x255d: 0x00c0, + 0x255e: 0x00c0, 0x255f: 0x00c0, 0x2560: 0x00c0, 0x2561: 0x00c0, 0x2562: 0x00c0, 0x2563: 0x00c0, + 0x2564: 0x00c0, 0x2565: 0x00c0, 0x2566: 0x0080, 0x2567: 0x0080, 0x2568: 0x0080, 0x2569: 0x0080, + 0x256a: 0x0080, 0x256b: 0x0080, 0x256c: 0x0080, 0x256d: 0x0080, 0x256e: 0x0080, 0x256f: 0x0080, + 0x2570: 0x00c3, 0x2571: 0x00c3, 0x2572: 0x0080, 0x2573: 0x0080, 0x2574: 0x0080, 0x2575: 0x0080, + 0x2576: 0x0080, 0x2577: 0x0080, + // Block 0x96, offset 0x2580 + 0x2580: 0x0080, 0x2581: 0x0080, 0x2582: 0x0080, 0x2583: 0x0080, 0x2584: 0x0080, 0x2585: 0x0080, + 0x2586: 0x0080, 0x2587: 0x0080, 0x2588: 0x0080, 0x2589: 0x0080, 0x258a: 0x0080, 0x258b: 0x0080, + 0x258c: 0x0080, 0x258d: 0x0080, 0x258e: 0x0080, 0x258f: 0x0080, 0x2590: 0x0080, 0x2591: 0x0080, + 0x2592: 0x0080, 0x2593: 0x0080, 0x2594: 0x0080, 0x2595: 0x0080, 0x2596: 0x0080, 0x2597: 0x00c0, + 0x2598: 0x00c0, 0x2599: 0x00c0, 0x259a: 0x00c0, 0x259b: 0x00c0, 0x259c: 0x00c0, 0x259d: 0x00c0, + 0x259e: 0x00c0, 0x259f: 0x00c0, 0x25a0: 0x0080, 0x25a1: 0x0080, 0x25a2: 0x00c0, 0x25a3: 0x00c0, + 0x25a4: 0x00c0, 0x25a5: 0x00c0, 0x25a6: 0x00c0, 0x25a7: 0x00c0, 0x25a8: 0x00c0, 0x25a9: 0x00c0, + 0x25aa: 0x00c0, 0x25ab: 0x00c0, 0x25ac: 0x00c0, 0x25ad: 0x00c0, 0x25ae: 0x00c0, 0x25af: 0x00c0, + 0x25b0: 0x00c0, 0x25b1: 0x00c0, 0x25b2: 0x00c0, 0x25b3: 0x00c0, 0x25b4: 0x00c0, 0x25b5: 0x00c0, + 0x25b6: 0x00c0, 0x25b7: 0x00c0, 0x25b8: 0x00c0, 0x25b9: 0x00c0, 0x25ba: 0x00c0, 0x25bb: 0x00c0, + 0x25bc: 0x00c0, 0x25bd: 0x00c0, 0x25be: 0x00c0, 0x25bf: 0x00c0, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x00c0, 0x25c1: 0x00c0, 0x25c2: 0x00c0, 0x25c3: 0x00c0, 0x25c4: 0x00c0, 0x25c5: 0x00c0, + 0x25c6: 0x00c0, 0x25c7: 0x00c0, 0x25c8: 0x00c0, 0x25c9: 0x00c0, 0x25ca: 0x00c0, 0x25cb: 0x00c0, + 0x25cc: 0x00c0, 0x25cd: 0x00c0, 0x25ce: 0x00c0, 0x25cf: 0x00c0, 0x25d0: 0x00c0, 0x25d1: 0x00c0, + 0x25d2: 0x00c0, 0x25d3: 0x00c0, 0x25d4: 0x00c0, 0x25d5: 0x00c0, 0x25d6: 0x00c0, 0x25d7: 0x00c0, + 0x25d8: 0x00c0, 0x25d9: 0x00c0, 0x25da: 0x00c0, 0x25db: 0x00c0, 0x25dc: 0x00c0, 0x25dd: 0x00c0, + 0x25de: 0x00c0, 0x25df: 0x00c0, 0x25e0: 0x00c0, 0x25e1: 0x00c0, 0x25e2: 0x00c0, 0x25e3: 0x00c0, + 0x25e4: 0x00c0, 0x25e5: 0x00c0, 0x25e6: 0x00c0, 0x25e7: 0x00c0, 0x25e8: 0x00c0, 0x25e9: 0x00c0, + 0x25ea: 0x00c0, 0x25eb: 0x00c0, 0x25ec: 0x00c0, 0x25ed: 0x00c0, 0x25ee: 0x00c0, 0x25ef: 0x00c0, + 0x25f0: 0x0080, 0x25f1: 0x00c0, 0x25f2: 0x00c0, 0x25f3: 0x00c0, 0x25f4: 0x00c0, 0x25f5: 0x00c0, + 0x25f6: 0x00c0, 0x25f7: 0x00c0, 0x25f8: 0x00c0, 0x25f9: 0x00c0, 0x25fa: 0x00c0, 0x25fb: 0x00c0, + 0x25fc: 0x00c0, 0x25fd: 0x00c0, 0x25fe: 0x00c0, 0x25ff: 0x00c0, + // Block 0x98, offset 0x2600 + 0x2600: 0x00c0, 0x2601: 0x00c0, 0x2602: 0x00c0, 0x2603: 0x00c0, 0x2604: 0x00c0, 0x2605: 0x00c0, + 0x2606: 0x00c0, 0x2607: 0x00c0, 0x2608: 0x00c0, 0x2609: 0x0080, 0x260a: 0x0080, 0x260b: 0x00c0, + 0x260c: 0x00c0, 0x260d: 0x00c0, 0x260e: 0x00c0, 0x260f: 0x00c0, 0x2610: 0x00c0, 0x2611: 0x00c0, + 0x2612: 0x00c0, 0x2613: 0x00c0, 0x2614: 0x00c0, 0x2615: 0x00c0, 0x2616: 0x00c0, 0x2617: 0x00c0, + 0x2618: 0x00c0, 0x2619: 0x00c0, 0x261a: 0x00c0, 0x261b: 0x00c0, 0x261c: 0x00c0, 0x261d: 0x00c0, + 0x261e: 0x00c0, 0x261f: 0x00c0, 0x2620: 0x00c0, 0x2621: 0x00c0, 0x2622: 0x00c0, 0x2623: 0x00c0, + 0x2624: 0x00c0, 0x2625: 0x00c0, 0x2626: 0x00c0, 0x2627: 0x00c0, 0x2628: 0x00c0, 0x2629: 0x00c0, + 0x262a: 0x00c0, 0x262b: 0x00c0, 0x262c: 0x00c0, 0x262d: 0x00c0, 0x262e: 0x00c0, 0x262f: 0x00c0, + 0x2630: 0x00c0, 0x2631: 0x00c0, 0x2632: 0x00c0, 0x2633: 0x00c0, 0x2634: 0x00c0, 0x2635: 0x00c0, + 0x2636: 0x00c0, 0x2637: 0x00c0, 0x2638: 0x00c0, 0x2639: 0x00c0, 0x263a: 0x00c0, 0x263b: 0x00c0, + 0x263c: 0x00c0, 0x263d: 0x00c0, 0x263e: 0x00c0, 0x263f: 0x00c0, + // Block 0x99, offset 0x2640 + 0x2640: 0x00c0, 0x2641: 0x00c0, 0x2642: 0x00c0, 0x2643: 0x00c0, 0x2644: 0x00c0, 0x2645: 0x00c0, + 0x2646: 0x00c0, 0x2647: 0x00c0, 0x2648: 0x00c0, 0x2649: 0x00c0, 0x264a: 0x00c0, + 0x2650: 0x00c0, 0x2651: 0x00c0, + 0x2653: 0x00c0, 0x2655: 0x00c0, 0x2656: 0x00c0, 0x2657: 0x00c0, + 0x2658: 0x00c0, 0x2659: 0x00c0, + 0x2672: 0x0080, 0x2673: 0x0080, 0x2674: 0x0080, 0x2675: 0x00c0, + 0x2676: 0x00c0, 0x2677: 0x00c0, 0x2678: 0x0080, 0x2679: 0x0080, 0x267a: 0x00c0, 0x267b: 0x00c0, + 0x267c: 0x00c0, 0x267d: 0x00c0, 0x267e: 0x00c0, 0x267f: 0x00c0, + // Block 0x9a, offset 0x2680 + 0x2680: 0x00c0, 0x2681: 0x00c0, 0x2682: 0x00c3, 0x2683: 0x00c0, 0x2684: 0x00c0, 0x2685: 0x00c0, + 0x2686: 0x00c6, 0x2687: 0x00c0, 0x2688: 0x00c0, 0x2689: 0x00c0, 0x268a: 0x00c0, 0x268b: 0x00c3, + 0x268c: 0x00c0, 0x268d: 0x00c0, 0x268e: 0x00c0, 0x268f: 0x00c0, 0x2690: 0x00c0, 0x2691: 0x00c0, + 0x2692: 0x00c0, 0x2693: 0x00c0, 0x2694: 0x00c0, 0x2695: 0x00c0, 0x2696: 0x00c0, 0x2697: 0x00c0, + 0x2698: 0x00c0, 0x2699: 0x00c0, 0x269a: 0x00c0, 0x269b: 0x00c0, 0x269c: 0x00c0, 0x269d: 0x00c0, + 0x269e: 0x00c0, 0x269f: 0x00c0, 0x26a0: 0x00c0, 0x26a1: 0x00c0, 0x26a2: 0x00c0, 0x26a3: 0x00c0, + 0x26a4: 0x00c0, 0x26a5: 0x00c3, 0x26a6: 0x00c3, 0x26a7: 0x00c0, 0x26a8: 0x0080, 0x26a9: 0x0080, + 0x26aa: 0x0080, 0x26ab: 0x0080, 0x26ac: 0x00c6, + 0x26b0: 0x0080, 0x26b1: 0x0080, 0x26b2: 0x0080, 0x26b3: 0x0080, 0x26b4: 0x0080, 0x26b5: 0x0080, + 0x26b6: 0x0080, 0x26b7: 0x0080, 0x26b8: 0x0080, 0x26b9: 0x0080, + // Block 0x9b, offset 0x26c0 + 0x26c0: 0x00c2, 0x26c1: 0x00c2, 0x26c2: 0x00c2, 0x26c3: 0x00c2, 0x26c4: 0x00c2, 0x26c5: 0x00c2, + 0x26c6: 0x00c2, 0x26c7: 0x00c2, 0x26c8: 0x00c2, 0x26c9: 0x00c2, 0x26ca: 0x00c2, 0x26cb: 0x00c2, + 0x26cc: 0x00c2, 0x26cd: 0x00c2, 0x26ce: 0x00c2, 0x26cf: 0x00c2, 0x26d0: 0x00c2, 0x26d1: 0x00c2, + 0x26d2: 0x00c2, 0x26d3: 0x00c2, 0x26d4: 0x00c2, 0x26d5: 0x00c2, 0x26d6: 0x00c2, 0x26d7: 0x00c2, + 0x26d8: 0x00c2, 0x26d9: 0x00c2, 0x26da: 0x00c2, 0x26db: 0x00c2, 0x26dc: 0x00c2, 0x26dd: 0x00c2, + 0x26de: 0x00c2, 0x26df: 0x00c2, 0x26e0: 0x00c2, 0x26e1: 0x00c2, 0x26e2: 0x00c2, 0x26e3: 0x00c2, + 0x26e4: 0x00c2, 0x26e5: 0x00c2, 0x26e6: 0x00c2, 0x26e7: 0x00c2, 0x26e8: 0x00c2, 0x26e9: 0x00c2, + 0x26ea: 0x00c2, 0x26eb: 0x00c2, 0x26ec: 0x00c2, 0x26ed: 0x00c2, 0x26ee: 0x00c2, 0x26ef: 0x00c2, + 0x26f0: 0x00c2, 0x26f1: 0x00c2, 0x26f2: 0x00c1, 0x26f3: 0x00c0, 0x26f4: 0x0080, 0x26f5: 0x0080, + 0x26f6: 0x0080, 0x26f7: 0x0080, + // Block 0x9c, offset 0x2700 + 0x2700: 0x00c0, 0x2701: 0x00c0, 0x2702: 0x00c0, 0x2703: 0x00c0, 0x2704: 0x00c6, 0x2705: 0x00c3, + 0x270e: 0x0080, 0x270f: 0x0080, 0x2710: 0x00c0, 0x2711: 0x00c0, + 0x2712: 0x00c0, 0x2713: 0x00c0, 0x2714: 0x00c0, 0x2715: 0x00c0, 0x2716: 0x00c0, 0x2717: 0x00c0, + 0x2718: 0x00c0, 0x2719: 0x00c0, + 0x2720: 0x00c3, 0x2721: 0x00c3, 0x2722: 0x00c3, 0x2723: 0x00c3, + 0x2724: 0x00c3, 0x2725: 0x00c3, 0x2726: 0x00c3, 0x2727: 0x00c3, 0x2728: 0x00c3, 0x2729: 0x00c3, + 0x272a: 0x00c3, 0x272b: 0x00c3, 0x272c: 0x00c3, 0x272d: 0x00c3, 0x272e: 0x00c3, 0x272f: 0x00c3, + 0x2730: 0x00c3, 0x2731: 0x00c3, 0x2732: 0x00c0, 0x2733: 0x00c0, 0x2734: 0x00c0, 0x2735: 0x00c0, + 0x2736: 0x00c0, 0x2737: 0x00c0, 0x2738: 0x0080, 0x2739: 0x0080, 0x273a: 0x0080, 0x273b: 0x00c0, + 0x273c: 0x0080, 0x273d: 0x00c0, 0x273e: 0x00c0, 0x273f: 0x00c3, + // Block 0x9d, offset 0x2740 + 0x2740: 0x00c0, 0x2741: 0x00c0, 0x2742: 0x00c0, 0x2743: 0x00c0, 0x2744: 0x00c0, 0x2745: 0x00c0, + 0x2746: 0x00c0, 0x2747: 0x00c0, 0x2748: 0x00c0, 0x2749: 0x00c0, 0x274a: 0x00c0, 0x274b: 0x00c0, + 0x274c: 0x00c0, 0x274d: 0x00c0, 0x274e: 0x00c0, 0x274f: 0x00c0, 0x2750: 0x00c0, 0x2751: 0x00c0, + 0x2752: 0x00c0, 0x2753: 0x00c0, 0x2754: 0x00c0, 0x2755: 0x00c0, 0x2756: 0x00c0, 0x2757: 0x00c0, + 0x2758: 0x00c0, 0x2759: 0x00c0, 0x275a: 0x00c0, 0x275b: 0x00c0, 0x275c: 0x00c0, 0x275d: 0x00c0, + 0x275e: 0x00c0, 0x275f: 0x00c0, 0x2760: 0x00c0, 0x2761: 0x00c0, 0x2762: 0x00c0, 0x2763: 0x00c0, + 0x2764: 0x00c0, 0x2765: 0x00c0, 0x2766: 0x00c3, 0x2767: 0x00c3, 0x2768: 0x00c3, 0x2769: 0x00c3, + 0x276a: 0x00c3, 0x276b: 0x00c3, 0x276c: 0x00c3, 0x276d: 0x00c3, 0x276e: 0x0080, 0x276f: 0x0080, + 0x2770: 0x00c0, 0x2771: 0x00c0, 0x2772: 0x00c0, 0x2773: 0x00c0, 0x2774: 0x00c0, 0x2775: 0x00c0, + 0x2776: 0x00c0, 0x2777: 0x00c0, 0x2778: 0x00c0, 0x2779: 0x00c0, 0x277a: 0x00c0, 0x277b: 0x00c0, + 0x277c: 0x00c0, 0x277d: 0x00c0, 0x277e: 0x00c0, 0x277f: 0x00c0, + // Block 0x9e, offset 0x2780 + 0x2780: 0x00c0, 0x2781: 0x00c0, 0x2782: 0x00c0, 0x2783: 0x00c0, 0x2784: 0x00c0, 0x2785: 0x00c0, + 0x2786: 0x00c0, 0x2787: 0x00c3, 0x2788: 0x00c3, 0x2789: 0x00c3, 0x278a: 0x00c3, 0x278b: 0x00c3, + 0x278c: 0x00c3, 0x278d: 0x00c3, 0x278e: 0x00c3, 0x278f: 0x00c3, 0x2790: 0x00c3, 0x2791: 0x00c3, + 0x2792: 0x00c0, 0x2793: 0x00c5, + 0x279f: 0x0080, 0x27a0: 0x0040, 0x27a1: 0x0040, 0x27a2: 0x0040, 0x27a3: 0x0040, + 0x27a4: 0x0040, 0x27a5: 0x0040, 0x27a6: 0x0040, 0x27a7: 0x0040, 0x27a8: 0x0040, 0x27a9: 0x0040, + 0x27aa: 0x0040, 0x27ab: 0x0040, 0x27ac: 0x0040, 0x27ad: 0x0040, 0x27ae: 0x0040, 0x27af: 0x0040, + 0x27b0: 0x0040, 0x27b1: 0x0040, 0x27b2: 0x0040, 0x27b3: 0x0040, 0x27b4: 0x0040, 0x27b5: 0x0040, + 0x27b6: 0x0040, 0x27b7: 0x0040, 0x27b8: 0x0040, 0x27b9: 0x0040, 0x27ba: 0x0040, 0x27bb: 0x0040, + 0x27bc: 0x0040, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x00c3, 0x27c1: 0x00c3, 0x27c2: 0x00c3, 0x27c3: 0x00c0, 0x27c4: 0x00c0, 0x27c5: 0x00c0, + 0x27c6: 0x00c0, 0x27c7: 0x00c0, 0x27c8: 0x00c0, 0x27c9: 0x00c0, 0x27ca: 0x00c0, 0x27cb: 0x00c0, + 0x27cc: 0x00c0, 0x27cd: 0x00c0, 0x27ce: 0x00c0, 0x27cf: 0x00c0, 0x27d0: 0x00c0, 0x27d1: 0x00c0, + 0x27d2: 0x00c0, 0x27d3: 0x00c0, 0x27d4: 0x00c0, 0x27d5: 0x00c0, 0x27d6: 0x00c0, 0x27d7: 0x00c0, + 0x27d8: 0x00c0, 0x27d9: 0x00c0, 0x27da: 0x00c0, 0x27db: 0x00c0, 0x27dc: 0x00c0, 0x27dd: 0x00c0, + 0x27de: 0x00c0, 0x27df: 0x00c0, 0x27e0: 0x00c0, 0x27e1: 0x00c0, 0x27e2: 0x00c0, 0x27e3: 0x00c0, + 0x27e4: 0x00c0, 0x27e5: 0x00c0, 0x27e6: 0x00c0, 0x27e7: 0x00c0, 0x27e8: 0x00c0, 0x27e9: 0x00c0, + 0x27ea: 0x00c0, 0x27eb: 0x00c0, 0x27ec: 0x00c0, 0x27ed: 0x00c0, 0x27ee: 0x00c0, 0x27ef: 0x00c0, + 0x27f0: 0x00c0, 0x27f1: 0x00c0, 0x27f2: 0x00c0, 0x27f3: 0x00c3, 0x27f4: 0x00c0, 0x27f5: 0x00c0, + 0x27f6: 0x00c3, 0x27f7: 0x00c3, 0x27f8: 0x00c3, 0x27f9: 0x00c3, 0x27fa: 0x00c0, 0x27fb: 0x00c0, + 0x27fc: 0x00c3, 0x27fd: 0x00c3, 0x27fe: 0x00c0, 0x27ff: 0x00c0, + // Block 0xa0, offset 0x2800 + 0x2800: 0x00c5, 0x2801: 0x0080, 0x2802: 0x0080, 0x2803: 0x0080, 0x2804: 0x0080, 0x2805: 0x0080, + 0x2806: 0x0080, 0x2807: 0x0080, 0x2808: 0x0080, 0x2809: 0x0080, 0x280a: 0x0080, 0x280b: 0x0080, + 0x280c: 0x0080, 0x280d: 0x0080, 0x280f: 0x00c0, 0x2810: 0x00c0, 0x2811: 0x00c0, + 0x2812: 0x00c0, 0x2813: 0x00c0, 0x2814: 0x00c0, 0x2815: 0x00c0, 0x2816: 0x00c0, 0x2817: 0x00c0, + 0x2818: 0x00c0, 0x2819: 0x00c0, + 0x281e: 0x0080, 0x281f: 0x0080, 0x2820: 0x00c0, 0x2821: 0x00c0, 0x2822: 0x00c0, 0x2823: 0x00c0, + 0x2824: 0x00c0, 0x2825: 0x00c3, 0x2826: 0x00c0, 0x2827: 0x00c0, 0x2828: 0x00c0, 0x2829: 0x00c0, + 0x282a: 0x00c0, 0x282b: 0x00c0, 0x282c: 0x00c0, 0x282d: 0x00c0, 0x282e: 0x00c0, 0x282f: 0x00c0, + 0x2830: 0x00c0, 0x2831: 0x00c0, 0x2832: 0x00c0, 0x2833: 0x00c0, 0x2834: 0x00c0, 0x2835: 0x00c0, + 0x2836: 0x00c0, 0x2837: 0x00c0, 0x2838: 0x00c0, 0x2839: 0x00c0, 0x283a: 0x00c0, 0x283b: 0x00c0, + 0x283c: 0x00c0, 0x283d: 0x00c0, 0x283e: 0x00c0, + // Block 0xa1, offset 0x2840 + 0x2840: 0x00c0, 0x2841: 0x00c0, 0x2842: 0x00c0, 0x2843: 0x00c0, 0x2844: 0x00c0, 0x2845: 0x00c0, + 0x2846: 0x00c0, 0x2847: 0x00c0, 0x2848: 0x00c0, 0x2849: 0x00c0, 0x284a: 0x00c0, 0x284b: 0x00c0, + 0x284c: 0x00c0, 0x284d: 0x00c0, 0x284e: 0x00c0, 0x284f: 0x00c0, 0x2850: 0x00c0, 0x2851: 0x00c0, + 0x2852: 0x00c0, 0x2853: 0x00c0, 0x2854: 0x00c0, 0x2855: 0x00c0, 0x2856: 0x00c0, 0x2857: 0x00c0, + 0x2858: 0x00c0, 0x2859: 0x00c0, 0x285a: 0x00c0, 0x285b: 0x00c0, 0x285c: 0x00c0, 0x285d: 0x00c0, + 0x285e: 0x00c0, 0x285f: 0x00c0, 0x2860: 0x00c0, 0x2861: 0x00c0, 0x2862: 0x00c0, 0x2863: 0x00c0, + 0x2864: 0x00c0, 0x2865: 0x00c0, 0x2866: 0x00c0, 0x2867: 0x00c0, 0x2868: 0x00c0, 0x2869: 0x00c3, + 0x286a: 0x00c3, 0x286b: 0x00c3, 0x286c: 0x00c3, 0x286d: 0x00c3, 0x286e: 0x00c3, 0x286f: 0x00c0, + 0x2870: 0x00c0, 0x2871: 0x00c3, 0x2872: 0x00c3, 0x2873: 0x00c0, 0x2874: 0x00c0, 0x2875: 0x00c3, + 0x2876: 0x00c3, + // Block 0xa2, offset 0x2880 + 0x2880: 0x00c0, 0x2881: 0x00c0, 0x2882: 0x00c0, 0x2883: 0x00c3, 0x2884: 0x00c0, 0x2885: 0x00c0, + 0x2886: 0x00c0, 0x2887: 0x00c0, 0x2888: 0x00c0, 0x2889: 0x00c0, 0x288a: 0x00c0, 0x288b: 0x00c0, + 0x288c: 0x00c3, 0x288d: 0x00c0, 0x2890: 0x00c0, 0x2891: 0x00c0, + 0x2892: 0x00c0, 0x2893: 0x00c0, 0x2894: 0x00c0, 0x2895: 0x00c0, 0x2896: 0x00c0, 0x2897: 0x00c0, + 0x2898: 0x00c0, 0x2899: 0x00c0, 0x289c: 0x0080, 0x289d: 0x0080, + 0x289e: 0x0080, 0x289f: 0x0080, 0x28a0: 0x00c0, 0x28a1: 0x00c0, 0x28a2: 0x00c0, 0x28a3: 0x00c0, + 0x28a4: 0x00c0, 0x28a5: 0x00c0, 0x28a6: 0x00c0, 0x28a7: 0x00c0, 0x28a8: 0x00c0, 0x28a9: 0x00c0, + 0x28aa: 0x00c0, 0x28ab: 0x00c0, 0x28ac: 0x00c0, 0x28ad: 0x00c0, 0x28ae: 0x00c0, 0x28af: 0x00c0, + 0x28b0: 0x00c0, 0x28b1: 0x00c0, 0x28b2: 0x00c0, 0x28b3: 0x00c0, 0x28b4: 0x00c0, 0x28b5: 0x00c0, + 0x28b6: 0x00c0, 0x28b7: 0x0080, 0x28b8: 0x0080, 0x28b9: 0x0080, 0x28ba: 0x00c0, 0x28bb: 0x00c0, + 0x28bc: 0x00c3, 0x28bd: 0x00c0, 0x28be: 0x00c0, 0x28bf: 0x00c0, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x00c0, 0x28c1: 0x00c0, 0x28c2: 0x00c0, 0x28c3: 0x00c0, 0x28c4: 0x00c0, 0x28c5: 0x00c0, + 0x28c6: 0x00c0, 0x28c7: 0x00c0, 0x28c8: 0x00c0, 0x28c9: 0x00c0, 0x28ca: 0x00c0, 0x28cb: 0x00c0, + 0x28cc: 0x00c0, 0x28cd: 0x00c0, 0x28ce: 0x00c0, 0x28cf: 0x00c0, 0x28d0: 0x00c0, 0x28d1: 0x00c0, + 0x28d2: 0x00c0, 0x28d3: 0x00c0, 0x28d4: 0x00c0, 0x28d5: 0x00c0, 0x28d6: 0x00c0, 0x28d7: 0x00c0, + 0x28d8: 0x00c0, 0x28d9: 0x00c0, 0x28da: 0x00c0, 0x28db: 0x00c0, 0x28dc: 0x00c0, 0x28dd: 0x00c0, + 0x28de: 0x00c0, 0x28df: 0x00c0, 0x28e0: 0x00c0, 0x28e1: 0x00c0, 0x28e2: 0x00c0, 0x28e3: 0x00c0, + 0x28e4: 0x00c0, 0x28e5: 0x00c0, 0x28e6: 0x00c0, 0x28e7: 0x00c0, 0x28e8: 0x00c0, 0x28e9: 0x00c0, + 0x28ea: 0x00c0, 0x28eb: 0x00c0, 0x28ec: 0x00c0, 0x28ed: 0x00c0, 0x28ee: 0x00c0, 0x28ef: 0x00c0, + 0x28f0: 0x00c3, 0x28f1: 0x00c0, 0x28f2: 0x00c3, 0x28f3: 0x00c3, 0x28f4: 0x00c3, 0x28f5: 0x00c0, + 0x28f6: 0x00c0, 0x28f7: 0x00c3, 0x28f8: 0x00c3, 0x28f9: 0x00c0, 0x28fa: 0x00c0, 0x28fb: 0x00c0, + 0x28fc: 0x00c0, 0x28fd: 0x00c0, 0x28fe: 0x00c3, 0x28ff: 0x00c3, + // Block 0xa4, offset 0x2900 + 0x2900: 0x00c0, 0x2901: 0x00c3, 0x2902: 0x00c0, + 0x291b: 0x00c0, 0x291c: 0x00c0, 0x291d: 0x00c0, + 0x291e: 0x0080, 0x291f: 0x0080, 0x2920: 0x00c0, 0x2921: 0x00c0, 0x2922: 0x00c0, 0x2923: 0x00c0, + 0x2924: 0x00c0, 0x2925: 0x00c0, 0x2926: 0x00c0, 0x2927: 0x00c0, 0x2928: 0x00c0, 0x2929: 0x00c0, + 0x292a: 0x00c0, 0x292b: 0x00c0, 0x292c: 0x00c3, 0x292d: 0x00c3, 0x292e: 0x00c0, 0x292f: 0x00c0, + 0x2930: 0x0080, 0x2931: 0x0080, 0x2932: 0x00c0, 0x2933: 0x00c0, 0x2934: 0x00c0, 0x2935: 0x00c0, + 0x2936: 0x00c6, + // Block 0xa5, offset 0x2940 + 0x2941: 0x00c0, 0x2942: 0x00c0, 0x2943: 0x00c0, 0x2944: 0x00c0, 0x2945: 0x00c0, + 0x2946: 0x00c0, 0x2949: 0x00c0, 0x294a: 0x00c0, 0x294b: 0x00c0, + 0x294c: 0x00c0, 0x294d: 0x00c0, 0x294e: 0x00c0, 0x2951: 0x00c0, + 0x2952: 0x00c0, 0x2953: 0x00c0, 0x2954: 0x00c0, 0x2955: 0x00c0, 0x2956: 0x00c0, + 0x2960: 0x00c0, 0x2961: 0x00c0, 0x2962: 0x00c0, 0x2963: 0x00c0, + 0x2964: 0x00c0, 0x2965: 0x00c0, 0x2966: 0x00c0, 0x2968: 0x00c0, 0x2969: 0x00c0, + 0x296a: 0x00c0, 0x296b: 0x00c0, 0x296c: 0x00c0, 0x296d: 0x00c0, 0x296e: 0x00c0, + 0x2970: 0x00c0, 0x2971: 0x00c0, 0x2972: 0x00c0, 0x2973: 0x00c0, 0x2974: 0x00c0, 0x2975: 0x00c0, + 0x2976: 0x00c0, 0x2977: 0x00c0, 0x2978: 0x00c0, 0x2979: 0x00c0, 0x297a: 0x00c0, 0x297b: 0x00c0, + 0x297c: 0x00c0, 0x297d: 0x00c0, 0x297e: 0x00c0, 0x297f: 0x00c0, + // Block 0xa6, offset 0x2980 + 0x2980: 0x00c0, 0x2981: 0x00c0, 0x2982: 0x00c0, 0x2983: 0x00c0, 0x2984: 0x00c0, 0x2985: 0x00c0, + 0x2986: 0x00c0, 0x2987: 0x00c0, 0x2988: 0x00c0, 0x2989: 0x00c0, 0x298a: 0x00c0, 0x298b: 0x00c0, + 0x298c: 0x00c0, 0x298d: 0x00c0, 0x298e: 0x00c0, 0x298f: 0x00c0, 0x2990: 0x00c0, 0x2991: 0x00c0, + 0x2992: 0x00c0, 0x2993: 0x00c0, 0x2994: 0x00c0, 0x2995: 0x00c0, 0x2996: 0x00c0, 0x2997: 0x00c0, + 0x2998: 0x00c0, 0x2999: 0x00c0, 0x299a: 0x00c0, 0x299b: 0x0080, 0x299c: 0x0080, 0x299d: 0x0080, + 0x299e: 0x0080, 0x299f: 0x0080, 0x29a0: 0x00c0, 0x29a1: 0x00c0, 0x29a2: 0x00c0, 0x29a3: 0x00c0, + 0x29a4: 0x00c0, 0x29a5: 0x00c8, 0x29a6: 0x00c0, 0x29a7: 0x00c0, 0x29a8: 0x00c0, 0x29a9: 0x0080, + 0x29aa: 0x0080, 0x29ab: 0x0080, + 0x29b0: 0x00c0, 0x29b1: 0x00c0, 0x29b2: 0x00c0, 0x29b3: 0x00c0, 0x29b4: 0x00c0, 0x29b5: 0x00c0, + 0x29b6: 0x00c0, 0x29b7: 0x00c0, 0x29b8: 0x00c0, 0x29b9: 0x00c0, 0x29ba: 0x00c0, 0x29bb: 0x00c0, + 0x29bc: 0x00c0, 0x29bd: 0x00c0, 0x29be: 0x00c0, 0x29bf: 0x00c0, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x00c0, 0x29c1: 0x00c0, 0x29c2: 0x00c0, 0x29c3: 0x00c0, 0x29c4: 0x00c0, 0x29c5: 0x00c0, + 0x29c6: 0x00c0, 0x29c7: 0x00c0, 0x29c8: 0x00c0, 0x29c9: 0x00c0, 0x29ca: 0x00c0, 0x29cb: 0x00c0, + 0x29cc: 0x00c0, 0x29cd: 0x00c0, 0x29ce: 0x00c0, 0x29cf: 0x00c0, 0x29d0: 0x00c0, 0x29d1: 0x00c0, + 0x29d2: 0x00c0, 0x29d3: 0x00c0, 0x29d4: 0x00c0, 0x29d5: 0x00c0, 0x29d6: 0x00c0, 0x29d7: 0x00c0, + 0x29d8: 0x00c0, 0x29d9: 0x00c0, 0x29da: 0x00c0, 0x29db: 0x00c0, 0x29dc: 0x00c0, 0x29dd: 0x00c0, + 0x29de: 0x00c0, 0x29df: 0x00c0, 0x29e0: 0x00c0, 0x29e1: 0x00c0, 0x29e2: 0x00c0, 0x29e3: 0x00c0, + 0x29e4: 0x00c0, 0x29e5: 0x00c3, 0x29e6: 0x00c0, 0x29e7: 0x00c0, 0x29e8: 0x00c3, 0x29e9: 0x00c0, + 0x29ea: 0x00c0, 0x29eb: 0x0080, 0x29ec: 0x00c0, 0x29ed: 0x00c6, + 0x29f0: 0x00c0, 0x29f1: 0x00c0, 0x29f2: 0x00c0, 0x29f3: 0x00c0, 0x29f4: 0x00c0, 0x29f5: 0x00c0, + 0x29f6: 0x00c0, 0x29f7: 0x00c0, 0x29f8: 0x00c0, 0x29f9: 0x00c0, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x00c0, 0x2a01: 0x00c0, 0x2a02: 0x00c0, 0x2a03: 0x00c0, 0x2a04: 0x00c0, 0x2a05: 0x00c0, + 0x2a06: 0x00c0, 0x2a07: 0x00c0, 0x2a08: 0x00c0, 0x2a09: 0x00c0, 0x2a0a: 0x00c0, 0x2a0b: 0x00c0, + 0x2a0c: 0x00c0, 0x2a0d: 0x00c0, 0x2a0e: 0x00c0, 0x2a0f: 0x00c0, 0x2a10: 0x00c0, 0x2a11: 0x00c0, + 0x2a12: 0x00c0, 0x2a13: 0x00c0, 0x2a14: 0x00c0, 0x2a15: 0x00c0, 0x2a16: 0x00c0, 0x2a17: 0x00c0, + 0x2a18: 0x00c0, 0x2a19: 0x00c0, 0x2a1a: 0x00c0, 0x2a1b: 0x00c0, 0x2a1c: 0x00c0, 0x2a1d: 0x00c0, + 0x2a1e: 0x00c0, 0x2a1f: 0x00c0, 0x2a20: 0x00c0, 0x2a21: 0x00c0, 0x2a22: 0x00c0, 0x2a23: 0x00c0, + 0x2a30: 0x0040, 0x2a31: 0x0040, 0x2a32: 0x0040, 0x2a33: 0x0040, 0x2a34: 0x0040, 0x2a35: 0x0040, + 0x2a36: 0x0040, 0x2a37: 0x0040, 0x2a38: 0x0040, 0x2a39: 0x0040, 0x2a3a: 0x0040, 0x2a3b: 0x0040, + 0x2a3c: 0x0040, 0x2a3d: 0x0040, 0x2a3e: 0x0040, 0x2a3f: 0x0040, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x0040, 0x2a41: 0x0040, 0x2a42: 0x0040, 0x2a43: 0x0040, 0x2a44: 0x0040, 0x2a45: 0x0040, + 0x2a46: 0x0040, 0x2a4b: 0x0040, + 0x2a4c: 0x0040, 0x2a4d: 0x0040, 0x2a4e: 0x0040, 0x2a4f: 0x0040, 0x2a50: 0x0040, 0x2a51: 0x0040, + 0x2a52: 0x0040, 0x2a53: 0x0040, 0x2a54: 0x0040, 0x2a55: 0x0040, 0x2a56: 0x0040, 0x2a57: 0x0040, + 0x2a58: 0x0040, 0x2a59: 0x0040, 0x2a5a: 0x0040, 0x2a5b: 0x0040, 0x2a5c: 0x0040, 0x2a5d: 0x0040, + 0x2a5e: 0x0040, 0x2a5f: 0x0040, 0x2a60: 0x0040, 0x2a61: 0x0040, 0x2a62: 0x0040, 0x2a63: 0x0040, + 0x2a64: 0x0040, 0x2a65: 0x0040, 0x2a66: 0x0040, 0x2a67: 0x0040, 0x2a68: 0x0040, 0x2a69: 0x0040, + 0x2a6a: 0x0040, 0x2a6b: 0x0040, 0x2a6c: 0x0040, 0x2a6d: 0x0040, 0x2a6e: 0x0040, 0x2a6f: 0x0040, + 0x2a70: 0x0040, 0x2a71: 0x0040, 0x2a72: 0x0040, 0x2a73: 0x0040, 0x2a74: 0x0040, 0x2a75: 0x0040, + 0x2a76: 0x0040, 0x2a77: 0x0040, 0x2a78: 0x0040, 0x2a79: 0x0040, 0x2a7a: 0x0040, 0x2a7b: 0x0040, + // Block 0xaa, offset 0x2a80 + 0x2a80: 0x008c, 0x2a81: 0x008c, 0x2a82: 0x008c, 0x2a83: 0x008c, 0x2a84: 0x008c, 0x2a85: 0x008c, + 0x2a86: 0x008c, 0x2a87: 0x008c, 0x2a88: 0x008c, 0x2a89: 0x008c, 0x2a8a: 0x008c, 0x2a8b: 0x008c, + 0x2a8c: 0x008c, 0x2a8d: 0x008c, 0x2a8e: 0x00cc, 0x2a8f: 0x00cc, 0x2a90: 0x008c, 0x2a91: 0x00cc, + 0x2a92: 0x008c, 0x2a93: 0x00cc, 0x2a94: 0x00cc, 0x2a95: 0x008c, 0x2a96: 0x008c, 0x2a97: 0x008c, + 0x2a98: 0x008c, 0x2a99: 0x008c, 0x2a9a: 0x008c, 0x2a9b: 0x008c, 0x2a9c: 0x008c, 0x2a9d: 0x008c, + 0x2a9e: 0x008c, 0x2a9f: 0x00cc, 0x2aa0: 0x008c, 0x2aa1: 0x00cc, 0x2aa2: 0x008c, 0x2aa3: 0x00cc, + 0x2aa4: 0x00cc, 0x2aa5: 0x008c, 0x2aa6: 0x008c, 0x2aa7: 0x00cc, 0x2aa8: 0x00cc, 0x2aa9: 0x00cc, + 0x2aaa: 0x008c, 0x2aab: 0x008c, 0x2aac: 0x008c, 0x2aad: 0x008c, 0x2aae: 0x008c, 0x2aaf: 0x008c, + 0x2ab0: 0x008c, 0x2ab1: 0x008c, 0x2ab2: 0x008c, 0x2ab3: 0x008c, 0x2ab4: 0x008c, 0x2ab5: 0x008c, + 0x2ab6: 0x008c, 0x2ab7: 0x008c, 0x2ab8: 0x008c, 0x2ab9: 0x008c, 0x2aba: 0x008c, 0x2abb: 0x008c, + 0x2abc: 0x008c, 0x2abd: 0x008c, 0x2abe: 0x008c, 0x2abf: 0x008c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x008c, 0x2ac1: 0x008c, 0x2ac2: 0x008c, 0x2ac3: 0x008c, 0x2ac4: 0x008c, 0x2ac5: 0x008c, + 0x2ac6: 0x008c, 0x2ac7: 0x008c, 0x2ac8: 0x008c, 0x2ac9: 0x008c, 0x2aca: 0x008c, 0x2acb: 0x008c, + 0x2acc: 0x008c, 0x2acd: 0x008c, 0x2ace: 0x008c, 0x2acf: 0x008c, 0x2ad0: 0x008c, 0x2ad1: 0x008c, + 0x2ad2: 0x008c, 0x2ad3: 0x008c, 0x2ad4: 0x008c, 0x2ad5: 0x008c, 0x2ad6: 0x008c, 0x2ad7: 0x008c, + 0x2ad8: 0x008c, 0x2ad9: 0x008c, 0x2ada: 0x008c, 0x2adb: 0x008c, 0x2adc: 0x008c, 0x2add: 0x008c, + 0x2ade: 0x008c, 0x2adf: 0x008c, 0x2ae0: 0x008c, 0x2ae1: 0x008c, 0x2ae2: 0x008c, 0x2ae3: 0x008c, + 0x2ae4: 0x008c, 0x2ae5: 0x008c, 0x2ae6: 0x008c, 0x2ae7: 0x008c, 0x2ae8: 0x008c, 0x2ae9: 0x008c, + 0x2aea: 0x008c, 0x2aeb: 0x008c, 0x2aec: 0x008c, 0x2aed: 0x008c, + 0x2af0: 0x008c, 0x2af1: 0x008c, 0x2af2: 0x008c, 0x2af3: 0x008c, 0x2af4: 0x008c, 0x2af5: 0x008c, + 0x2af6: 0x008c, 0x2af7: 0x008c, 0x2af8: 0x008c, 0x2af9: 0x008c, 0x2afa: 0x008c, 0x2afb: 0x008c, + 0x2afc: 0x008c, 0x2afd: 0x008c, 0x2afe: 0x008c, 0x2aff: 0x008c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x008c, 0x2b01: 0x008c, 0x2b02: 0x008c, 0x2b03: 0x008c, 0x2b04: 0x008c, 0x2b05: 0x008c, + 0x2b06: 0x008c, 0x2b07: 0x008c, 0x2b08: 0x008c, 0x2b09: 0x008c, 0x2b0a: 0x008c, 0x2b0b: 0x008c, + 0x2b0c: 0x008c, 0x2b0d: 0x008c, 0x2b0e: 0x008c, 0x2b0f: 0x008c, 0x2b10: 0x008c, 0x2b11: 0x008c, + 0x2b12: 0x008c, 0x2b13: 0x008c, 0x2b14: 0x008c, 0x2b15: 0x008c, 0x2b16: 0x008c, 0x2b17: 0x008c, + 0x2b18: 0x008c, 0x2b19: 0x008c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x0080, 0x2b41: 0x0080, 0x2b42: 0x0080, 0x2b43: 0x0080, 0x2b44: 0x0080, 0x2b45: 0x0080, + 0x2b46: 0x0080, + 0x2b53: 0x0080, 0x2b54: 0x0080, 0x2b55: 0x0080, 0x2b56: 0x0080, 0x2b57: 0x0080, + 0x2b5d: 0x008a, + 0x2b5e: 0x00cb, 0x2b5f: 0x008a, 0x2b60: 0x008a, 0x2b61: 0x008a, 0x2b62: 0x008a, 0x2b63: 0x008a, + 0x2b64: 0x008a, 0x2b65: 0x008a, 0x2b66: 0x008a, 0x2b67: 0x008a, 0x2b68: 0x008a, 0x2b69: 0x008a, + 0x2b6a: 0x008a, 0x2b6b: 0x008a, 0x2b6c: 0x008a, 0x2b6d: 0x008a, 0x2b6e: 0x008a, 0x2b6f: 0x008a, + 0x2b70: 0x008a, 0x2b71: 0x008a, 0x2b72: 0x008a, 0x2b73: 0x008a, 0x2b74: 0x008a, 0x2b75: 0x008a, + 0x2b76: 0x008a, 0x2b78: 0x008a, 0x2b79: 0x008a, 0x2b7a: 0x008a, 0x2b7b: 0x008a, + 0x2b7c: 0x008a, 0x2b7e: 0x008a, + // Block 0xae, offset 0x2b80 + 0x2b80: 0x008a, 0x2b81: 0x008a, 0x2b83: 0x008a, 0x2b84: 0x008a, + 0x2b86: 0x008a, 0x2b87: 0x008a, 0x2b88: 0x008a, 0x2b89: 0x008a, 0x2b8a: 0x008a, 0x2b8b: 0x008a, + 0x2b8c: 0x008a, 0x2b8d: 0x008a, 0x2b8e: 0x008a, 0x2b8f: 0x008a, 0x2b90: 0x0080, 0x2b91: 0x0080, + 0x2b92: 0x0080, 0x2b93: 0x0080, 0x2b94: 0x0080, 0x2b95: 0x0080, 0x2b96: 0x0080, 0x2b97: 0x0080, + 0x2b98: 0x0080, 0x2b99: 0x0080, 0x2b9a: 0x0080, 0x2b9b: 0x0080, 0x2b9c: 0x0080, 0x2b9d: 0x0080, + 0x2b9e: 0x0080, 0x2b9f: 0x0080, 0x2ba0: 0x0080, 0x2ba1: 0x0080, 0x2ba2: 0x0080, 0x2ba3: 0x0080, + 0x2ba4: 0x0080, 0x2ba5: 0x0080, 0x2ba6: 0x0080, 0x2ba7: 0x0080, 0x2ba8: 0x0080, 0x2ba9: 0x0080, + 0x2baa: 0x0080, 0x2bab: 0x0080, 0x2bac: 0x0080, 0x2bad: 0x0080, 0x2bae: 0x0080, 0x2baf: 0x0080, + 0x2bb0: 0x0080, 0x2bb1: 0x0080, 0x2bb2: 0x0080, 0x2bb3: 0x0080, 0x2bb4: 0x0080, 0x2bb5: 0x0080, + 0x2bb6: 0x0080, 0x2bb7: 0x0080, 0x2bb8: 0x0080, 0x2bb9: 0x0080, 0x2bba: 0x0080, 0x2bbb: 0x0080, + 0x2bbc: 0x0080, 0x2bbd: 0x0080, 0x2bbe: 0x0080, 0x2bbf: 0x0080, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x0080, 0x2bc1: 0x0080, 0x2bc2: 0x0080, + 0x2bd3: 0x0080, 0x2bd4: 0x0080, 0x2bd5: 0x0080, 0x2bd6: 0x0080, 0x2bd7: 0x0080, + 0x2bd8: 0x0080, 0x2bd9: 0x0080, 0x2bda: 0x0080, 0x2bdb: 0x0080, 0x2bdc: 0x0080, 0x2bdd: 0x0080, + 0x2bde: 0x0080, 0x2bdf: 0x0080, 0x2be0: 0x0080, 0x2be1: 0x0080, 0x2be2: 0x0080, 0x2be3: 0x0080, + 0x2be4: 0x0080, 0x2be5: 0x0080, 0x2be6: 0x0080, 0x2be7: 0x0080, 0x2be8: 0x0080, 0x2be9: 0x0080, + 0x2bea: 0x0080, 0x2beb: 0x0080, 0x2bec: 0x0080, 0x2bed: 0x0080, 0x2bee: 0x0080, 0x2bef: 0x0080, + 0x2bf0: 0x0080, 0x2bf1: 0x0080, 0x2bf2: 0x0080, 0x2bf3: 0x0080, 0x2bf4: 0x0080, 0x2bf5: 0x0080, + 0x2bf6: 0x0080, 0x2bf7: 0x0080, 0x2bf8: 0x0080, 0x2bf9: 0x0080, 0x2bfa: 0x0080, 0x2bfb: 0x0080, + 0x2bfc: 0x0080, 0x2bfd: 0x0080, 0x2bfe: 0x0080, 0x2bff: 0x0080, + // Block 0xb0, offset 0x2c00 + 0x2c00: 0x0080, 0x2c01: 0x0080, 0x2c02: 0x0080, 0x2c03: 0x0080, 0x2c04: 0x0080, 0x2c05: 0x0080, + 0x2c06: 0x0080, 0x2c07: 0x0080, 0x2c08: 0x0080, 0x2c09: 0x0080, 0x2c0a: 0x0080, 0x2c0b: 0x0080, + 0x2c0c: 0x0080, 0x2c0d: 0x0080, 0x2c0e: 0x0080, 0x2c0f: 0x0080, + 0x2c12: 0x0080, 0x2c13: 0x0080, 0x2c14: 0x0080, 0x2c15: 0x0080, 0x2c16: 0x0080, 0x2c17: 0x0080, + 0x2c18: 0x0080, 0x2c19: 0x0080, 0x2c1a: 0x0080, 0x2c1b: 0x0080, 0x2c1c: 0x0080, 0x2c1d: 0x0080, + 0x2c1e: 0x0080, 0x2c1f: 0x0080, 0x2c20: 0x0080, 0x2c21: 0x0080, 0x2c22: 0x0080, 0x2c23: 0x0080, + 0x2c24: 0x0080, 0x2c25: 0x0080, 0x2c26: 0x0080, 0x2c27: 0x0080, 0x2c28: 0x0080, 0x2c29: 0x0080, + 0x2c2a: 0x0080, 0x2c2b: 0x0080, 0x2c2c: 0x0080, 0x2c2d: 0x0080, 0x2c2e: 0x0080, 0x2c2f: 0x0080, + 0x2c30: 0x0080, 0x2c31: 0x0080, 0x2c32: 0x0080, 0x2c33: 0x0080, 0x2c34: 0x0080, 0x2c35: 0x0080, + 0x2c36: 0x0080, 0x2c37: 0x0080, 0x2c38: 0x0080, 0x2c39: 0x0080, 0x2c3a: 0x0080, 0x2c3b: 0x0080, + 0x2c3c: 0x0080, 0x2c3d: 0x0080, 0x2c3e: 0x0080, 0x2c3f: 0x0080, + // Block 0xb1, offset 0x2c40 + 0x2c40: 0x0080, 0x2c41: 0x0080, 0x2c42: 0x0080, 0x2c43: 0x0080, 0x2c44: 0x0080, 0x2c45: 0x0080, + 0x2c46: 0x0080, 0x2c47: 0x0080, + 0x2c4f: 0x0080, + 0x2c70: 0x0080, 0x2c71: 0x0080, 0x2c72: 0x0080, 0x2c73: 0x0080, 0x2c74: 0x0080, 0x2c75: 0x0080, + 0x2c76: 0x0080, 0x2c77: 0x0080, 0x2c78: 0x0080, 0x2c79: 0x0080, 0x2c7a: 0x0080, 0x2c7b: 0x0080, + 0x2c7c: 0x0080, 0x2c7d: 0x0080, 0x2c7e: 0x0080, 0x2c7f: 0x0080, + // Block 0xb2, offset 0x2c80 + 0x2c80: 0x0040, 0x2c81: 0x0040, 0x2c82: 0x0040, 0x2c83: 0x0040, 0x2c84: 0x0040, 0x2c85: 0x0040, + 0x2c86: 0x0040, 0x2c87: 0x0040, 0x2c88: 0x0040, 0x2c89: 0x0040, 0x2c8a: 0x0040, 0x2c8b: 0x0040, + 0x2c8c: 0x0040, 0x2c8d: 0x0040, 0x2c8e: 0x0040, 0x2c8f: 0x0040, 0x2c90: 0x0080, 0x2c91: 0x0080, + 0x2c92: 0x0080, 0x2c93: 0x0080, 0x2c94: 0x0080, 0x2c95: 0x0080, 0x2c96: 0x0080, 0x2c97: 0x0080, + 0x2c98: 0x0080, 0x2c99: 0x0080, + 0x2ca0: 0x00c3, 0x2ca1: 0x00c3, 0x2ca2: 0x00c3, 0x2ca3: 0x00c3, + 0x2ca4: 0x00c3, 0x2ca5: 0x00c3, 0x2ca6: 0x00c3, 0x2ca7: 0x00c3, 0x2ca8: 0x00c3, 0x2ca9: 0x00c3, + 0x2caa: 0x00c3, 0x2cab: 0x00c3, 0x2cac: 0x00c3, 0x2cad: 0x00c3, 0x2cae: 0x00c3, 0x2caf: 0x00c3, + 0x2cb0: 0x0080, 0x2cb1: 0x0080, 0x2cb2: 0x0080, 0x2cb3: 0x0080, 0x2cb4: 0x0080, 0x2cb5: 0x0080, + 0x2cb6: 0x0080, 0x2cb7: 0x0080, 0x2cb8: 0x0080, 0x2cb9: 0x0080, 0x2cba: 0x0080, 0x2cbb: 0x0080, + 0x2cbc: 0x0080, 0x2cbd: 0x0080, 0x2cbe: 0x0080, 0x2cbf: 0x0080, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x0080, 0x2cc1: 0x0080, 0x2cc2: 0x0080, 0x2cc3: 0x0080, 0x2cc4: 0x0080, 0x2cc5: 0x0080, + 0x2cc6: 0x0080, 0x2cc7: 0x0080, 0x2cc8: 0x0080, 0x2cc9: 0x0080, 0x2cca: 0x0080, 0x2ccb: 0x0080, + 0x2ccc: 0x0080, 0x2ccd: 0x0080, 0x2cce: 0x0080, 0x2ccf: 0x0080, 0x2cd0: 0x0080, 0x2cd1: 0x0080, + 0x2cd2: 0x0080, 0x2cd4: 0x0080, 0x2cd5: 0x0080, 0x2cd6: 0x0080, 0x2cd7: 0x0080, + 0x2cd8: 0x0080, 0x2cd9: 0x0080, 0x2cda: 0x0080, 0x2cdb: 0x0080, 0x2cdc: 0x0080, 0x2cdd: 0x0080, + 0x2cde: 0x0080, 0x2cdf: 0x0080, 0x2ce0: 0x0080, 0x2ce1: 0x0080, 0x2ce2: 0x0080, 0x2ce3: 0x0080, + 0x2ce4: 0x0080, 0x2ce5: 0x0080, 0x2ce6: 0x0080, 0x2ce8: 0x0080, 0x2ce9: 0x0080, + 0x2cea: 0x0080, 0x2ceb: 0x0080, + 0x2cf0: 0x0080, 0x2cf1: 0x0080, 0x2cf2: 0x0080, 0x2cf3: 0x00c0, 0x2cf4: 0x0080, + 0x2cf6: 0x0080, 0x2cf7: 0x0080, 0x2cf8: 0x0080, 0x2cf9: 0x0080, 0x2cfa: 0x0080, 0x2cfb: 0x0080, + 0x2cfc: 0x0080, 0x2cfd: 0x0080, 0x2cfe: 0x0080, 0x2cff: 0x0080, + // Block 0xb4, offset 0x2d00 + 0x2d00: 0x0080, 0x2d01: 0x0080, 0x2d02: 0x0080, 0x2d03: 0x0080, 0x2d04: 0x0080, 0x2d05: 0x0080, + 0x2d06: 0x0080, 0x2d07: 0x0080, 0x2d08: 0x0080, 0x2d09: 0x0080, 0x2d0a: 0x0080, 0x2d0b: 0x0080, + 0x2d0c: 0x0080, 0x2d0d: 0x0080, 0x2d0e: 0x0080, 0x2d0f: 0x0080, 0x2d10: 0x0080, 0x2d11: 0x0080, + 0x2d12: 0x0080, 0x2d13: 0x0080, 0x2d14: 0x0080, 0x2d15: 0x0080, 0x2d16: 0x0080, 0x2d17: 0x0080, + 0x2d18: 0x0080, 0x2d19: 0x0080, 0x2d1a: 0x0080, 0x2d1b: 0x0080, 0x2d1c: 0x0080, 0x2d1d: 0x0080, + 0x2d1e: 0x0080, 0x2d1f: 0x0080, 0x2d20: 0x0080, 0x2d21: 0x0080, 0x2d22: 0x0080, 0x2d23: 0x0080, + 0x2d24: 0x0080, 0x2d25: 0x0080, 0x2d26: 0x0080, 0x2d27: 0x0080, 0x2d28: 0x0080, 0x2d29: 0x0080, + 0x2d2a: 0x0080, 0x2d2b: 0x0080, 0x2d2c: 0x0080, 0x2d2d: 0x0080, 0x2d2e: 0x0080, 0x2d2f: 0x0080, + 0x2d30: 0x0080, 0x2d31: 0x0080, 0x2d32: 0x0080, 0x2d33: 0x0080, 0x2d34: 0x0080, 0x2d35: 0x0080, + 0x2d36: 0x0080, 0x2d37: 0x0080, 0x2d38: 0x0080, 0x2d39: 0x0080, 0x2d3a: 0x0080, 0x2d3b: 0x0080, + 0x2d3c: 0x0080, 0x2d3f: 0x0040, + // Block 0xb5, offset 0x2d40 + 0x2d41: 0x0080, 0x2d42: 0x0080, 0x2d43: 0x0080, 0x2d44: 0x0080, 0x2d45: 0x0080, + 0x2d46: 0x0080, 0x2d47: 0x0080, 0x2d48: 0x0080, 0x2d49: 0x0080, 0x2d4a: 0x0080, 0x2d4b: 0x0080, + 0x2d4c: 0x0080, 0x2d4d: 0x0080, 0x2d4e: 0x0080, 0x2d4f: 0x0080, 0x2d50: 0x0080, 0x2d51: 0x0080, + 0x2d52: 0x0080, 0x2d53: 0x0080, 0x2d54: 0x0080, 0x2d55: 0x0080, 0x2d56: 0x0080, 0x2d57: 0x0080, + 0x2d58: 0x0080, 0x2d59: 0x0080, 0x2d5a: 0x0080, 0x2d5b: 0x0080, 0x2d5c: 0x0080, 0x2d5d: 0x0080, + 0x2d5e: 0x0080, 0x2d5f: 0x0080, 0x2d60: 0x0080, 0x2d61: 0x0080, 0x2d62: 0x0080, 0x2d63: 0x0080, + 0x2d64: 0x0080, 0x2d65: 0x0080, 0x2d66: 0x0080, 0x2d67: 0x0080, 0x2d68: 0x0080, 0x2d69: 0x0080, + 0x2d6a: 0x0080, 0x2d6b: 0x0080, 0x2d6c: 0x0080, 0x2d6d: 0x0080, 0x2d6e: 0x0080, 0x2d6f: 0x0080, + 0x2d70: 0x0080, 0x2d71: 0x0080, 0x2d72: 0x0080, 0x2d73: 0x0080, 0x2d74: 0x0080, 0x2d75: 0x0080, + 0x2d76: 0x0080, 0x2d77: 0x0080, 0x2d78: 0x0080, 0x2d79: 0x0080, 0x2d7a: 0x0080, 0x2d7b: 0x0080, + 0x2d7c: 0x0080, 0x2d7d: 0x0080, 0x2d7e: 0x0080, 0x2d7f: 0x0080, + // Block 0xb6, offset 0x2d80 + 0x2d80: 0x0080, 0x2d81: 0x0080, 0x2d82: 0x0080, 0x2d83: 0x0080, 0x2d84: 0x0080, 0x2d85: 0x0080, + 0x2d86: 0x0080, 0x2d87: 0x0080, 0x2d88: 0x0080, 0x2d89: 0x0080, 0x2d8a: 0x0080, 0x2d8b: 0x0080, + 0x2d8c: 0x0080, 0x2d8d: 0x0080, 0x2d8e: 0x0080, 0x2d8f: 0x0080, 0x2d90: 0x0080, 0x2d91: 0x0080, + 0x2d92: 0x0080, 0x2d93: 0x0080, 0x2d94: 0x0080, 0x2d95: 0x0080, 0x2d96: 0x0080, 0x2d97: 0x0080, + 0x2d98: 0x0080, 0x2d99: 0x0080, 0x2d9a: 0x0080, 0x2d9b: 0x0080, 0x2d9c: 0x0080, 0x2d9d: 0x0080, + 0x2d9e: 0x0080, 0x2d9f: 0x0080, 0x2da0: 0x0080, 0x2da1: 0x0080, 0x2da2: 0x0080, 0x2da3: 0x0080, + 0x2da4: 0x0080, 0x2da5: 0x0080, 0x2da6: 0x008c, 0x2da7: 0x008c, 0x2da8: 0x008c, 0x2da9: 0x008c, + 0x2daa: 0x008c, 0x2dab: 0x008c, 0x2dac: 0x008c, 0x2dad: 0x008c, 0x2dae: 0x008c, 0x2daf: 0x008c, + 0x2db0: 0x0080, 0x2db1: 0x008c, 0x2db2: 0x008c, 0x2db3: 0x008c, 0x2db4: 0x008c, 0x2db5: 0x008c, + 0x2db6: 0x008c, 0x2db7: 0x008c, 0x2db8: 0x008c, 0x2db9: 0x008c, 0x2dba: 0x008c, 0x2dbb: 0x008c, + 0x2dbc: 0x008c, 0x2dbd: 0x008c, 0x2dbe: 0x008c, 0x2dbf: 0x008c, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x008c, 0x2dc1: 0x008c, 0x2dc2: 0x008c, 0x2dc3: 0x008c, 0x2dc4: 0x008c, 0x2dc5: 0x008c, + 0x2dc6: 0x008c, 0x2dc7: 0x008c, 0x2dc8: 0x008c, 0x2dc9: 0x008c, 0x2dca: 0x008c, 0x2dcb: 0x008c, + 0x2dcc: 0x008c, 0x2dcd: 0x008c, 0x2dce: 0x008c, 0x2dcf: 0x008c, 0x2dd0: 0x008c, 0x2dd1: 0x008c, + 0x2dd2: 0x008c, 0x2dd3: 0x008c, 0x2dd4: 0x008c, 0x2dd5: 0x008c, 0x2dd6: 0x008c, 0x2dd7: 0x008c, + 0x2dd8: 0x008c, 0x2dd9: 0x008c, 0x2dda: 0x008c, 0x2ddb: 0x008c, 0x2ddc: 0x008c, 0x2ddd: 0x008c, + 0x2dde: 0x0080, 0x2ddf: 0x0080, 0x2de0: 0x0040, 0x2de1: 0x0080, 0x2de2: 0x0080, 0x2de3: 0x0080, + 0x2de4: 0x0080, 0x2de5: 0x0080, 0x2de6: 0x0080, 0x2de7: 0x0080, 0x2de8: 0x0080, 0x2de9: 0x0080, + 0x2dea: 0x0080, 0x2deb: 0x0080, 0x2dec: 0x0080, 0x2ded: 0x0080, 0x2dee: 0x0080, 0x2def: 0x0080, + 0x2df0: 0x0080, 0x2df1: 0x0080, 0x2df2: 0x0080, 0x2df3: 0x0080, 0x2df4: 0x0080, 0x2df5: 0x0080, + 0x2df6: 0x0080, 0x2df7: 0x0080, 0x2df8: 0x0080, 0x2df9: 0x0080, 0x2dfa: 0x0080, 0x2dfb: 0x0080, + 0x2dfc: 0x0080, 0x2dfd: 0x0080, 0x2dfe: 0x0080, + // Block 0xb8, offset 0x2e00 + 0x2e02: 0x0080, 0x2e03: 0x0080, 0x2e04: 0x0080, 0x2e05: 0x0080, + 0x2e06: 0x0080, 0x2e07: 0x0080, 0x2e0a: 0x0080, 0x2e0b: 0x0080, + 0x2e0c: 0x0080, 0x2e0d: 0x0080, 0x2e0e: 0x0080, 0x2e0f: 0x0080, + 0x2e12: 0x0080, 0x2e13: 0x0080, 0x2e14: 0x0080, 0x2e15: 0x0080, 0x2e16: 0x0080, 0x2e17: 0x0080, + 0x2e1a: 0x0080, 0x2e1b: 0x0080, 0x2e1c: 0x0080, + 0x2e20: 0x0080, 0x2e21: 0x0080, 0x2e22: 0x0080, 0x2e23: 0x0080, + 0x2e24: 0x0080, 0x2e25: 0x0080, 0x2e26: 0x0080, 0x2e28: 0x0080, 0x2e29: 0x0080, + 0x2e2a: 0x0080, 0x2e2b: 0x0080, 0x2e2c: 0x0080, 0x2e2d: 0x0080, 0x2e2e: 0x0080, + 0x2e39: 0x0040, 0x2e3a: 0x0040, 0x2e3b: 0x0040, + 0x2e3c: 0x0080, 0x2e3d: 0x0080, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x00c0, 0x2e41: 0x00c0, 0x2e42: 0x00c0, 0x2e43: 0x00c0, 0x2e44: 0x00c0, 0x2e45: 0x00c0, + 0x2e46: 0x00c0, 0x2e47: 0x00c0, 0x2e48: 0x00c0, 0x2e49: 0x00c0, 0x2e4a: 0x00c0, 0x2e4b: 0x00c0, + 0x2e4d: 0x00c0, 0x2e4e: 0x00c0, 0x2e4f: 0x00c0, 0x2e50: 0x00c0, 0x2e51: 0x00c0, + 0x2e52: 0x00c0, 0x2e53: 0x00c0, 0x2e54: 0x00c0, 0x2e55: 0x00c0, 0x2e56: 0x00c0, 0x2e57: 0x00c0, + 0x2e58: 0x00c0, 0x2e59: 0x00c0, 0x2e5a: 0x00c0, 0x2e5b: 0x00c0, 0x2e5c: 0x00c0, 0x2e5d: 0x00c0, + 0x2e5e: 0x00c0, 0x2e5f: 0x00c0, 0x2e60: 0x00c0, 0x2e61: 0x00c0, 0x2e62: 0x00c0, 0x2e63: 0x00c0, + 0x2e64: 0x00c0, 0x2e65: 0x00c0, 0x2e66: 0x00c0, 0x2e68: 0x00c0, 0x2e69: 0x00c0, + 0x2e6a: 0x00c0, 0x2e6b: 0x00c0, 0x2e6c: 0x00c0, 0x2e6d: 0x00c0, 0x2e6e: 0x00c0, 0x2e6f: 0x00c0, + 0x2e70: 0x00c0, 0x2e71: 0x00c0, 0x2e72: 0x00c0, 0x2e73: 0x00c0, 0x2e74: 0x00c0, 0x2e75: 0x00c0, + 0x2e76: 0x00c0, 0x2e77: 0x00c0, 0x2e78: 0x00c0, 0x2e79: 0x00c0, 0x2e7a: 0x00c0, + 0x2e7c: 0x00c0, 0x2e7d: 0x00c0, 0x2e7f: 0x00c0, + // Block 0xba, offset 0x2e80 + 0x2e80: 0x00c0, 0x2e81: 0x00c0, 0x2e82: 0x00c0, 0x2e83: 0x00c0, 0x2e84: 0x00c0, 0x2e85: 0x00c0, + 0x2e86: 0x00c0, 0x2e87: 0x00c0, 0x2e88: 0x00c0, 0x2e89: 0x00c0, 0x2e8a: 0x00c0, 0x2e8b: 0x00c0, + 0x2e8c: 0x00c0, 0x2e8d: 0x00c0, 0x2e90: 0x00c0, 0x2e91: 0x00c0, + 0x2e92: 0x00c0, 0x2e93: 0x00c0, 0x2e94: 0x00c0, 0x2e95: 0x00c0, 0x2e96: 0x00c0, 0x2e97: 0x00c0, + 0x2e98: 0x00c0, 0x2e99: 0x00c0, 0x2e9a: 0x00c0, 0x2e9b: 0x00c0, 0x2e9c: 0x00c0, 0x2e9d: 0x00c0, + // Block 0xbb, offset 0x2ec0 + 0x2ec0: 0x00c0, 0x2ec1: 0x00c0, 0x2ec2: 0x00c0, 0x2ec3: 0x00c0, 0x2ec4: 0x00c0, 0x2ec5: 0x00c0, + 0x2ec6: 0x00c0, 0x2ec7: 0x00c0, 0x2ec8: 0x00c0, 0x2ec9: 0x00c0, 0x2eca: 0x00c0, 0x2ecb: 0x00c0, + 0x2ecc: 0x00c0, 0x2ecd: 0x00c0, 0x2ece: 0x00c0, 0x2ecf: 0x00c0, 0x2ed0: 0x00c0, 0x2ed1: 0x00c0, + 0x2ed2: 0x00c0, 0x2ed3: 0x00c0, 0x2ed4: 0x00c0, 0x2ed5: 0x00c0, 0x2ed6: 0x00c0, 0x2ed7: 0x00c0, + 0x2ed8: 0x00c0, 0x2ed9: 0x00c0, 0x2eda: 0x00c0, 0x2edb: 0x00c0, 0x2edc: 0x00c0, 0x2edd: 0x00c0, + 0x2ede: 0x00c0, 0x2edf: 0x00c0, 0x2ee0: 0x00c0, 0x2ee1: 0x00c0, 0x2ee2: 0x00c0, 0x2ee3: 0x00c0, + 0x2ee4: 0x00c0, 0x2ee5: 0x00c0, 0x2ee6: 0x00c0, 0x2ee7: 0x00c0, 0x2ee8: 0x00c0, 0x2ee9: 0x00c0, + 0x2eea: 0x00c0, 0x2eeb: 0x00c0, 0x2eec: 0x00c0, 0x2eed: 0x00c0, 0x2eee: 0x00c0, 0x2eef: 0x00c0, + 0x2ef0: 0x00c0, 0x2ef1: 0x00c0, 0x2ef2: 0x00c0, 0x2ef3: 0x00c0, 0x2ef4: 0x00c0, 0x2ef5: 0x00c0, + 0x2ef6: 0x00c0, 0x2ef7: 0x00c0, 0x2ef8: 0x00c0, 0x2ef9: 0x00c0, 0x2efa: 0x00c0, + // Block 0xbc, offset 0x2f00 + 0x2f00: 0x0080, 0x2f01: 0x0080, 0x2f02: 0x0080, + 0x2f07: 0x0080, 0x2f08: 0x0080, 0x2f09: 0x0080, 0x2f0a: 0x0080, 0x2f0b: 0x0080, + 0x2f0c: 0x0080, 0x2f0d: 0x0080, 0x2f0e: 0x0080, 0x2f0f: 0x0080, 0x2f10: 0x0080, 0x2f11: 0x0080, + 0x2f12: 0x0080, 0x2f13: 0x0080, 0x2f14: 0x0080, 0x2f15: 0x0080, 0x2f16: 0x0080, 0x2f17: 0x0080, + 0x2f18: 0x0080, 0x2f19: 0x0080, 0x2f1a: 0x0080, 0x2f1b: 0x0080, 0x2f1c: 0x0080, 0x2f1d: 0x0080, + 0x2f1e: 0x0080, 0x2f1f: 0x0080, 0x2f20: 0x0080, 0x2f21: 0x0080, 0x2f22: 0x0080, 0x2f23: 0x0080, + 0x2f24: 0x0080, 0x2f25: 0x0080, 0x2f26: 0x0080, 0x2f27: 0x0080, 0x2f28: 0x0080, 0x2f29: 0x0080, + 0x2f2a: 0x0080, 0x2f2b: 0x0080, 0x2f2c: 0x0080, 0x2f2d: 0x0080, 0x2f2e: 0x0080, 0x2f2f: 0x0080, + 0x2f30: 0x0080, 0x2f31: 0x0080, 0x2f32: 0x0080, 0x2f33: 0x0080, + 0x2f37: 0x0080, 0x2f38: 0x0080, 0x2f39: 0x0080, 0x2f3a: 0x0080, 0x2f3b: 0x0080, + 0x2f3c: 0x0080, 0x2f3d: 0x0080, 0x2f3e: 0x0080, 0x2f3f: 0x0080, + // Block 0xbd, offset 0x2f40 + 0x2f40: 0x0088, 0x2f41: 0x0088, 0x2f42: 0x0088, 0x2f43: 0x0088, 0x2f44: 0x0088, 0x2f45: 0x0088, + 0x2f46: 0x0088, 0x2f47: 0x0088, 0x2f48: 0x0088, 0x2f49: 0x0088, 0x2f4a: 0x0088, 0x2f4b: 0x0088, + 0x2f4c: 0x0088, 0x2f4d: 0x0088, 0x2f4e: 0x0088, 0x2f4f: 0x0088, 0x2f50: 0x0088, 0x2f51: 0x0088, + 0x2f52: 0x0088, 0x2f53: 0x0088, 0x2f54: 0x0088, 0x2f55: 0x0088, 0x2f56: 0x0088, 0x2f57: 0x0088, + 0x2f58: 0x0088, 0x2f59: 0x0088, 0x2f5a: 0x0088, 0x2f5b: 0x0088, 0x2f5c: 0x0088, 0x2f5d: 0x0088, + 0x2f5e: 0x0088, 0x2f5f: 0x0088, 0x2f60: 0x0088, 0x2f61: 0x0088, 0x2f62: 0x0088, 0x2f63: 0x0088, + 0x2f64: 0x0088, 0x2f65: 0x0088, 0x2f66: 0x0088, 0x2f67: 0x0088, 0x2f68: 0x0088, 0x2f69: 0x0088, + 0x2f6a: 0x0088, 0x2f6b: 0x0088, 0x2f6c: 0x0088, 0x2f6d: 0x0088, 0x2f6e: 0x0088, 0x2f6f: 0x0088, + 0x2f70: 0x0088, 0x2f71: 0x0088, 0x2f72: 0x0088, 0x2f73: 0x0088, 0x2f74: 0x0088, 0x2f75: 0x0088, + 0x2f76: 0x0088, 0x2f77: 0x0088, 0x2f78: 0x0088, 0x2f79: 0x0088, 0x2f7a: 0x0088, 0x2f7b: 0x0088, + 0x2f7c: 0x0088, 0x2f7d: 0x0088, 0x2f7e: 0x0088, 0x2f7f: 0x0088, + // Block 0xbe, offset 0x2f80 + 0x2f80: 0x0088, 0x2f81: 0x0088, 0x2f82: 0x0088, 0x2f83: 0x0088, 0x2f84: 0x0088, 0x2f85: 0x0088, + 0x2f86: 0x0088, 0x2f87: 0x0088, 0x2f88: 0x0088, 0x2f89: 0x0088, 0x2f8a: 0x0088, 0x2f8b: 0x0088, + 0x2f8c: 0x0088, 0x2f8d: 0x0088, 0x2f8e: 0x0088, 0x2f90: 0x0080, 0x2f91: 0x0080, + 0x2f92: 0x0080, 0x2f93: 0x0080, 0x2f94: 0x0080, 0x2f95: 0x0080, 0x2f96: 0x0080, 0x2f97: 0x0080, + 0x2f98: 0x0080, 0x2f99: 0x0080, 0x2f9a: 0x0080, 0x2f9b: 0x0080, 0x2f9c: 0x0080, + 0x2fa0: 0x0088, + // Block 0xbf, offset 0x2fc0 + 0x2fd0: 0x0080, 0x2fd1: 0x0080, + 0x2fd2: 0x0080, 0x2fd3: 0x0080, 0x2fd4: 0x0080, 0x2fd5: 0x0080, 0x2fd6: 0x0080, 0x2fd7: 0x0080, + 0x2fd8: 0x0080, 0x2fd9: 0x0080, 0x2fda: 0x0080, 0x2fdb: 0x0080, 0x2fdc: 0x0080, 0x2fdd: 0x0080, + 0x2fde: 0x0080, 0x2fdf: 0x0080, 0x2fe0: 0x0080, 0x2fe1: 0x0080, 0x2fe2: 0x0080, 0x2fe3: 0x0080, + 0x2fe4: 0x0080, 0x2fe5: 0x0080, 0x2fe6: 0x0080, 0x2fe7: 0x0080, 0x2fe8: 0x0080, 0x2fe9: 0x0080, + 0x2fea: 0x0080, 0x2feb: 0x0080, 0x2fec: 0x0080, 0x2fed: 0x0080, 0x2fee: 0x0080, 0x2fef: 0x0080, + 0x2ff0: 0x0080, 0x2ff1: 0x0080, 0x2ff2: 0x0080, 0x2ff3: 0x0080, 0x2ff4: 0x0080, 0x2ff5: 0x0080, + 0x2ff6: 0x0080, 0x2ff7: 0x0080, 0x2ff8: 0x0080, 0x2ff9: 0x0080, 0x2ffa: 0x0080, 0x2ffb: 0x0080, + 0x2ffc: 0x0080, 0x2ffd: 0x00c3, + // Block 0xc0, offset 0x3000 + 0x3000: 0x00c0, 0x3001: 0x00c0, 0x3002: 0x00c0, 0x3003: 0x00c0, 0x3004: 0x00c0, 0x3005: 0x00c0, + 0x3006: 0x00c0, 0x3007: 0x00c0, 0x3008: 0x00c0, 0x3009: 0x00c0, 0x300a: 0x00c0, 0x300b: 0x00c0, + 0x300c: 0x00c0, 0x300d: 0x00c0, 0x300e: 0x00c0, 0x300f: 0x00c0, 0x3010: 0x00c0, 0x3011: 0x00c0, + 0x3012: 0x00c0, 0x3013: 0x00c0, 0x3014: 0x00c0, 0x3015: 0x00c0, 0x3016: 0x00c0, 0x3017: 0x00c0, + 0x3018: 0x00c0, 0x3019: 0x00c0, 0x301a: 0x00c0, 0x301b: 0x00c0, 0x301c: 0x00c0, + 0x3020: 0x00c0, 0x3021: 0x00c0, 0x3022: 0x00c0, 0x3023: 0x00c0, + 0x3024: 0x00c0, 0x3025: 0x00c0, 0x3026: 0x00c0, 0x3027: 0x00c0, 0x3028: 0x00c0, 0x3029: 0x00c0, + 0x302a: 0x00c0, 0x302b: 0x00c0, 0x302c: 0x00c0, 0x302d: 0x00c0, 0x302e: 0x00c0, 0x302f: 0x00c0, + 0x3030: 0x00c0, 0x3031: 0x00c0, 0x3032: 0x00c0, 0x3033: 0x00c0, 0x3034: 0x00c0, 0x3035: 0x00c0, + 0x3036: 0x00c0, 0x3037: 0x00c0, 0x3038: 0x00c0, 0x3039: 0x00c0, 0x303a: 0x00c0, 0x303b: 0x00c0, + 0x303c: 0x00c0, 0x303d: 0x00c0, 0x303e: 0x00c0, 0x303f: 0x00c0, + // Block 0xc1, offset 0x3040 + 0x3040: 0x00c0, 0x3041: 0x00c0, 0x3042: 0x00c0, 0x3043: 0x00c0, 0x3044: 0x00c0, 0x3045: 0x00c0, + 0x3046: 0x00c0, 0x3047: 0x00c0, 0x3048: 0x00c0, 0x3049: 0x00c0, 0x304a: 0x00c0, 0x304b: 0x00c0, + 0x304c: 0x00c0, 0x304d: 0x00c0, 0x304e: 0x00c0, 0x304f: 0x00c0, 0x3050: 0x00c0, + 0x3060: 0x00c3, 0x3061: 0x0080, 0x3062: 0x0080, 0x3063: 0x0080, + 0x3064: 0x0080, 0x3065: 0x0080, 0x3066: 0x0080, 0x3067: 0x0080, 0x3068: 0x0080, 0x3069: 0x0080, + 0x306a: 0x0080, 0x306b: 0x0080, 0x306c: 0x0080, 0x306d: 0x0080, 0x306e: 0x0080, 0x306f: 0x0080, + 0x3070: 0x0080, 0x3071: 0x0080, 0x3072: 0x0080, 0x3073: 0x0080, 0x3074: 0x0080, 0x3075: 0x0080, + 0x3076: 0x0080, 0x3077: 0x0080, 0x3078: 0x0080, 0x3079: 0x0080, 0x307a: 0x0080, 0x307b: 0x0080, + // Block 0xc2, offset 0x3080 + 0x3080: 0x00c0, 0x3081: 0x00c0, 0x3082: 0x00c0, 0x3083: 0x00c0, 0x3084: 0x00c0, 0x3085: 0x00c0, + 0x3086: 0x00c0, 0x3087: 0x00c0, 0x3088: 0x00c0, 0x3089: 0x00c0, 0x308a: 0x00c0, 0x308b: 0x00c0, + 0x308c: 0x00c0, 0x308d: 0x00c0, 0x308e: 0x00c0, 0x308f: 0x00c0, 0x3090: 0x00c0, 0x3091: 0x00c0, + 0x3092: 0x00c0, 0x3093: 0x00c0, 0x3094: 0x00c0, 0x3095: 0x00c0, 0x3096: 0x00c0, 0x3097: 0x00c0, + 0x3098: 0x00c0, 0x3099: 0x00c0, 0x309a: 0x00c0, 0x309b: 0x00c0, 0x309c: 0x00c0, 0x309d: 0x00c0, + 0x309e: 0x00c0, 0x309f: 0x00c0, 0x30a0: 0x0080, 0x30a1: 0x0080, 0x30a2: 0x0080, 0x30a3: 0x0080, + 0x30ad: 0x00c0, 0x30ae: 0x00c0, 0x30af: 0x00c0, + 0x30b0: 0x00c0, 0x30b1: 0x00c0, 0x30b2: 0x00c0, 0x30b3: 0x00c0, 0x30b4: 0x00c0, 0x30b5: 0x00c0, + 0x30b6: 0x00c0, 0x30b7: 0x00c0, 0x30b8: 0x00c0, 0x30b9: 0x00c0, 0x30ba: 0x00c0, 0x30bb: 0x00c0, + 0x30bc: 0x00c0, 0x30bd: 0x00c0, 0x30be: 0x00c0, 0x30bf: 0x00c0, + // Block 0xc3, offset 0x30c0 + 0x30c0: 0x00c0, 0x30c1: 0x0080, 0x30c2: 0x00c0, 0x30c3: 0x00c0, 0x30c4: 0x00c0, 0x30c5: 0x00c0, + 0x30c6: 0x00c0, 0x30c7: 0x00c0, 0x30c8: 0x00c0, 0x30c9: 0x00c0, 0x30ca: 0x0080, + 0x30d0: 0x00c0, 0x30d1: 0x00c0, + 0x30d2: 0x00c0, 0x30d3: 0x00c0, 0x30d4: 0x00c0, 0x30d5: 0x00c0, 0x30d6: 0x00c0, 0x30d7: 0x00c0, + 0x30d8: 0x00c0, 0x30d9: 0x00c0, 0x30da: 0x00c0, 0x30db: 0x00c0, 0x30dc: 0x00c0, 0x30dd: 0x00c0, + 0x30de: 0x00c0, 0x30df: 0x00c0, 0x30e0: 0x00c0, 0x30e1: 0x00c0, 0x30e2: 0x00c0, 0x30e3: 0x00c0, + 0x30e4: 0x00c0, 0x30e5: 0x00c0, 0x30e6: 0x00c0, 0x30e7: 0x00c0, 0x30e8: 0x00c0, 0x30e9: 0x00c0, + 0x30ea: 0x00c0, 0x30eb: 0x00c0, 0x30ec: 0x00c0, 0x30ed: 0x00c0, 0x30ee: 0x00c0, 0x30ef: 0x00c0, + 0x30f0: 0x00c0, 0x30f1: 0x00c0, 0x30f2: 0x00c0, 0x30f3: 0x00c0, 0x30f4: 0x00c0, 0x30f5: 0x00c0, + 0x30f6: 0x00c3, 0x30f7: 0x00c3, 0x30f8: 0x00c3, 0x30f9: 0x00c3, 0x30fa: 0x00c3, + // Block 0xc4, offset 0x3100 + 0x3100: 0x00c0, 0x3101: 0x00c0, 0x3102: 0x00c0, 0x3103: 0x00c0, 0x3104: 0x00c0, 0x3105: 0x00c0, + 0x3106: 0x00c0, 0x3107: 0x00c0, 0x3108: 0x00c0, 0x3109: 0x00c0, 0x310a: 0x00c0, 0x310b: 0x00c0, + 0x310c: 0x00c0, 0x310d: 0x00c0, 0x310e: 0x00c0, 0x310f: 0x00c0, 0x3110: 0x00c0, 0x3111: 0x00c0, + 0x3112: 0x00c0, 0x3113: 0x00c0, 0x3114: 0x00c0, 0x3115: 0x00c0, 0x3116: 0x00c0, 0x3117: 0x00c0, + 0x3118: 0x00c0, 0x3119: 0x00c0, 0x311a: 0x00c0, 0x311b: 0x00c0, 0x311c: 0x00c0, 0x311d: 0x00c0, + 0x311f: 0x0080, 0x3120: 0x00c0, 0x3121: 0x00c0, 0x3122: 0x00c0, 0x3123: 0x00c0, + 0x3124: 0x00c0, 0x3125: 0x00c0, 0x3126: 0x00c0, 0x3127: 0x00c0, 0x3128: 0x00c0, 0x3129: 0x00c0, + 0x312a: 0x00c0, 0x312b: 0x00c0, 0x312c: 0x00c0, 0x312d: 0x00c0, 0x312e: 0x00c0, 0x312f: 0x00c0, + 0x3130: 0x00c0, 0x3131: 0x00c0, 0x3132: 0x00c0, 0x3133: 0x00c0, 0x3134: 0x00c0, 0x3135: 0x00c0, + 0x3136: 0x00c0, 0x3137: 0x00c0, 0x3138: 0x00c0, 0x3139: 0x00c0, 0x313a: 0x00c0, 0x313b: 0x00c0, + 0x313c: 0x00c0, 0x313d: 0x00c0, 0x313e: 0x00c0, 0x313f: 0x00c0, + // Block 0xc5, offset 0x3140 + 0x3140: 0x00c0, 0x3141: 0x00c0, 0x3142: 0x00c0, 0x3143: 0x00c0, + 0x3148: 0x00c0, 0x3149: 0x00c0, 0x314a: 0x00c0, 0x314b: 0x00c0, + 0x314c: 0x00c0, 0x314d: 0x00c0, 0x314e: 0x00c0, 0x314f: 0x00c0, 0x3150: 0x0080, 0x3151: 0x0080, + 0x3152: 0x0080, 0x3153: 0x0080, 0x3154: 0x0080, 0x3155: 0x0080, + // Block 0xc6, offset 0x3180 + 0x3180: 0x00c0, 0x3181: 0x00c0, 0x3182: 0x00c0, 0x3183: 0x00c0, 0x3184: 0x00c0, 0x3185: 0x00c0, + 0x3186: 0x00c0, 0x3187: 0x00c0, 0x3188: 0x00c0, 0x3189: 0x00c0, 0x318a: 0x00c0, 0x318b: 0x00c0, + 0x318c: 0x00c0, 0x318d: 0x00c0, 0x318e: 0x00c0, 0x318f: 0x00c0, 0x3190: 0x00c0, 0x3191: 0x00c0, + 0x3192: 0x00c0, 0x3193: 0x00c0, 0x3194: 0x00c0, 0x3195: 0x00c0, 0x3196: 0x00c0, 0x3197: 0x00c0, + 0x3198: 0x00c0, 0x3199: 0x00c0, 0x319a: 0x00c0, 0x319b: 0x00c0, 0x319c: 0x00c0, 0x319d: 0x00c0, + 0x31a0: 0x00c0, 0x31a1: 0x00c0, 0x31a2: 0x00c0, 0x31a3: 0x00c0, + 0x31a4: 0x00c0, 0x31a5: 0x00c0, 0x31a6: 0x00c0, 0x31a7: 0x00c0, 0x31a8: 0x00c0, 0x31a9: 0x00c0, + 0x31b0: 0x00c0, 0x31b1: 0x00c0, 0x31b2: 0x00c0, 0x31b3: 0x00c0, 0x31b4: 0x00c0, 0x31b5: 0x00c0, + 0x31b6: 0x00c0, 0x31b7: 0x00c0, 0x31b8: 0x00c0, 0x31b9: 0x00c0, 0x31ba: 0x00c0, 0x31bb: 0x00c0, + 0x31bc: 0x00c0, 0x31bd: 0x00c0, 0x31be: 0x00c0, 0x31bf: 0x00c0, + // Block 0xc7, offset 0x31c0 + 0x31c0: 0x00c0, 0x31c1: 0x00c0, 0x31c2: 0x00c0, 0x31c3: 0x00c0, 0x31c4: 0x00c0, 0x31c5: 0x00c0, + 0x31c6: 0x00c0, 0x31c7: 0x00c0, 0x31c8: 0x00c0, 0x31c9: 0x00c0, 0x31ca: 0x00c0, 0x31cb: 0x00c0, + 0x31cc: 0x00c0, 0x31cd: 0x00c0, 0x31ce: 0x00c0, 0x31cf: 0x00c0, 0x31d0: 0x00c0, 0x31d1: 0x00c0, + 0x31d2: 0x00c0, 0x31d3: 0x00c0, + 0x31d8: 0x00c0, 0x31d9: 0x00c0, 0x31da: 0x00c0, 0x31db: 0x00c0, 0x31dc: 0x00c0, 0x31dd: 0x00c0, + 0x31de: 0x00c0, 0x31df: 0x00c0, 0x31e0: 0x00c0, 0x31e1: 0x00c0, 0x31e2: 0x00c0, 0x31e3: 0x00c0, + 0x31e4: 0x00c0, 0x31e5: 0x00c0, 0x31e6: 0x00c0, 0x31e7: 0x00c0, 0x31e8: 0x00c0, 0x31e9: 0x00c0, + 0x31ea: 0x00c0, 0x31eb: 0x00c0, 0x31ec: 0x00c0, 0x31ed: 0x00c0, 0x31ee: 0x00c0, 0x31ef: 0x00c0, + 0x31f0: 0x00c0, 0x31f1: 0x00c0, 0x31f2: 0x00c0, 0x31f3: 0x00c0, 0x31f4: 0x00c0, 0x31f5: 0x00c0, + 0x31f6: 0x00c0, 0x31f7: 0x00c0, 0x31f8: 0x00c0, 0x31f9: 0x00c0, 0x31fa: 0x00c0, 0x31fb: 0x00c0, + // Block 0xc8, offset 0x3200 + 0x3200: 0x00c0, 0x3201: 0x00c0, 0x3202: 0x00c0, 0x3203: 0x00c0, 0x3204: 0x00c0, 0x3205: 0x00c0, + 0x3206: 0x00c0, 0x3207: 0x00c0, 0x3208: 0x00c0, 0x3209: 0x00c0, 0x320a: 0x00c0, 0x320b: 0x00c0, + 0x320c: 0x00c0, 0x320d: 0x00c0, 0x320e: 0x00c0, 0x320f: 0x00c0, 0x3210: 0x00c0, 0x3211: 0x00c0, + 0x3212: 0x00c0, 0x3213: 0x00c0, 0x3214: 0x00c0, 0x3215: 0x00c0, 0x3216: 0x00c0, 0x3217: 0x00c0, + 0x3218: 0x00c0, 0x3219: 0x00c0, 0x321a: 0x00c0, 0x321b: 0x00c0, 0x321c: 0x00c0, 0x321d: 0x00c0, + 0x321e: 0x00c0, 0x321f: 0x00c0, 0x3220: 0x00c0, 0x3221: 0x00c0, 0x3222: 0x00c0, 0x3223: 0x00c0, + 0x3224: 0x00c0, 0x3225: 0x00c0, 0x3226: 0x00c0, 0x3227: 0x00c0, + 0x3230: 0x00c0, 0x3231: 0x00c0, 0x3232: 0x00c0, 0x3233: 0x00c0, 0x3234: 0x00c0, 0x3235: 0x00c0, + 0x3236: 0x00c0, 0x3237: 0x00c0, 0x3238: 0x00c0, 0x3239: 0x00c0, 0x323a: 0x00c0, 0x323b: 0x00c0, + 0x323c: 0x00c0, 0x323d: 0x00c0, 0x323e: 0x00c0, 0x323f: 0x00c0, + // Block 0xc9, offset 0x3240 + 0x3240: 0x00c0, 0x3241: 0x00c0, 0x3242: 0x00c0, 0x3243: 0x00c0, 0x3244: 0x00c0, 0x3245: 0x00c0, + 0x3246: 0x00c0, 0x3247: 0x00c0, 0x3248: 0x00c0, 0x3249: 0x00c0, 0x324a: 0x00c0, 0x324b: 0x00c0, + 0x324c: 0x00c0, 0x324d: 0x00c0, 0x324e: 0x00c0, 0x324f: 0x00c0, 0x3250: 0x00c0, 0x3251: 0x00c0, + 0x3252: 0x00c0, 0x3253: 0x00c0, 0x3254: 0x00c0, 0x3255: 0x00c0, 0x3256: 0x00c0, 0x3257: 0x00c0, + 0x3258: 0x00c0, 0x3259: 0x00c0, 0x325a: 0x00c0, 0x325b: 0x00c0, 0x325c: 0x00c0, 0x325d: 0x00c0, + 0x325e: 0x00c0, 0x325f: 0x00c0, 0x3260: 0x00c0, 0x3261: 0x00c0, 0x3262: 0x00c0, 0x3263: 0x00c0, + 0x326f: 0x0080, + 0x3270: 0x00c0, 0x3271: 0x00c0, 0x3272: 0x00c0, 0x3273: 0x00c0, 0x3274: 0x00c0, 0x3275: 0x00c0, + 0x3276: 0x00c0, 0x3277: 0x00c0, 0x3278: 0x00c0, 0x3279: 0x00c0, 0x327a: 0x00c0, + 0x327c: 0x00c0, 0x327d: 0x00c0, 0x327e: 0x00c0, 0x327f: 0x00c0, + // Block 0xca, offset 0x3280 + 0x3280: 0x00c0, 0x3281: 0x00c0, 0x3282: 0x00c0, 0x3283: 0x00c0, 0x3284: 0x00c0, 0x3285: 0x00c0, + 0x3286: 0x00c0, 0x3287: 0x00c0, 0x3288: 0x00c0, 0x3289: 0x00c0, 0x328a: 0x00c0, + 0x328c: 0x00c0, 0x328d: 0x00c0, 0x328e: 0x00c0, 0x328f: 0x00c0, 0x3290: 0x00c0, 0x3291: 0x00c0, + 0x3292: 0x00c0, 0x3294: 0x00c0, 0x3295: 0x00c0, 0x3297: 0x00c0, + 0x3298: 0x00c0, 0x3299: 0x00c0, 0x329a: 0x00c0, 0x329b: 0x00c0, 0x329c: 0x00c0, 0x329d: 0x00c0, + 0x329e: 0x00c0, 0x329f: 0x00c0, 0x32a0: 0x00c0, 0x32a1: 0x00c0, 0x32a3: 0x00c0, + 0x32a4: 0x00c0, 0x32a5: 0x00c0, 0x32a6: 0x00c0, 0x32a7: 0x00c0, 0x32a8: 0x00c0, 0x32a9: 0x00c0, + 0x32aa: 0x00c0, 0x32ab: 0x00c0, 0x32ac: 0x00c0, 0x32ad: 0x00c0, 0x32ae: 0x00c0, 0x32af: 0x00c0, + 0x32b0: 0x00c0, 0x32b1: 0x00c0, 0x32b3: 0x00c0, 0x32b4: 0x00c0, 0x32b5: 0x00c0, + 0x32b6: 0x00c0, 0x32b7: 0x00c0, 0x32b8: 0x00c0, 0x32b9: 0x00c0, 0x32bb: 0x00c0, + 0x32bc: 0x00c0, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x00c0, 0x32c1: 0x00c0, 0x32c2: 0x00c0, 0x32c3: 0x00c0, 0x32c4: 0x00c0, 0x32c5: 0x00c0, + 0x32c6: 0x00c0, 0x32c7: 0x00c0, 0x32c8: 0x00c0, 0x32c9: 0x00c0, 0x32ca: 0x00c0, 0x32cb: 0x00c0, + 0x32cc: 0x00c0, 0x32cd: 0x00c0, 0x32ce: 0x00c0, 0x32cf: 0x00c0, 0x32d0: 0x00c0, 0x32d1: 0x00c0, + 0x32d2: 0x00c0, 0x32d3: 0x00c0, 0x32d4: 0x00c0, 0x32d5: 0x00c0, 0x32d6: 0x00c0, 0x32d7: 0x00c0, + 0x32d8: 0x00c0, 0x32d9: 0x00c0, 0x32da: 0x00c0, 0x32db: 0x00c0, 0x32dc: 0x00c0, 0x32dd: 0x00c0, + 0x32de: 0x00c0, 0x32df: 0x00c0, 0x32e0: 0x00c0, 0x32e1: 0x00c0, 0x32e2: 0x00c0, 0x32e3: 0x00c0, + 0x32e4: 0x00c0, 0x32e5: 0x00c0, 0x32e6: 0x00c0, 0x32e7: 0x00c0, 0x32e8: 0x00c0, 0x32e9: 0x00c0, + 0x32ea: 0x00c0, 0x32eb: 0x00c0, 0x32ec: 0x00c0, 0x32ed: 0x00c0, 0x32ee: 0x00c0, 0x32ef: 0x00c0, + 0x32f0: 0x00c0, 0x32f1: 0x00c0, 0x32f2: 0x00c0, 0x32f3: 0x00c0, 0x32f4: 0x00c0, 0x32f5: 0x00c0, + 0x32f6: 0x00c0, + // Block 0xcc, offset 0x3300 + 0x3300: 0x00c0, 0x3301: 0x00c0, 0x3302: 0x00c0, 0x3303: 0x00c0, 0x3304: 0x00c0, 0x3305: 0x00c0, + 0x3306: 0x00c0, 0x3307: 0x00c0, 0x3308: 0x00c0, 0x3309: 0x00c0, 0x330a: 0x00c0, 0x330b: 0x00c0, + 0x330c: 0x00c0, 0x330d: 0x00c0, 0x330e: 0x00c0, 0x330f: 0x00c0, 0x3310: 0x00c0, 0x3311: 0x00c0, + 0x3312: 0x00c0, 0x3313: 0x00c0, 0x3314: 0x00c0, 0x3315: 0x00c0, + 0x3320: 0x00c0, 0x3321: 0x00c0, 0x3322: 0x00c0, 0x3323: 0x00c0, + 0x3324: 0x00c0, 0x3325: 0x00c0, 0x3326: 0x00c0, 0x3327: 0x00c0, + // Block 0xcd, offset 0x3340 + 0x3340: 0x00c0, 0x3341: 0x0080, 0x3342: 0x0080, 0x3343: 0x0080, 0x3344: 0x0080, 0x3345: 0x0080, + 0x3347: 0x0080, 0x3348: 0x0080, 0x3349: 0x0080, 0x334a: 0x0080, 0x334b: 0x0080, + 0x334c: 0x0080, 0x334d: 0x0080, 0x334e: 0x0080, 0x334f: 0x0080, 0x3350: 0x0080, 0x3351: 0x0080, + 0x3352: 0x0080, 0x3353: 0x0080, 0x3354: 0x0080, 0x3355: 0x0080, 0x3356: 0x0080, 0x3357: 0x0080, + 0x3358: 0x0080, 0x3359: 0x0080, 0x335a: 0x0080, 0x335b: 0x0080, 0x335c: 0x0080, 0x335d: 0x0080, + 0x335e: 0x0080, 0x335f: 0x0080, 0x3360: 0x0080, 0x3361: 0x0080, 0x3362: 0x0080, 0x3363: 0x0080, + 0x3364: 0x0080, 0x3365: 0x0080, 0x3366: 0x0080, 0x3367: 0x0080, 0x3368: 0x0080, 0x3369: 0x0080, + 0x336a: 0x0080, 0x336b: 0x0080, 0x336c: 0x0080, 0x336d: 0x0080, 0x336e: 0x0080, 0x336f: 0x0080, + 0x3370: 0x0080, 0x3372: 0x0080, 0x3373: 0x0080, 0x3374: 0x0080, 0x3375: 0x0080, + 0x3376: 0x0080, 0x3377: 0x0080, 0x3378: 0x0080, 0x3379: 0x0080, 0x337a: 0x0080, + // Block 0xce, offset 0x3380 + 0x3380: 0x00c0, 0x3381: 0x00c0, 0x3382: 0x00c0, 0x3383: 0x00c0, 0x3384: 0x00c0, 0x3385: 0x00c0, + 0x3388: 0x00c0, 0x338a: 0x00c0, 0x338b: 0x00c0, + 0x338c: 0x00c0, 0x338d: 0x00c0, 0x338e: 0x00c0, 0x338f: 0x00c0, 0x3390: 0x00c0, 0x3391: 0x00c0, + 0x3392: 0x00c0, 0x3393: 0x00c0, 0x3394: 0x00c0, 0x3395: 0x00c0, 0x3396: 0x00c0, 0x3397: 0x00c0, + 0x3398: 0x00c0, 0x3399: 0x00c0, 0x339a: 0x00c0, 0x339b: 0x00c0, 0x339c: 0x00c0, 0x339d: 0x00c0, + 0x339e: 0x00c0, 0x339f: 0x00c0, 0x33a0: 0x00c0, 0x33a1: 0x00c0, 0x33a2: 0x00c0, 0x33a3: 0x00c0, + 0x33a4: 0x00c0, 0x33a5: 0x00c0, 0x33a6: 0x00c0, 0x33a7: 0x00c0, 0x33a8: 0x00c0, 0x33a9: 0x00c0, + 0x33aa: 0x00c0, 0x33ab: 0x00c0, 0x33ac: 0x00c0, 0x33ad: 0x00c0, 0x33ae: 0x00c0, 0x33af: 0x00c0, + 0x33b0: 0x00c0, 0x33b1: 0x00c0, 0x33b2: 0x00c0, 0x33b3: 0x00c0, 0x33b4: 0x00c0, 0x33b5: 0x00c0, + 0x33b7: 0x00c0, 0x33b8: 0x00c0, + 0x33bc: 0x00c0, 0x33bf: 0x00c0, + // Block 0xcf, offset 0x33c0 + 0x33c0: 0x00c0, 0x33c1: 0x00c0, 0x33c2: 0x00c0, 0x33c3: 0x00c0, 0x33c4: 0x00c0, 0x33c5: 0x00c0, + 0x33c6: 0x00c0, 0x33c7: 0x00c0, 0x33c8: 0x00c0, 0x33c9: 0x00c0, 0x33ca: 0x00c0, 0x33cb: 0x00c0, + 0x33cc: 0x00c0, 0x33cd: 0x00c0, 0x33ce: 0x00c0, 0x33cf: 0x00c0, 0x33d0: 0x00c0, 0x33d1: 0x00c0, + 0x33d2: 0x00c0, 0x33d3: 0x00c0, 0x33d4: 0x00c0, 0x33d5: 0x00c0, 0x33d7: 0x0080, + 0x33d8: 0x0080, 0x33d9: 0x0080, 0x33da: 0x0080, 0x33db: 0x0080, 0x33dc: 0x0080, 0x33dd: 0x0080, + 0x33de: 0x0080, 0x33df: 0x0080, 0x33e0: 0x00c0, 0x33e1: 0x00c0, 0x33e2: 0x00c0, 0x33e3: 0x00c0, + 0x33e4: 0x00c0, 0x33e5: 0x00c0, 0x33e6: 0x00c0, 0x33e7: 0x00c0, 0x33e8: 0x00c0, 0x33e9: 0x00c0, + 0x33ea: 0x00c0, 0x33eb: 0x00c0, 0x33ec: 0x00c0, 0x33ed: 0x00c0, 0x33ee: 0x00c0, 0x33ef: 0x00c0, + 0x33f0: 0x00c0, 0x33f1: 0x00c0, 0x33f2: 0x00c0, 0x33f3: 0x00c0, 0x33f4: 0x00c0, 0x33f5: 0x00c0, + 0x33f6: 0x00c0, 0x33f7: 0x0080, 0x33f8: 0x0080, 0x33f9: 0x0080, 0x33fa: 0x0080, 0x33fb: 0x0080, + 0x33fc: 0x0080, 0x33fd: 0x0080, 0x33fe: 0x0080, 0x33ff: 0x0080, + // Block 0xd0, offset 0x3400 + 0x3400: 0x00c0, 0x3401: 0x00c0, 0x3402: 0x00c0, 0x3403: 0x00c0, 0x3404: 0x00c0, 0x3405: 0x00c0, + 0x3406: 0x00c0, 0x3407: 0x00c0, 0x3408: 0x00c0, 0x3409: 0x00c0, 0x340a: 0x00c0, 0x340b: 0x00c0, + 0x340c: 0x00c0, 0x340d: 0x00c0, 0x340e: 0x00c0, 0x340f: 0x00c0, 0x3410: 0x00c0, 0x3411: 0x00c0, + 0x3412: 0x00c0, 0x3413: 0x00c0, 0x3414: 0x00c0, 0x3415: 0x00c0, 0x3416: 0x00c0, 0x3417: 0x00c0, + 0x3418: 0x00c0, 0x3419: 0x00c0, 0x341a: 0x00c0, 0x341b: 0x00c0, 0x341c: 0x00c0, 0x341d: 0x00c0, + 0x341e: 0x00c0, + 0x3427: 0x0080, 0x3428: 0x0080, 0x3429: 0x0080, + 0x342a: 0x0080, 0x342b: 0x0080, 0x342c: 0x0080, 0x342d: 0x0080, 0x342e: 0x0080, 0x342f: 0x0080, + // Block 0xd1, offset 0x3440 + 0x3460: 0x00c0, 0x3461: 0x00c0, 0x3462: 0x00c0, 0x3463: 0x00c0, + 0x3464: 0x00c0, 0x3465: 0x00c0, 0x3466: 0x00c0, 0x3467: 0x00c0, 0x3468: 0x00c0, 0x3469: 0x00c0, + 0x346a: 0x00c0, 0x346b: 0x00c0, 0x346c: 0x00c0, 0x346d: 0x00c0, 0x346e: 0x00c0, 0x346f: 0x00c0, + 0x3470: 0x00c0, 0x3471: 0x00c0, 0x3472: 0x00c0, 0x3474: 0x00c0, 0x3475: 0x00c0, + 0x347b: 0x0080, + 0x347c: 0x0080, 0x347d: 0x0080, 0x347e: 0x0080, 0x347f: 0x0080, + // Block 0xd2, offset 0x3480 + 0x3480: 0x00c0, 0x3481: 0x00c0, 0x3482: 0x00c0, 0x3483: 0x00c0, 0x3484: 0x00c0, 0x3485: 0x00c0, + 0x3486: 0x00c0, 0x3487: 0x00c0, 0x3488: 0x00c0, 0x3489: 0x00c0, 0x348a: 0x00c0, 0x348b: 0x00c0, + 0x348c: 0x00c0, 0x348d: 0x00c0, 0x348e: 0x00c0, 0x348f: 0x00c0, 0x3490: 0x00c0, 0x3491: 0x00c0, + 0x3492: 0x00c0, 0x3493: 0x00c0, 0x3494: 0x00c0, 0x3495: 0x00c0, 0x3496: 0x0080, 0x3497: 0x0080, + 0x3498: 0x0080, 0x3499: 0x0080, 0x349a: 0x0080, 0x349b: 0x0080, + 0x349f: 0x0080, 0x34a0: 0x00c0, 0x34a1: 0x00c0, 0x34a2: 0x00c0, 0x34a3: 0x00c0, + 0x34a4: 0x00c0, 0x34a5: 0x00c0, 0x34a6: 0x00c0, 0x34a7: 0x00c0, 0x34a8: 0x00c0, 0x34a9: 0x00c0, + 0x34aa: 0x00c0, 0x34ab: 0x00c0, 0x34ac: 0x00c0, 0x34ad: 0x00c0, 0x34ae: 0x00c0, 0x34af: 0x00c0, + 0x34b0: 0x00c0, 0x34b1: 0x00c0, 0x34b2: 0x00c0, 0x34b3: 0x00c0, 0x34b4: 0x00c0, 0x34b5: 0x00c0, + 0x34b6: 0x00c0, 0x34b7: 0x00c0, 0x34b8: 0x00c0, 0x34b9: 0x00c0, + 0x34bf: 0x0080, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x00c0, 0x34c1: 0x00c0, 0x34c2: 0x00c0, 0x34c3: 0x00c0, 0x34c4: 0x00c0, 0x34c5: 0x00c0, + 0x34c6: 0x00c0, 0x34c7: 0x00c0, 0x34c8: 0x00c0, 0x34c9: 0x00c0, 0x34ca: 0x00c0, 0x34cb: 0x00c0, + 0x34cc: 0x00c0, 0x34cd: 0x00c0, 0x34ce: 0x00c0, 0x34cf: 0x00c0, 0x34d0: 0x00c0, 0x34d1: 0x00c0, + 0x34d2: 0x00c0, 0x34d3: 0x00c0, 0x34d4: 0x00c0, 0x34d5: 0x00c0, 0x34d6: 0x00c0, 0x34d7: 0x00c0, + 0x34d8: 0x00c0, 0x34d9: 0x00c0, 0x34da: 0x00c0, 0x34db: 0x00c0, 0x34dc: 0x00c0, 0x34dd: 0x00c0, + 0x34de: 0x00c0, 0x34df: 0x00c0, 0x34e0: 0x00c0, 0x34e1: 0x00c0, 0x34e2: 0x00c0, 0x34e3: 0x00c0, + 0x34e4: 0x00c0, 0x34e5: 0x00c0, 0x34e6: 0x00c0, 0x34e7: 0x00c0, 0x34e8: 0x00c0, 0x34e9: 0x00c0, + 0x34ea: 0x00c0, 0x34eb: 0x00c0, 0x34ec: 0x00c0, 0x34ed: 0x00c0, 0x34ee: 0x00c0, 0x34ef: 0x00c0, + 0x34f0: 0x00c0, 0x34f1: 0x00c0, 0x34f2: 0x00c0, 0x34f3: 0x00c0, 0x34f4: 0x00c0, 0x34f5: 0x00c0, + 0x34f6: 0x00c0, 0x34f7: 0x00c0, + 0x34fc: 0x0080, 0x34fd: 0x0080, 0x34fe: 0x00c0, 0x34ff: 0x00c0, + // Block 0xd4, offset 0x3500 + 0x3500: 0x00c0, 0x3501: 0x00c3, 0x3502: 0x00c3, 0x3503: 0x00c3, 0x3505: 0x00c3, + 0x3506: 0x00c3, + 0x350c: 0x00c3, 0x350d: 0x00c3, 0x350e: 0x00c3, 0x350f: 0x00c3, 0x3510: 0x00c0, 0x3511: 0x00c0, + 0x3512: 0x00c0, 0x3513: 0x00c0, 0x3515: 0x00c0, 0x3516: 0x00c0, 0x3517: 0x00c0, + 0x3519: 0x00c0, 0x351a: 0x00c0, 0x351b: 0x00c0, 0x351c: 0x00c0, 0x351d: 0x00c0, + 0x351e: 0x00c0, 0x351f: 0x00c0, 0x3520: 0x00c0, 0x3521: 0x00c0, 0x3522: 0x00c0, 0x3523: 0x00c0, + 0x3524: 0x00c0, 0x3525: 0x00c0, 0x3526: 0x00c0, 0x3527: 0x00c0, 0x3528: 0x00c0, 0x3529: 0x00c0, + 0x352a: 0x00c0, 0x352b: 0x00c0, 0x352c: 0x00c0, 0x352d: 0x00c0, 0x352e: 0x00c0, 0x352f: 0x00c0, + 0x3530: 0x00c0, 0x3531: 0x00c0, 0x3532: 0x00c0, 0x3533: 0x00c0, 0x3534: 0x00c0, 0x3535: 0x00c0, + 0x3538: 0x00c3, 0x3539: 0x00c3, 0x353a: 0x00c3, + 0x353f: 0x00c6, + // Block 0xd5, offset 0x3540 + 0x3540: 0x0080, 0x3541: 0x0080, 0x3542: 0x0080, 0x3543: 0x0080, 0x3544: 0x0080, 0x3545: 0x0080, + 0x3546: 0x0080, 0x3547: 0x0080, 0x3548: 0x0080, + 0x3550: 0x0080, 0x3551: 0x0080, + 0x3552: 0x0080, 0x3553: 0x0080, 0x3554: 0x0080, 0x3555: 0x0080, 0x3556: 0x0080, 0x3557: 0x0080, + 0x3558: 0x0080, + 0x3560: 0x00c0, 0x3561: 0x00c0, 0x3562: 0x00c0, 0x3563: 0x00c0, + 0x3564: 0x00c0, 0x3565: 0x00c0, 0x3566: 0x00c0, 0x3567: 0x00c0, 0x3568: 0x00c0, 0x3569: 0x00c0, + 0x356a: 0x00c0, 0x356b: 0x00c0, 0x356c: 0x00c0, 0x356d: 0x00c0, 0x356e: 0x00c0, 0x356f: 0x00c0, + 0x3570: 0x00c0, 0x3571: 0x00c0, 0x3572: 0x00c0, 0x3573: 0x00c0, 0x3574: 0x00c0, 0x3575: 0x00c0, + 0x3576: 0x00c0, 0x3577: 0x00c0, 0x3578: 0x00c0, 0x3579: 0x00c0, 0x357a: 0x00c0, 0x357b: 0x00c0, + 0x357c: 0x00c0, 0x357d: 0x0080, 0x357e: 0x0080, 0x357f: 0x0080, + // Block 0xd6, offset 0x3580 + 0x3580: 0x00c0, 0x3581: 0x00c0, 0x3582: 0x00c0, 0x3583: 0x00c0, 0x3584: 0x00c0, 0x3585: 0x00c0, + 0x3586: 0x00c0, 0x3587: 0x00c0, 0x3588: 0x00c0, 0x3589: 0x00c0, 0x358a: 0x00c0, 0x358b: 0x00c0, + 0x358c: 0x00c0, 0x358d: 0x00c0, 0x358e: 0x00c0, 0x358f: 0x00c0, 0x3590: 0x00c0, 0x3591: 0x00c0, + 0x3592: 0x00c0, 0x3593: 0x00c0, 0x3594: 0x00c0, 0x3595: 0x00c0, 0x3596: 0x00c0, 0x3597: 0x00c0, + 0x3598: 0x00c0, 0x3599: 0x00c0, 0x359a: 0x00c0, 0x359b: 0x00c0, 0x359c: 0x00c0, 0x359d: 0x0080, + 0x359e: 0x0080, 0x359f: 0x0080, + // Block 0xd7, offset 0x35c0 + 0x35c0: 0x00c2, 0x35c1: 0x00c2, 0x35c2: 0x00c2, 0x35c3: 0x00c2, 0x35c4: 0x00c2, 0x35c5: 0x00c4, + 0x35c6: 0x00c0, 0x35c7: 0x00c4, 0x35c8: 0x0080, 0x35c9: 0x00c4, 0x35ca: 0x00c4, 0x35cb: 0x00c0, + 0x35cc: 0x00c0, 0x35cd: 0x00c1, 0x35ce: 0x00c4, 0x35cf: 0x00c4, 0x35d0: 0x00c4, 0x35d1: 0x00c4, + 0x35d2: 0x00c4, 0x35d3: 0x00c2, 0x35d4: 0x00c2, 0x35d5: 0x00c2, 0x35d6: 0x00c2, 0x35d7: 0x00c1, + 0x35d8: 0x00c2, 0x35d9: 0x00c2, 0x35da: 0x00c2, 0x35db: 0x00c2, 0x35dc: 0x00c2, 0x35dd: 0x00c4, + 0x35de: 0x00c2, 0x35df: 0x00c2, 0x35e0: 0x00c2, 0x35e1: 0x00c4, 0x35e2: 0x00c0, 0x35e3: 0x00c0, + 0x35e4: 0x00c4, 0x35e5: 0x00c3, 0x35e6: 0x00c3, + 0x35eb: 0x0082, 0x35ec: 0x0082, 0x35ed: 0x0082, 0x35ee: 0x0082, 0x35ef: 0x0084, + 0x35f0: 0x0080, 0x35f1: 0x0080, 0x35f2: 0x0080, 0x35f3: 0x0080, 0x35f4: 0x0080, 0x35f5: 0x0080, + 0x35f6: 0x0080, + // Block 0xd8, offset 0x3600 + 0x3600: 0x00c0, 0x3601: 0x00c0, 0x3602: 0x00c0, 0x3603: 0x00c0, 0x3604: 0x00c0, 0x3605: 0x00c0, + 0x3606: 0x00c0, 0x3607: 0x00c0, 0x3608: 0x00c0, 0x3609: 0x00c0, 0x360a: 0x00c0, 0x360b: 0x00c0, + 0x360c: 0x00c0, 0x360d: 0x00c0, 0x360e: 0x00c0, 0x360f: 0x00c0, 0x3610: 0x00c0, 0x3611: 0x00c0, + 0x3612: 0x00c0, 0x3613: 0x00c0, 0x3614: 0x00c0, 0x3615: 0x00c0, 0x3616: 0x00c0, 0x3617: 0x00c0, + 0x3618: 0x00c0, 0x3619: 0x00c0, 0x361a: 0x00c0, 0x361b: 0x00c0, 0x361c: 0x00c0, 0x361d: 0x00c0, + 0x361e: 0x00c0, 0x361f: 0x00c0, 0x3620: 0x00c0, 0x3621: 0x00c0, 0x3622: 0x00c0, 0x3623: 0x00c0, + 0x3624: 0x00c0, 0x3625: 0x00c0, 0x3626: 0x00c0, 0x3627: 0x00c0, 0x3628: 0x00c0, 0x3629: 0x00c0, + 0x362a: 0x00c0, 0x362b: 0x00c0, 0x362c: 0x00c0, 0x362d: 0x00c0, 0x362e: 0x00c0, 0x362f: 0x00c0, + 0x3630: 0x00c0, 0x3631: 0x00c0, 0x3632: 0x00c0, 0x3633: 0x00c0, 0x3634: 0x00c0, 0x3635: 0x00c0, + 0x3639: 0x0080, 0x363a: 0x0080, 0x363b: 0x0080, + 0x363c: 0x0080, 0x363d: 0x0080, 0x363e: 0x0080, 0x363f: 0x0080, + // Block 0xd9, offset 0x3640 + 0x3640: 0x00c0, 0x3641: 0x00c0, 0x3642: 0x00c0, 0x3643: 0x00c0, 0x3644: 0x00c0, 0x3645: 0x00c0, + 0x3646: 0x00c0, 0x3647: 0x00c0, 0x3648: 0x00c0, 0x3649: 0x00c0, 0x364a: 0x00c0, 0x364b: 0x00c0, + 0x364c: 0x00c0, 0x364d: 0x00c0, 0x364e: 0x00c0, 0x364f: 0x00c0, 0x3650: 0x00c0, 0x3651: 0x00c0, + 0x3652: 0x00c0, 0x3653: 0x00c0, 0x3654: 0x00c0, 0x3655: 0x00c0, + 0x3658: 0x0080, 0x3659: 0x0080, 0x365a: 0x0080, 0x365b: 0x0080, 0x365c: 0x0080, 0x365d: 0x0080, + 0x365e: 0x0080, 0x365f: 0x0080, 0x3660: 0x00c0, 0x3661: 0x00c0, 0x3662: 0x00c0, 0x3663: 0x00c0, + 0x3664: 0x00c0, 0x3665: 0x00c0, 0x3666: 0x00c0, 0x3667: 0x00c0, 0x3668: 0x00c0, 0x3669: 0x00c0, + 0x366a: 0x00c0, 0x366b: 0x00c0, 0x366c: 0x00c0, 0x366d: 0x00c0, 0x366e: 0x00c0, 0x366f: 0x00c0, + 0x3670: 0x00c0, 0x3671: 0x00c0, 0x3672: 0x00c0, + 0x3678: 0x0080, 0x3679: 0x0080, 0x367a: 0x0080, 0x367b: 0x0080, + 0x367c: 0x0080, 0x367d: 0x0080, 0x367e: 0x0080, 0x367f: 0x0080, + // Block 0xda, offset 0x3680 + 0x3680: 0x00c2, 0x3681: 0x00c4, 0x3682: 0x00c2, 0x3683: 0x00c4, 0x3684: 0x00c4, 0x3685: 0x00c4, + 0x3686: 0x00c2, 0x3687: 0x00c2, 0x3688: 0x00c2, 0x3689: 0x00c4, 0x368a: 0x00c2, 0x368b: 0x00c2, + 0x368c: 0x00c4, 0x368d: 0x00c2, 0x368e: 0x00c4, 0x368f: 0x00c4, 0x3690: 0x00c2, 0x3691: 0x00c4, + 0x3699: 0x0080, 0x369a: 0x0080, 0x369b: 0x0080, 0x369c: 0x0080, + 0x36a9: 0x0084, + 0x36aa: 0x0084, 0x36ab: 0x0084, 0x36ac: 0x0084, 0x36ad: 0x0082, 0x36ae: 0x0082, 0x36af: 0x0080, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x00c0, 0x36c1: 0x00c0, 0x36c2: 0x00c0, 0x36c3: 0x00c0, 0x36c4: 0x00c0, 0x36c5: 0x00c0, + 0x36c6: 0x00c0, 0x36c7: 0x00c0, 0x36c8: 0x00c0, + // Block 0xdc, offset 0x3700 + 0x3700: 0x00c0, 0x3701: 0x00c0, 0x3702: 0x00c0, 0x3703: 0x00c0, 0x3704: 0x00c0, 0x3705: 0x00c0, + 0x3706: 0x00c0, 0x3707: 0x00c0, 0x3708: 0x00c0, 0x3709: 0x00c0, 0x370a: 0x00c0, 0x370b: 0x00c0, + 0x370c: 0x00c0, 0x370d: 0x00c0, 0x370e: 0x00c0, 0x370f: 0x00c0, 0x3710: 0x00c0, 0x3711: 0x00c0, + 0x3712: 0x00c0, 0x3713: 0x00c0, 0x3714: 0x00c0, 0x3715: 0x00c0, 0x3716: 0x00c0, 0x3717: 0x00c0, + 0x3718: 0x00c0, 0x3719: 0x00c0, 0x371a: 0x00c0, 0x371b: 0x00c0, 0x371c: 0x00c0, 0x371d: 0x00c0, + 0x371e: 0x00c0, 0x371f: 0x00c0, 0x3720: 0x00c0, 0x3721: 0x00c0, 0x3722: 0x00c0, 0x3723: 0x00c0, + 0x3724: 0x00c0, 0x3725: 0x00c0, 0x3726: 0x00c0, 0x3727: 0x00c0, 0x3728: 0x00c0, 0x3729: 0x00c0, + 0x372a: 0x00c0, 0x372b: 0x00c0, 0x372c: 0x00c0, 0x372d: 0x00c0, 0x372e: 0x00c0, 0x372f: 0x00c0, + 0x3730: 0x00c0, 0x3731: 0x00c0, 0x3732: 0x00c0, + // Block 0xdd, offset 0x3740 + 0x3740: 0x00c0, 0x3741: 0x00c0, 0x3742: 0x00c0, 0x3743: 0x00c0, 0x3744: 0x00c0, 0x3745: 0x00c0, + 0x3746: 0x00c0, 0x3747: 0x00c0, 0x3748: 0x00c0, 0x3749: 0x00c0, 0x374a: 0x00c0, 0x374b: 0x00c0, + 0x374c: 0x00c0, 0x374d: 0x00c0, 0x374e: 0x00c0, 0x374f: 0x00c0, 0x3750: 0x00c0, 0x3751: 0x00c0, + 0x3752: 0x00c0, 0x3753: 0x00c0, 0x3754: 0x00c0, 0x3755: 0x00c0, 0x3756: 0x00c0, 0x3757: 0x00c0, + 0x3758: 0x00c0, 0x3759: 0x00c0, 0x375a: 0x00c0, 0x375b: 0x00c0, 0x375c: 0x00c0, 0x375d: 0x00c0, + 0x375e: 0x00c0, 0x375f: 0x00c0, 0x3760: 0x00c0, 0x3761: 0x00c0, 0x3762: 0x00c0, 0x3763: 0x00c0, + 0x3764: 0x00c0, 0x3765: 0x00c0, 0x3766: 0x00c0, 0x3767: 0x00c0, 0x3768: 0x00c0, 0x3769: 0x00c0, + 0x376a: 0x00c0, 0x376b: 0x00c0, 0x376c: 0x00c0, 0x376d: 0x00c0, 0x376e: 0x00c0, 0x376f: 0x00c0, + 0x3770: 0x00c0, 0x3771: 0x00c0, 0x3772: 0x00c0, + 0x377a: 0x0080, 0x377b: 0x0080, + 0x377c: 0x0080, 0x377d: 0x0080, 0x377e: 0x0080, 0x377f: 0x0080, + // Block 0xde, offset 0x3780 + 0x3780: 0x00c1, 0x3781: 0x00c2, 0x3782: 0x00c2, 0x3783: 0x00c2, 0x3784: 0x00c2, 0x3785: 0x00c2, + 0x3786: 0x00c2, 0x3787: 0x00c2, 0x3788: 0x00c2, 0x3789: 0x00c2, 0x378a: 0x00c2, 0x378b: 0x00c2, + 0x378c: 0x00c2, 0x378d: 0x00c2, 0x378e: 0x00c2, 0x378f: 0x00c2, 0x3790: 0x00c2, 0x3791: 0x00c2, + 0x3792: 0x00c2, 0x3793: 0x00c2, 0x3794: 0x00c2, 0x3795: 0x00c2, 0x3796: 0x00c2, 0x3797: 0x00c2, + 0x3798: 0x00c2, 0x3799: 0x00c2, 0x379a: 0x00c2, 0x379b: 0x00c2, 0x379c: 0x00c2, 0x379d: 0x00c2, + 0x379e: 0x00c2, 0x379f: 0x00c2, 0x37a0: 0x00c2, 0x37a1: 0x00c2, 0x37a2: 0x00c4, 0x37a3: 0x00c2, + 0x37a4: 0x00c3, 0x37a5: 0x00c3, 0x37a6: 0x00c3, 0x37a7: 0x00c3, + 0x37b0: 0x00c0, 0x37b1: 0x00c0, 0x37b2: 0x00c0, 0x37b3: 0x00c0, 0x37b4: 0x00c0, 0x37b5: 0x00c0, + 0x37b6: 0x00c0, 0x37b7: 0x00c0, 0x37b8: 0x00c0, 0x37b9: 0x00c0, + // Block 0xdf, offset 0x37c0 + 0x37e0: 0x0080, 0x37e1: 0x0080, 0x37e2: 0x0080, 0x37e3: 0x0080, + 0x37e4: 0x0080, 0x37e5: 0x0080, 0x37e6: 0x0080, 0x37e7: 0x0080, 0x37e8: 0x0080, 0x37e9: 0x0080, + 0x37ea: 0x0080, 0x37eb: 0x0080, 0x37ec: 0x0080, 0x37ed: 0x0080, 0x37ee: 0x0080, 0x37ef: 0x0080, + 0x37f0: 0x0080, 0x37f1: 0x0080, 0x37f2: 0x0080, 0x37f3: 0x0080, 0x37f4: 0x0080, 0x37f5: 0x0080, + 0x37f6: 0x0080, 0x37f7: 0x0080, 0x37f8: 0x0080, 0x37f9: 0x0080, 0x37fa: 0x0080, 0x37fb: 0x0080, + 0x37fc: 0x0080, 0x37fd: 0x0080, 0x37fe: 0x0080, + // Block 0xe0, offset 0x3800 + 0x3800: 0x00c0, 0x3801: 0x00c0, 0x3802: 0x00c0, 0x3803: 0x00c0, 0x3804: 0x00c0, 0x3805: 0x00c0, + 0x3806: 0x00c0, 0x3807: 0x00c0, 0x3808: 0x00c0, 0x3809: 0x00c0, 0x380a: 0x00c0, 0x380b: 0x00c0, + 0x380c: 0x00c0, 0x380d: 0x00c0, 0x380e: 0x00c0, 0x380f: 0x00c0, 0x3810: 0x00c0, 0x3811: 0x00c0, + 0x3812: 0x00c0, 0x3813: 0x00c0, 0x3814: 0x00c0, 0x3815: 0x00c0, 0x3816: 0x00c0, 0x3817: 0x00c0, + 0x3818: 0x00c0, 0x3819: 0x00c0, 0x381a: 0x00c0, 0x381b: 0x00c0, 0x381c: 0x00c0, 0x381d: 0x00c0, + 0x381e: 0x00c0, 0x381f: 0x00c0, 0x3820: 0x00c0, 0x3821: 0x00c0, 0x3822: 0x00c0, 0x3823: 0x00c0, + 0x3824: 0x00c0, 0x3825: 0x00c0, 0x3826: 0x00c0, 0x3827: 0x00c0, 0x3828: 0x00c0, 0x3829: 0x00c0, + 0x382b: 0x00c3, 0x382c: 0x00c3, 0x382d: 0x0080, + 0x3830: 0x00c0, 0x3831: 0x00c0, + // Block 0xe1, offset 0x3840 + 0x387d: 0x00c3, 0x387e: 0x00c3, 0x387f: 0x00c3, + // Block 0xe2, offset 0x3880 + 0x3880: 0x00c0, 0x3881: 0x00c0, 0x3882: 0x00c0, 0x3883: 0x00c0, 0x3884: 0x00c0, 0x3885: 0x00c0, + 0x3886: 0x00c0, 0x3887: 0x00c0, 0x3888: 0x00c0, 0x3889: 0x00c0, 0x388a: 0x00c0, 0x388b: 0x00c0, + 0x388c: 0x00c0, 0x388d: 0x00c0, 0x388e: 0x00c0, 0x388f: 0x00c0, 0x3890: 0x00c0, 0x3891: 0x00c0, + 0x3892: 0x00c0, 0x3893: 0x00c0, 0x3894: 0x00c0, 0x3895: 0x00c0, 0x3896: 0x00c0, 0x3897: 0x00c0, + 0x3898: 0x00c0, 0x3899: 0x00c0, 0x389a: 0x00c0, 0x389b: 0x00c0, 0x389c: 0x00c0, 0x389d: 0x0080, + 0x389e: 0x0080, 0x389f: 0x0080, 0x38a0: 0x0080, 0x38a1: 0x0080, 0x38a2: 0x0080, 0x38a3: 0x0080, + 0x38a4: 0x0080, 0x38a5: 0x0080, 0x38a6: 0x0080, 0x38a7: 0x00c0, + 0x38b0: 0x00c2, 0x38b1: 0x00c2, 0x38b2: 0x00c2, 0x38b3: 0x00c4, 0x38b4: 0x00c2, 0x38b5: 0x00c2, + 0x38b6: 0x00c2, 0x38b7: 0x00c2, 0x38b8: 0x00c2, 0x38b9: 0x00c2, 0x38ba: 0x00c2, 0x38bb: 0x00c2, + 0x38bc: 0x00c2, 0x38bd: 0x00c2, 0x38be: 0x00c2, 0x38bf: 0x00c2, + // Block 0xe3, offset 0x38c0 + 0x38c0: 0x00c2, 0x38c1: 0x00c2, 0x38c2: 0x00c2, 0x38c3: 0x00c2, 0x38c4: 0x00c2, 0x38c5: 0x00c0, + 0x38c6: 0x00c3, 0x38c7: 0x00c3, 0x38c8: 0x00c3, 0x38c9: 0x00c3, 0x38ca: 0x00c3, 0x38cb: 0x00c3, + 0x38cc: 0x00c3, 0x38cd: 0x00c3, 0x38ce: 0x00c3, 0x38cf: 0x00c3, 0x38d0: 0x00c3, 0x38d1: 0x0082, + 0x38d2: 0x0082, 0x38d3: 0x0082, 0x38d4: 0x0084, 0x38d5: 0x0080, 0x38d6: 0x0080, 0x38d7: 0x0080, + 0x38d8: 0x0080, 0x38d9: 0x0080, + 0x38f0: 0x00c2, 0x38f1: 0x00c2, 0x38f2: 0x00c2, 0x38f3: 0x00c2, 0x38f4: 0x00c4, 0x38f5: 0x00c4, + 0x38f6: 0x00c2, 0x38f7: 0x00c2, 0x38f8: 0x00c2, 0x38f9: 0x00c2, 0x38fa: 0x00c2, 0x38fb: 0x00c2, + 0x38fc: 0x00c2, 0x38fd: 0x00c2, 0x38fe: 0x00c2, 0x38ff: 0x00c2, + // Block 0xe4, offset 0x3900 + 0x3900: 0x00c2, 0x3901: 0x00c2, 0x3902: 0x00c3, 0x3903: 0x00c3, 0x3904: 0x00c3, 0x3905: 0x00c3, + 0x3906: 0x0080, 0x3907: 0x0080, 0x3908: 0x0080, 0x3909: 0x0080, + 0x3930: 0x00c2, 0x3931: 0x00c0, 0x3932: 0x00c2, 0x3933: 0x00c2, 0x3934: 0x00c4, 0x3935: 0x00c4, + 0x3936: 0x00c4, 0x3937: 0x00c0, 0x3938: 0x00c2, 0x3939: 0x00c4, 0x393a: 0x00c4, 0x393b: 0x00c2, + 0x393c: 0x00c2, 0x393d: 0x00c4, 0x393e: 0x00c2, 0x393f: 0x00c2, + // Block 0xe5, offset 0x3940 + 0x3940: 0x00c0, 0x3941: 0x00c2, 0x3942: 0x00c4, 0x3943: 0x00c4, 0x3944: 0x00c2, 0x3945: 0x0080, + 0x3946: 0x0080, 0x3947: 0x0080, 0x3948: 0x0080, 0x3949: 0x0084, 0x394a: 0x0082, 0x394b: 0x0081, + 0x3960: 0x00c0, 0x3961: 0x00c0, 0x3962: 0x00c0, 0x3963: 0x00c0, + 0x3964: 0x00c0, 0x3965: 0x00c0, 0x3966: 0x00c0, 0x3967: 0x00c0, 0x3968: 0x00c0, 0x3969: 0x00c0, + 0x396a: 0x00c0, 0x396b: 0x00c0, 0x396c: 0x00c0, 0x396d: 0x00c0, 0x396e: 0x00c0, 0x396f: 0x00c0, + 0x3970: 0x00c0, 0x3971: 0x00c0, 0x3972: 0x00c0, 0x3973: 0x00c0, 0x3974: 0x00c0, 0x3975: 0x00c0, + 0x3976: 0x00c0, + // Block 0xe6, offset 0x3980 + 0x3980: 0x00c0, 0x3981: 0x00c3, 0x3982: 0x00c0, 0x3983: 0x00c0, 0x3984: 0x00c0, 0x3985: 0x00c0, + 0x3986: 0x00c0, 0x3987: 0x00c0, 0x3988: 0x00c0, 0x3989: 0x00c0, 0x398a: 0x00c0, 0x398b: 0x00c0, + 0x398c: 0x00c0, 0x398d: 0x00c0, 0x398e: 0x00c0, 0x398f: 0x00c0, 0x3990: 0x00c0, 0x3991: 0x00c0, + 0x3992: 0x00c0, 0x3993: 0x00c0, 0x3994: 0x00c0, 0x3995: 0x00c0, 0x3996: 0x00c0, 0x3997: 0x00c0, + 0x3998: 0x00c0, 0x3999: 0x00c0, 0x399a: 0x00c0, 0x399b: 0x00c0, 0x399c: 0x00c0, 0x399d: 0x00c0, + 0x399e: 0x00c0, 0x399f: 0x00c0, 0x39a0: 0x00c0, 0x39a1: 0x00c0, 0x39a2: 0x00c0, 0x39a3: 0x00c0, + 0x39a4: 0x00c0, 0x39a5: 0x00c0, 0x39a6: 0x00c0, 0x39a7: 0x00c0, 0x39a8: 0x00c0, 0x39a9: 0x00c0, + 0x39aa: 0x00c0, 0x39ab: 0x00c0, 0x39ac: 0x00c0, 0x39ad: 0x00c0, 0x39ae: 0x00c0, 0x39af: 0x00c0, + 0x39b0: 0x00c0, 0x39b1: 0x00c0, 0x39b2: 0x00c0, 0x39b3: 0x00c0, 0x39b4: 0x00c0, 0x39b5: 0x00c0, + 0x39b6: 0x00c0, 0x39b7: 0x00c0, 0x39b8: 0x00c3, 0x39b9: 0x00c3, 0x39ba: 0x00c3, 0x39bb: 0x00c3, + 0x39bc: 0x00c3, 0x39bd: 0x00c3, 0x39be: 0x00c3, 0x39bf: 0x00c3, + // Block 0xe7, offset 0x39c0 + 0x39c0: 0x00c3, 0x39c1: 0x00c3, 0x39c2: 0x00c3, 0x39c3: 0x00c3, 0x39c4: 0x00c3, 0x39c5: 0x00c3, + 0x39c6: 0x00c6, 0x39c7: 0x0080, 0x39c8: 0x0080, 0x39c9: 0x0080, 0x39ca: 0x0080, 0x39cb: 0x0080, + 0x39cc: 0x0080, 0x39cd: 0x0080, + 0x39d2: 0x0080, 0x39d3: 0x0080, 0x39d4: 0x0080, 0x39d5: 0x0080, 0x39d6: 0x0080, 0x39d7: 0x0080, + 0x39d8: 0x0080, 0x39d9: 0x0080, 0x39da: 0x0080, 0x39db: 0x0080, 0x39dc: 0x0080, 0x39dd: 0x0080, + 0x39de: 0x0080, 0x39df: 0x0080, 0x39e0: 0x0080, 0x39e1: 0x0080, 0x39e2: 0x0080, 0x39e3: 0x0080, + 0x39e4: 0x0080, 0x39e5: 0x0080, 0x39e6: 0x00c0, 0x39e7: 0x00c0, 0x39e8: 0x00c0, 0x39e9: 0x00c0, + 0x39ea: 0x00c0, 0x39eb: 0x00c0, 0x39ec: 0x00c0, 0x39ed: 0x00c0, 0x39ee: 0x00c0, 0x39ef: 0x00c0, + 0x39f0: 0x00c6, 0x39f1: 0x00c0, 0x39f2: 0x00c0, 0x39f3: 0x00c3, 0x39f4: 0x00c3, 0x39f5: 0x00c0, + 0x39ff: 0x00c6, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x00c3, 0x3a01: 0x00c3, 0x3a02: 0x00c0, 0x3a03: 0x00c0, 0x3a04: 0x00c0, 0x3a05: 0x00c0, + 0x3a06: 0x00c0, 0x3a07: 0x00c0, 0x3a08: 0x00c0, 0x3a09: 0x00c0, 0x3a0a: 0x00c0, 0x3a0b: 0x00c0, + 0x3a0c: 0x00c0, 0x3a0d: 0x00c0, 0x3a0e: 0x00c0, 0x3a0f: 0x00c0, 0x3a10: 0x00c0, 0x3a11: 0x00c0, + 0x3a12: 0x00c0, 0x3a13: 0x00c0, 0x3a14: 0x00c0, 0x3a15: 0x00c0, 0x3a16: 0x00c0, 0x3a17: 0x00c0, + 0x3a18: 0x00c0, 0x3a19: 0x00c0, 0x3a1a: 0x00c0, 0x3a1b: 0x00c0, 0x3a1c: 0x00c0, 0x3a1d: 0x00c0, + 0x3a1e: 0x00c0, 0x3a1f: 0x00c0, 0x3a20: 0x00c0, 0x3a21: 0x00c0, 0x3a22: 0x00c0, 0x3a23: 0x00c0, + 0x3a24: 0x00c0, 0x3a25: 0x00c0, 0x3a26: 0x00c0, 0x3a27: 0x00c0, 0x3a28: 0x00c0, 0x3a29: 0x00c0, + 0x3a2a: 0x00c0, 0x3a2b: 0x00c0, 0x3a2c: 0x00c0, 0x3a2d: 0x00c0, 0x3a2e: 0x00c0, 0x3a2f: 0x00c0, + 0x3a30: 0x00c0, 0x3a31: 0x00c0, 0x3a32: 0x00c0, 0x3a33: 0x00c3, 0x3a34: 0x00c3, 0x3a35: 0x00c3, + 0x3a36: 0x00c3, 0x3a37: 0x00c0, 0x3a38: 0x00c0, 0x3a39: 0x00c6, 0x3a3a: 0x00c3, 0x3a3b: 0x0080, + 0x3a3c: 0x0080, 0x3a3d: 0x0040, 0x3a3e: 0x0080, 0x3a3f: 0x0080, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x0080, 0x3a41: 0x0080, 0x3a42: 0x00c3, + 0x3a4d: 0x0040, 0x3a50: 0x00c0, 0x3a51: 0x00c0, + 0x3a52: 0x00c0, 0x3a53: 0x00c0, 0x3a54: 0x00c0, 0x3a55: 0x00c0, 0x3a56: 0x00c0, 0x3a57: 0x00c0, + 0x3a58: 0x00c0, 0x3a59: 0x00c0, 0x3a5a: 0x00c0, 0x3a5b: 0x00c0, 0x3a5c: 0x00c0, 0x3a5d: 0x00c0, + 0x3a5e: 0x00c0, 0x3a5f: 0x00c0, 0x3a60: 0x00c0, 0x3a61: 0x00c0, 0x3a62: 0x00c0, 0x3a63: 0x00c0, + 0x3a64: 0x00c0, 0x3a65: 0x00c0, 0x3a66: 0x00c0, 0x3a67: 0x00c0, 0x3a68: 0x00c0, + 0x3a70: 0x00c0, 0x3a71: 0x00c0, 0x3a72: 0x00c0, 0x3a73: 0x00c0, 0x3a74: 0x00c0, 0x3a75: 0x00c0, + 0x3a76: 0x00c0, 0x3a77: 0x00c0, 0x3a78: 0x00c0, 0x3a79: 0x00c0, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x00c3, 0x3a81: 0x00c3, 0x3a82: 0x00c3, 0x3a83: 0x00c0, 0x3a84: 0x00c0, 0x3a85: 0x00c0, + 0x3a86: 0x00c0, 0x3a87: 0x00c0, 0x3a88: 0x00c0, 0x3a89: 0x00c0, 0x3a8a: 0x00c0, 0x3a8b: 0x00c0, + 0x3a8c: 0x00c0, 0x3a8d: 0x00c0, 0x3a8e: 0x00c0, 0x3a8f: 0x00c0, 0x3a90: 0x00c0, 0x3a91: 0x00c0, + 0x3a92: 0x00c0, 0x3a93: 0x00c0, 0x3a94: 0x00c0, 0x3a95: 0x00c0, 0x3a96: 0x00c0, 0x3a97: 0x00c0, + 0x3a98: 0x00c0, 0x3a99: 0x00c0, 0x3a9a: 0x00c0, 0x3a9b: 0x00c0, 0x3a9c: 0x00c0, 0x3a9d: 0x00c0, + 0x3a9e: 0x00c0, 0x3a9f: 0x00c0, 0x3aa0: 0x00c0, 0x3aa1: 0x00c0, 0x3aa2: 0x00c0, 0x3aa3: 0x00c0, + 0x3aa4: 0x00c0, 0x3aa5: 0x00c0, 0x3aa6: 0x00c0, 0x3aa7: 0x00c3, 0x3aa8: 0x00c3, 0x3aa9: 0x00c3, + 0x3aaa: 0x00c3, 0x3aab: 0x00c3, 0x3aac: 0x00c0, 0x3aad: 0x00c3, 0x3aae: 0x00c3, 0x3aaf: 0x00c3, + 0x3ab0: 0x00c3, 0x3ab1: 0x00c3, 0x3ab2: 0x00c3, 0x3ab3: 0x00c6, 0x3ab4: 0x00c6, + 0x3ab6: 0x00c0, 0x3ab7: 0x00c0, 0x3ab8: 0x00c0, 0x3ab9: 0x00c0, 0x3aba: 0x00c0, 0x3abb: 0x00c0, + 0x3abc: 0x00c0, 0x3abd: 0x00c0, 0x3abe: 0x00c0, 0x3abf: 0x00c0, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x0080, 0x3ac1: 0x0080, 0x3ac2: 0x0080, 0x3ac3: 0x0080, 0x3ac4: 0x00c0, 0x3ac5: 0x00c0, + 0x3ac6: 0x00c0, 0x3ac7: 0x00c0, + 0x3ad0: 0x00c0, 0x3ad1: 0x00c0, + 0x3ad2: 0x00c0, 0x3ad3: 0x00c0, 0x3ad4: 0x00c0, 0x3ad5: 0x00c0, 0x3ad6: 0x00c0, 0x3ad7: 0x00c0, + 0x3ad8: 0x00c0, 0x3ad9: 0x00c0, 0x3ada: 0x00c0, 0x3adb: 0x00c0, 0x3adc: 0x00c0, 0x3add: 0x00c0, + 0x3ade: 0x00c0, 0x3adf: 0x00c0, 0x3ae0: 0x00c0, 0x3ae1: 0x00c0, 0x3ae2: 0x00c0, 0x3ae3: 0x00c0, + 0x3ae4: 0x00c0, 0x3ae5: 0x00c0, 0x3ae6: 0x00c0, 0x3ae7: 0x00c0, 0x3ae8: 0x00c0, 0x3ae9: 0x00c0, + 0x3aea: 0x00c0, 0x3aeb: 0x00c0, 0x3aec: 0x00c0, 0x3aed: 0x00c0, 0x3aee: 0x00c0, 0x3aef: 0x00c0, + 0x3af0: 0x00c0, 0x3af1: 0x00c0, 0x3af2: 0x00c0, 0x3af3: 0x00c3, 0x3af4: 0x0080, 0x3af5: 0x0080, + 0x3af6: 0x00c0, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x00c3, 0x3b01: 0x00c3, 0x3b02: 0x00c0, 0x3b03: 0x00c0, 0x3b04: 0x00c0, 0x3b05: 0x00c0, + 0x3b06: 0x00c0, 0x3b07: 0x00c0, 0x3b08: 0x00c0, 0x3b09: 0x00c0, 0x3b0a: 0x00c0, 0x3b0b: 0x00c0, + 0x3b0c: 0x00c0, 0x3b0d: 0x00c0, 0x3b0e: 0x00c0, 0x3b0f: 0x00c0, 0x3b10: 0x00c0, 0x3b11: 0x00c0, + 0x3b12: 0x00c0, 0x3b13: 0x00c0, 0x3b14: 0x00c0, 0x3b15: 0x00c0, 0x3b16: 0x00c0, 0x3b17: 0x00c0, + 0x3b18: 0x00c0, 0x3b19: 0x00c0, 0x3b1a: 0x00c0, 0x3b1b: 0x00c0, 0x3b1c: 0x00c0, 0x3b1d: 0x00c0, + 0x3b1e: 0x00c0, 0x3b1f: 0x00c0, 0x3b20: 0x00c0, 0x3b21: 0x00c0, 0x3b22: 0x00c0, 0x3b23: 0x00c0, + 0x3b24: 0x00c0, 0x3b25: 0x00c0, 0x3b26: 0x00c0, 0x3b27: 0x00c0, 0x3b28: 0x00c0, 0x3b29: 0x00c0, + 0x3b2a: 0x00c0, 0x3b2b: 0x00c0, 0x3b2c: 0x00c0, 0x3b2d: 0x00c0, 0x3b2e: 0x00c0, 0x3b2f: 0x00c0, + 0x3b30: 0x00c0, 0x3b31: 0x00c0, 0x3b32: 0x00c0, 0x3b33: 0x00c0, 0x3b34: 0x00c0, 0x3b35: 0x00c0, + 0x3b36: 0x00c3, 0x3b37: 0x00c3, 0x3b38: 0x00c3, 0x3b39: 0x00c3, 0x3b3a: 0x00c3, 0x3b3b: 0x00c3, + 0x3b3c: 0x00c3, 0x3b3d: 0x00c3, 0x3b3e: 0x00c3, 0x3b3f: 0x00c0, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x00c5, 0x3b41: 0x00c0, 0x3b42: 0x00c0, 0x3b43: 0x00c0, 0x3b44: 0x00c0, 0x3b45: 0x0080, + 0x3b46: 0x0080, 0x3b47: 0x0080, 0x3b48: 0x0080, 0x3b49: 0x00c3, 0x3b4a: 0x00c3, 0x3b4b: 0x00c3, + 0x3b4c: 0x00c3, 0x3b4d: 0x0080, 0x3b4e: 0x00c0, 0x3b4f: 0x00c3, 0x3b50: 0x00c0, 0x3b51: 0x00c0, + 0x3b52: 0x00c0, 0x3b53: 0x00c0, 0x3b54: 0x00c0, 0x3b55: 0x00c0, 0x3b56: 0x00c0, 0x3b57: 0x00c0, + 0x3b58: 0x00c0, 0x3b59: 0x00c0, 0x3b5a: 0x00c0, 0x3b5b: 0x0080, 0x3b5c: 0x00c0, 0x3b5d: 0x0080, + 0x3b5e: 0x0080, 0x3b5f: 0x0080, 0x3b61: 0x0080, 0x3b62: 0x0080, 0x3b63: 0x0080, + 0x3b64: 0x0080, 0x3b65: 0x0080, 0x3b66: 0x0080, 0x3b67: 0x0080, 0x3b68: 0x0080, 0x3b69: 0x0080, + 0x3b6a: 0x0080, 0x3b6b: 0x0080, 0x3b6c: 0x0080, 0x3b6d: 0x0080, 0x3b6e: 0x0080, 0x3b6f: 0x0080, + 0x3b70: 0x0080, 0x3b71: 0x0080, 0x3b72: 0x0080, 0x3b73: 0x0080, 0x3b74: 0x0080, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x00c0, 0x3b81: 0x00c0, 0x3b82: 0x00c0, 0x3b83: 0x00c0, 0x3b84: 0x00c0, 0x3b85: 0x00c0, + 0x3b86: 0x00c0, 0x3b87: 0x00c0, 0x3b88: 0x00c0, 0x3b89: 0x00c0, 0x3b8a: 0x00c0, 0x3b8b: 0x00c0, + 0x3b8c: 0x00c0, 0x3b8d: 0x00c0, 0x3b8e: 0x00c0, 0x3b8f: 0x00c0, 0x3b90: 0x00c0, 0x3b91: 0x00c0, + 0x3b93: 0x00c0, 0x3b94: 0x00c0, 0x3b95: 0x00c0, 0x3b96: 0x00c0, 0x3b97: 0x00c0, + 0x3b98: 0x00c0, 0x3b99: 0x00c0, 0x3b9a: 0x00c0, 0x3b9b: 0x00c0, 0x3b9c: 0x00c0, 0x3b9d: 0x00c0, + 0x3b9e: 0x00c0, 0x3b9f: 0x00c0, 0x3ba0: 0x00c0, 0x3ba1: 0x00c0, 0x3ba2: 0x00c0, 0x3ba3: 0x00c0, + 0x3ba4: 0x00c0, 0x3ba5: 0x00c0, 0x3ba6: 0x00c0, 0x3ba7: 0x00c0, 0x3ba8: 0x00c0, 0x3ba9: 0x00c0, + 0x3baa: 0x00c0, 0x3bab: 0x00c0, 0x3bac: 0x00c0, 0x3bad: 0x00c0, 0x3bae: 0x00c0, 0x3baf: 0x00c3, + 0x3bb0: 0x00c3, 0x3bb1: 0x00c3, 0x3bb2: 0x00c0, 0x3bb3: 0x00c0, 0x3bb4: 0x00c3, 0x3bb5: 0x00c5, + 0x3bb6: 0x00c3, 0x3bb7: 0x00c3, 0x3bb8: 0x0080, 0x3bb9: 0x0080, 0x3bba: 0x0080, 0x3bbb: 0x0080, + 0x3bbc: 0x0080, 0x3bbd: 0x0080, 0x3bbe: 0x00c3, 0x3bbf: 0x00c0, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x00c0, 0x3bc1: 0x00c3, + // Block 0xf0, offset 0x3c00 + 0x3c00: 0x00c0, 0x3c01: 0x00c0, 0x3c02: 0x00c0, 0x3c03: 0x00c0, 0x3c04: 0x00c0, 0x3c05: 0x00c0, + 0x3c06: 0x00c0, 0x3c08: 0x00c0, 0x3c0a: 0x00c0, 0x3c0b: 0x00c0, + 0x3c0c: 0x00c0, 0x3c0d: 0x00c0, 0x3c0f: 0x00c0, 0x3c10: 0x00c0, 0x3c11: 0x00c0, + 0x3c12: 0x00c0, 0x3c13: 0x00c0, 0x3c14: 0x00c0, 0x3c15: 0x00c0, 0x3c16: 0x00c0, 0x3c17: 0x00c0, + 0x3c18: 0x00c0, 0x3c19: 0x00c0, 0x3c1a: 0x00c0, 0x3c1b: 0x00c0, 0x3c1c: 0x00c0, 0x3c1d: 0x00c0, + 0x3c1f: 0x00c0, 0x3c20: 0x00c0, 0x3c21: 0x00c0, 0x3c22: 0x00c0, 0x3c23: 0x00c0, + 0x3c24: 0x00c0, 0x3c25: 0x00c0, 0x3c26: 0x00c0, 0x3c27: 0x00c0, 0x3c28: 0x00c0, 0x3c29: 0x0080, + 0x3c30: 0x00c0, 0x3c31: 0x00c0, 0x3c32: 0x00c0, 0x3c33: 0x00c0, 0x3c34: 0x00c0, 0x3c35: 0x00c0, + 0x3c36: 0x00c0, 0x3c37: 0x00c0, 0x3c38: 0x00c0, 0x3c39: 0x00c0, 0x3c3a: 0x00c0, 0x3c3b: 0x00c0, + 0x3c3c: 0x00c0, 0x3c3d: 0x00c0, 0x3c3e: 0x00c0, 0x3c3f: 0x00c0, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x00c0, 0x3c41: 0x00c0, 0x3c42: 0x00c0, 0x3c43: 0x00c0, 0x3c44: 0x00c0, 0x3c45: 0x00c0, + 0x3c46: 0x00c0, 0x3c47: 0x00c0, 0x3c48: 0x00c0, 0x3c49: 0x00c0, 0x3c4a: 0x00c0, 0x3c4b: 0x00c0, + 0x3c4c: 0x00c0, 0x3c4d: 0x00c0, 0x3c4e: 0x00c0, 0x3c4f: 0x00c0, 0x3c50: 0x00c0, 0x3c51: 0x00c0, + 0x3c52: 0x00c0, 0x3c53: 0x00c0, 0x3c54: 0x00c0, 0x3c55: 0x00c0, 0x3c56: 0x00c0, 0x3c57: 0x00c0, + 0x3c58: 0x00c0, 0x3c59: 0x00c0, 0x3c5a: 0x00c0, 0x3c5b: 0x00c0, 0x3c5c: 0x00c0, 0x3c5d: 0x00c0, + 0x3c5e: 0x00c0, 0x3c5f: 0x00c3, 0x3c60: 0x00c0, 0x3c61: 0x00c0, 0x3c62: 0x00c0, 0x3c63: 0x00c3, + 0x3c64: 0x00c3, 0x3c65: 0x00c3, 0x3c66: 0x00c3, 0x3c67: 0x00c3, 0x3c68: 0x00c3, 0x3c69: 0x00c3, + 0x3c6a: 0x00c6, + 0x3c70: 0x00c0, 0x3c71: 0x00c0, 0x3c72: 0x00c0, 0x3c73: 0x00c0, 0x3c74: 0x00c0, 0x3c75: 0x00c0, + 0x3c76: 0x00c0, 0x3c77: 0x00c0, 0x3c78: 0x00c0, 0x3c79: 0x00c0, + // Block 0xf2, offset 0x3c80 + 0x3c80: 0x00c3, 0x3c81: 0x00c3, 0x3c82: 0x00c0, 0x3c83: 0x00c0, 0x3c85: 0x00c0, + 0x3c86: 0x00c0, 0x3c87: 0x00c0, 0x3c88: 0x00c0, 0x3c89: 0x00c0, 0x3c8a: 0x00c0, 0x3c8b: 0x00c0, + 0x3c8c: 0x00c0, 0x3c8f: 0x00c0, 0x3c90: 0x00c0, + 0x3c93: 0x00c0, 0x3c94: 0x00c0, 0x3c95: 0x00c0, 0x3c96: 0x00c0, 0x3c97: 0x00c0, + 0x3c98: 0x00c0, 0x3c99: 0x00c0, 0x3c9a: 0x00c0, 0x3c9b: 0x00c0, 0x3c9c: 0x00c0, 0x3c9d: 0x00c0, + 0x3c9e: 0x00c0, 0x3c9f: 0x00c0, 0x3ca0: 0x00c0, 0x3ca1: 0x00c0, 0x3ca2: 0x00c0, 0x3ca3: 0x00c0, + 0x3ca4: 0x00c0, 0x3ca5: 0x00c0, 0x3ca6: 0x00c0, 0x3ca7: 0x00c0, 0x3ca8: 0x00c0, + 0x3caa: 0x00c0, 0x3cab: 0x00c0, 0x3cac: 0x00c0, 0x3cad: 0x00c0, 0x3cae: 0x00c0, 0x3caf: 0x00c0, + 0x3cb0: 0x00c0, 0x3cb2: 0x00c0, 0x3cb3: 0x00c0, 0x3cb5: 0x00c0, + 0x3cb6: 0x00c0, 0x3cb7: 0x00c0, 0x3cb8: 0x00c0, 0x3cb9: 0x00c0, 0x3cbb: 0x00c3, + 0x3cbc: 0x00c3, 0x3cbd: 0x00c0, 0x3cbe: 0x00c0, 0x3cbf: 0x00c0, + // Block 0xf3, offset 0x3cc0 + 0x3cc0: 0x00c3, 0x3cc1: 0x00c0, 0x3cc2: 0x00c0, 0x3cc3: 0x00c0, 0x3cc4: 0x00c0, + 0x3cc7: 0x00c0, 0x3cc8: 0x00c0, 0x3ccb: 0x00c0, + 0x3ccc: 0x00c0, 0x3ccd: 0x00c5, 0x3cd0: 0x00c0, + 0x3cd7: 0x00c0, + 0x3cdd: 0x00c0, + 0x3cde: 0x00c0, 0x3cdf: 0x00c0, 0x3ce0: 0x00c0, 0x3ce1: 0x00c0, 0x3ce2: 0x00c0, 0x3ce3: 0x00c0, + 0x3ce6: 0x00c3, 0x3ce7: 0x00c3, 0x3ce8: 0x00c3, 0x3ce9: 0x00c3, + 0x3cea: 0x00c3, 0x3ceb: 0x00c3, 0x3cec: 0x00c3, + 0x3cf0: 0x00c3, 0x3cf1: 0x00c3, 0x3cf2: 0x00c3, 0x3cf3: 0x00c3, 0x3cf4: 0x00c3, + // Block 0xf4, offset 0x3d00 + 0x3d00: 0x00c0, 0x3d01: 0x00c0, 0x3d02: 0x00c0, 0x3d03: 0x00c0, 0x3d04: 0x00c0, 0x3d05: 0x00c0, + 0x3d06: 0x00c0, 0x3d07: 0x00c0, 0x3d08: 0x00c0, 0x3d09: 0x00c0, 0x3d0a: 0x00c0, 0x3d0b: 0x00c0, + 0x3d0c: 0x00c0, 0x3d0d: 0x00c0, 0x3d0e: 0x00c0, 0x3d0f: 0x00c0, 0x3d10: 0x00c0, 0x3d11: 0x00c0, + 0x3d12: 0x00c0, 0x3d13: 0x00c0, 0x3d14: 0x00c0, 0x3d15: 0x00c0, 0x3d16: 0x00c0, 0x3d17: 0x00c0, + 0x3d18: 0x00c0, 0x3d19: 0x00c0, 0x3d1a: 0x00c0, 0x3d1b: 0x00c0, 0x3d1c: 0x00c0, 0x3d1d: 0x00c0, + 0x3d1e: 0x00c0, 0x3d1f: 0x00c0, 0x3d20: 0x00c0, 0x3d21: 0x00c0, 0x3d22: 0x00c0, 0x3d23: 0x00c0, + 0x3d24: 0x00c0, 0x3d25: 0x00c0, 0x3d26: 0x00c0, 0x3d27: 0x00c0, 0x3d28: 0x00c0, 0x3d29: 0x00c0, + 0x3d2a: 0x00c0, 0x3d2b: 0x00c0, 0x3d2c: 0x00c0, 0x3d2d: 0x00c0, 0x3d2e: 0x00c0, 0x3d2f: 0x00c0, + 0x3d30: 0x00c0, 0x3d31: 0x00c0, 0x3d32: 0x00c0, 0x3d33: 0x00c0, 0x3d34: 0x00c0, 0x3d35: 0x00c0, + 0x3d36: 0x00c0, 0x3d37: 0x00c0, 0x3d38: 0x00c3, 0x3d39: 0x00c3, 0x3d3a: 0x00c3, 0x3d3b: 0x00c3, + 0x3d3c: 0x00c3, 0x3d3d: 0x00c3, 0x3d3e: 0x00c3, 0x3d3f: 0x00c3, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x00c0, 0x3d41: 0x00c0, 0x3d42: 0x00c6, 0x3d43: 0x00c3, 0x3d44: 0x00c3, 0x3d45: 0x00c0, + 0x3d46: 0x00c3, 0x3d47: 0x00c0, 0x3d48: 0x00c0, 0x3d49: 0x00c0, 0x3d4a: 0x00c0, 0x3d4b: 0x0080, + 0x3d4c: 0x0080, 0x3d4d: 0x0080, 0x3d4e: 0x0080, 0x3d4f: 0x0080, 0x3d50: 0x00c0, 0x3d51: 0x00c0, + 0x3d52: 0x00c0, 0x3d53: 0x00c0, 0x3d54: 0x00c0, 0x3d55: 0x00c0, 0x3d56: 0x00c0, 0x3d57: 0x00c0, + 0x3d58: 0x00c0, 0x3d59: 0x00c0, 0x3d5a: 0x0080, 0x3d5b: 0x0080, 0x3d5d: 0x0080, + 0x3d5e: 0x00c3, 0x3d5f: 0x00c0, 0x3d60: 0x00c0, 0x3d61: 0x00c0, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x00c0, 0x3d81: 0x00c0, 0x3d82: 0x00c0, 0x3d83: 0x00c0, 0x3d84: 0x00c0, 0x3d85: 0x00c0, + 0x3d86: 0x00c0, 0x3d87: 0x00c0, 0x3d88: 0x00c0, 0x3d89: 0x00c0, 0x3d8a: 0x00c0, 0x3d8b: 0x00c0, + 0x3d8c: 0x00c0, 0x3d8d: 0x00c0, 0x3d8e: 0x00c0, 0x3d8f: 0x00c0, 0x3d90: 0x00c0, 0x3d91: 0x00c0, + 0x3d92: 0x00c0, 0x3d93: 0x00c0, 0x3d94: 0x00c0, 0x3d95: 0x00c0, 0x3d96: 0x00c0, 0x3d97: 0x00c0, + 0x3d98: 0x00c0, 0x3d99: 0x00c0, 0x3d9a: 0x00c0, 0x3d9b: 0x00c0, 0x3d9c: 0x00c0, 0x3d9d: 0x00c0, + 0x3d9e: 0x00c0, 0x3d9f: 0x00c0, 0x3da0: 0x00c0, 0x3da1: 0x00c0, 0x3da2: 0x00c0, 0x3da3: 0x00c0, + 0x3da4: 0x00c0, 0x3da5: 0x00c0, 0x3da6: 0x00c0, 0x3da7: 0x00c0, 0x3da8: 0x00c0, 0x3da9: 0x00c0, + 0x3daa: 0x00c0, 0x3dab: 0x00c0, 0x3dac: 0x00c0, 0x3dad: 0x00c0, 0x3dae: 0x00c0, 0x3daf: 0x00c0, + 0x3db0: 0x00c0, 0x3db1: 0x00c0, 0x3db2: 0x00c0, 0x3db3: 0x00c3, 0x3db4: 0x00c3, 0x3db5: 0x00c3, + 0x3db6: 0x00c3, 0x3db7: 0x00c3, 0x3db8: 0x00c3, 0x3db9: 0x00c0, 0x3dba: 0x00c3, 0x3dbb: 0x00c0, + 0x3dbc: 0x00c0, 0x3dbd: 0x00c0, 0x3dbe: 0x00c0, 0x3dbf: 0x00c3, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x00c3, 0x3dc1: 0x00c0, 0x3dc2: 0x00c6, 0x3dc3: 0x00c3, 0x3dc4: 0x00c0, 0x3dc5: 0x00c0, + 0x3dc6: 0x0080, 0x3dc7: 0x00c0, + 0x3dd0: 0x00c0, 0x3dd1: 0x00c0, + 0x3dd2: 0x00c0, 0x3dd3: 0x00c0, 0x3dd4: 0x00c0, 0x3dd5: 0x00c0, 0x3dd6: 0x00c0, 0x3dd7: 0x00c0, + 0x3dd8: 0x00c0, 0x3dd9: 0x00c0, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x00c0, 0x3e01: 0x00c0, 0x3e02: 0x00c0, 0x3e03: 0x00c0, 0x3e04: 0x00c0, 0x3e05: 0x00c0, + 0x3e06: 0x00c0, 0x3e07: 0x00c0, 0x3e08: 0x00c0, 0x3e09: 0x00c0, 0x3e0a: 0x00c0, 0x3e0b: 0x00c0, + 0x3e0c: 0x00c0, 0x3e0d: 0x00c0, 0x3e0e: 0x00c0, 0x3e0f: 0x00c0, 0x3e10: 0x00c0, 0x3e11: 0x00c0, + 0x3e12: 0x00c0, 0x3e13: 0x00c0, 0x3e14: 0x00c0, 0x3e15: 0x00c0, 0x3e16: 0x00c0, 0x3e17: 0x00c0, + 0x3e18: 0x00c0, 0x3e19: 0x00c0, 0x3e1a: 0x00c0, 0x3e1b: 0x00c0, 0x3e1c: 0x00c0, 0x3e1d: 0x00c0, + 0x3e1e: 0x00c0, 0x3e1f: 0x00c0, 0x3e20: 0x00c0, 0x3e21: 0x00c0, 0x3e22: 0x00c0, 0x3e23: 0x00c0, + 0x3e24: 0x00c0, 0x3e25: 0x00c0, 0x3e26: 0x00c0, 0x3e27: 0x00c0, 0x3e28: 0x00c0, 0x3e29: 0x00c0, + 0x3e2a: 0x00c0, 0x3e2b: 0x00c0, 0x3e2c: 0x00c0, 0x3e2d: 0x00c0, 0x3e2e: 0x00c0, 0x3e2f: 0x00c0, + 0x3e30: 0x00c0, 0x3e31: 0x00c0, 0x3e32: 0x00c3, 0x3e33: 0x00c3, 0x3e34: 0x00c3, 0x3e35: 0x00c3, + 0x3e38: 0x00c0, 0x3e39: 0x00c0, 0x3e3a: 0x00c0, 0x3e3b: 0x00c0, + 0x3e3c: 0x00c3, 0x3e3d: 0x00c3, 0x3e3e: 0x00c0, 0x3e3f: 0x00c6, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x00c3, 0x3e41: 0x0080, 0x3e42: 0x0080, 0x3e43: 0x0080, 0x3e44: 0x0080, 0x3e45: 0x0080, + 0x3e46: 0x0080, 0x3e47: 0x0080, 0x3e48: 0x0080, 0x3e49: 0x0080, 0x3e4a: 0x0080, 0x3e4b: 0x0080, + 0x3e4c: 0x0080, 0x3e4d: 0x0080, 0x3e4e: 0x0080, 0x3e4f: 0x0080, 0x3e50: 0x0080, 0x3e51: 0x0080, + 0x3e52: 0x0080, 0x3e53: 0x0080, 0x3e54: 0x0080, 0x3e55: 0x0080, 0x3e56: 0x0080, 0x3e57: 0x0080, + 0x3e58: 0x00c0, 0x3e59: 0x00c0, 0x3e5a: 0x00c0, 0x3e5b: 0x00c0, 0x3e5c: 0x00c3, 0x3e5d: 0x00c3, + // Block 0xfa, offset 0x3e80 + 0x3e80: 0x00c0, 0x3e81: 0x00c0, 0x3e82: 0x00c0, 0x3e83: 0x00c0, 0x3e84: 0x00c0, 0x3e85: 0x00c0, + 0x3e86: 0x00c0, 0x3e87: 0x00c0, 0x3e88: 0x00c0, 0x3e89: 0x00c0, 0x3e8a: 0x00c0, 0x3e8b: 0x00c0, + 0x3e8c: 0x00c0, 0x3e8d: 0x00c0, 0x3e8e: 0x00c0, 0x3e8f: 0x00c0, 0x3e90: 0x00c0, 0x3e91: 0x00c0, + 0x3e92: 0x00c0, 0x3e93: 0x00c0, 0x3e94: 0x00c0, 0x3e95: 0x00c0, 0x3e96: 0x00c0, 0x3e97: 0x00c0, + 0x3e98: 0x00c0, 0x3e99: 0x00c0, 0x3e9a: 0x00c0, 0x3e9b: 0x00c0, 0x3e9c: 0x00c0, 0x3e9d: 0x00c0, + 0x3e9e: 0x00c0, 0x3e9f: 0x00c0, 0x3ea0: 0x00c0, 0x3ea1: 0x00c0, 0x3ea2: 0x00c0, 0x3ea3: 0x00c0, + 0x3ea4: 0x00c0, 0x3ea5: 0x00c0, 0x3ea6: 0x00c0, 0x3ea7: 0x00c0, 0x3ea8: 0x00c0, 0x3ea9: 0x00c0, + 0x3eaa: 0x00c0, 0x3eab: 0x00c0, 0x3eac: 0x00c0, 0x3ead: 0x00c0, 0x3eae: 0x00c0, 0x3eaf: 0x00c0, + 0x3eb0: 0x00c0, 0x3eb1: 0x00c0, 0x3eb2: 0x00c0, 0x3eb3: 0x00c3, 0x3eb4: 0x00c3, 0x3eb5: 0x00c3, + 0x3eb6: 0x00c3, 0x3eb7: 0x00c3, 0x3eb8: 0x00c3, 0x3eb9: 0x00c3, 0x3eba: 0x00c3, 0x3ebb: 0x00c0, + 0x3ebc: 0x00c0, 0x3ebd: 0x00c3, 0x3ebe: 0x00c0, 0x3ebf: 0x00c6, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x00c3, 0x3ec1: 0x0080, 0x3ec2: 0x0080, 0x3ec3: 0x0080, 0x3ec4: 0x00c0, + 0x3ed0: 0x00c0, 0x3ed1: 0x00c0, + 0x3ed2: 0x00c0, 0x3ed3: 0x00c0, 0x3ed4: 0x00c0, 0x3ed5: 0x00c0, 0x3ed6: 0x00c0, 0x3ed7: 0x00c0, + 0x3ed8: 0x00c0, 0x3ed9: 0x00c0, + 0x3ee0: 0x0080, 0x3ee1: 0x0080, 0x3ee2: 0x0080, 0x3ee3: 0x0080, + 0x3ee4: 0x0080, 0x3ee5: 0x0080, 0x3ee6: 0x0080, 0x3ee7: 0x0080, 0x3ee8: 0x0080, 0x3ee9: 0x0080, + 0x3eea: 0x0080, 0x3eeb: 0x0080, 0x3eec: 0x0080, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x00c0, 0x3f01: 0x00c0, 0x3f02: 0x00c0, 0x3f03: 0x00c0, 0x3f04: 0x00c0, 0x3f05: 0x00c0, + 0x3f06: 0x00c0, 0x3f07: 0x00c0, 0x3f08: 0x00c0, 0x3f09: 0x00c0, 0x3f0a: 0x00c0, 0x3f0b: 0x00c0, + 0x3f0c: 0x00c0, 0x3f0d: 0x00c0, 0x3f0e: 0x00c0, 0x3f0f: 0x00c0, 0x3f10: 0x00c0, 0x3f11: 0x00c0, + 0x3f12: 0x00c0, 0x3f13: 0x00c0, 0x3f14: 0x00c0, 0x3f15: 0x00c0, 0x3f16: 0x00c0, 0x3f17: 0x00c0, + 0x3f18: 0x00c0, 0x3f19: 0x00c0, 0x3f1a: 0x00c0, 0x3f1b: 0x00c0, 0x3f1c: 0x00c0, 0x3f1d: 0x00c0, + 0x3f1e: 0x00c0, 0x3f1f: 0x00c0, 0x3f20: 0x00c0, 0x3f21: 0x00c0, 0x3f22: 0x00c0, 0x3f23: 0x00c0, + 0x3f24: 0x00c0, 0x3f25: 0x00c0, 0x3f26: 0x00c0, 0x3f27: 0x00c0, 0x3f28: 0x00c0, 0x3f29: 0x00c0, + 0x3f2a: 0x00c0, 0x3f2b: 0x00c3, 0x3f2c: 0x00c0, 0x3f2d: 0x00c3, 0x3f2e: 0x00c0, 0x3f2f: 0x00c0, + 0x3f30: 0x00c3, 0x3f31: 0x00c3, 0x3f32: 0x00c3, 0x3f33: 0x00c3, 0x3f34: 0x00c3, 0x3f35: 0x00c3, + 0x3f36: 0x00c5, 0x3f37: 0x00c3, 0x3f38: 0x00c0, 0x3f39: 0x0080, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x00c0, 0x3f41: 0x00c0, 0x3f42: 0x00c0, 0x3f43: 0x00c0, 0x3f44: 0x00c0, 0x3f45: 0x00c0, + 0x3f46: 0x00c0, 0x3f47: 0x00c0, 0x3f48: 0x00c0, 0x3f49: 0x00c0, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x00c0, 0x3f81: 0x00c0, 0x3f82: 0x00c0, 0x3f83: 0x00c0, 0x3f84: 0x00c0, 0x3f85: 0x00c0, + 0x3f86: 0x00c0, 0x3f87: 0x00c0, 0x3f88: 0x00c0, 0x3f89: 0x00c0, 0x3f8a: 0x00c0, 0x3f8b: 0x00c0, + 0x3f8c: 0x00c0, 0x3f8d: 0x00c0, 0x3f8e: 0x00c0, 0x3f8f: 0x00c0, 0x3f90: 0x00c0, 0x3f91: 0x00c0, + 0x3f92: 0x00c0, 0x3f93: 0x00c0, 0x3f94: 0x00c0, 0x3f95: 0x00c0, 0x3f96: 0x00c0, 0x3f97: 0x00c0, + 0x3f98: 0x00c0, 0x3f99: 0x00c0, 0x3f9a: 0x00c0, 0x3f9d: 0x00c3, + 0x3f9e: 0x00c3, 0x3f9f: 0x00c3, 0x3fa0: 0x00c0, 0x3fa1: 0x00c0, 0x3fa2: 0x00c3, 0x3fa3: 0x00c3, + 0x3fa4: 0x00c3, 0x3fa5: 0x00c3, 0x3fa6: 0x00c0, 0x3fa7: 0x00c3, 0x3fa8: 0x00c3, 0x3fa9: 0x00c3, + 0x3faa: 0x00c3, 0x3fab: 0x00c6, + 0x3fb0: 0x00c0, 0x3fb1: 0x00c0, 0x3fb2: 0x00c0, 0x3fb3: 0x00c0, 0x3fb4: 0x00c0, 0x3fb5: 0x00c0, + 0x3fb6: 0x00c0, 0x3fb7: 0x00c0, 0x3fb8: 0x00c0, 0x3fb9: 0x00c0, 0x3fba: 0x0080, 0x3fbb: 0x0080, + 0x3fbc: 0x0080, 0x3fbd: 0x0080, 0x3fbe: 0x0080, 0x3fbf: 0x0080, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x00c0, 0x3fc1: 0x00c0, 0x3fc2: 0x00c0, 0x3fc3: 0x00c0, 0x3fc4: 0x00c0, 0x3fc5: 0x00c0, + 0x3fc6: 0x00c0, + // Block 0x100, offset 0x4000 + 0x4000: 0x00c0, 0x4001: 0x00c0, 0x4002: 0x00c0, 0x4003: 0x00c0, 0x4004: 0x00c0, 0x4005: 0x00c0, + 0x4006: 0x00c0, 0x4007: 0x00c0, 0x4008: 0x00c0, 0x4009: 0x00c0, 0x400a: 0x00c0, 0x400b: 0x00c0, + 0x400c: 0x00c0, 0x400d: 0x00c0, 0x400e: 0x00c0, 0x400f: 0x00c0, 0x4010: 0x00c0, 0x4011: 0x00c0, + 0x4012: 0x00c0, 0x4013: 0x00c0, 0x4014: 0x00c0, 0x4015: 0x00c0, 0x4016: 0x00c0, 0x4017: 0x00c0, + 0x4018: 0x00c0, 0x4019: 0x00c0, 0x401a: 0x00c0, 0x401b: 0x00c0, 0x401c: 0x00c0, 0x401d: 0x00c0, + 0x401e: 0x00c0, 0x401f: 0x00c0, 0x4020: 0x00c0, 0x4021: 0x00c0, 0x4022: 0x00c0, 0x4023: 0x00c0, + 0x4024: 0x00c0, 0x4025: 0x00c0, 0x4026: 0x00c0, 0x4027: 0x00c0, 0x4028: 0x00c0, 0x4029: 0x00c0, + 0x402a: 0x00c0, 0x402b: 0x00c0, 0x402c: 0x00c0, 0x402d: 0x00c0, 0x402e: 0x00c0, 0x402f: 0x00c3, + 0x4030: 0x00c3, 0x4031: 0x00c3, 0x4032: 0x00c3, 0x4033: 0x00c3, 0x4034: 0x00c3, 0x4035: 0x00c3, + 0x4036: 0x00c3, 0x4037: 0x00c3, 0x4038: 0x00c0, 0x4039: 0x00c6, 0x403a: 0x00c3, 0x403b: 0x0080, + // Block 0x101, offset 0x4040 + 0x4060: 0x00c0, 0x4061: 0x00c0, 0x4062: 0x00c0, 0x4063: 0x00c0, + 0x4064: 0x00c0, 0x4065: 0x00c0, 0x4066: 0x00c0, 0x4067: 0x00c0, 0x4068: 0x00c0, 0x4069: 0x00c0, + 0x406a: 0x00c0, 0x406b: 0x00c0, 0x406c: 0x00c0, 0x406d: 0x00c0, 0x406e: 0x00c0, 0x406f: 0x00c0, + 0x4070: 0x00c0, 0x4071: 0x00c0, 0x4072: 0x00c0, 0x4073: 0x00c0, 0x4074: 0x00c0, 0x4075: 0x00c0, + 0x4076: 0x00c0, 0x4077: 0x00c0, 0x4078: 0x00c0, 0x4079: 0x00c0, 0x407a: 0x00c0, 0x407b: 0x00c0, + 0x407c: 0x00c0, 0x407d: 0x00c0, 0x407e: 0x00c0, 0x407f: 0x00c0, + // Block 0x102, offset 0x4080 + 0x4080: 0x00c0, 0x4081: 0x00c0, 0x4082: 0x00c0, 0x4083: 0x00c0, 0x4084: 0x00c0, 0x4085: 0x00c0, + 0x4086: 0x00c0, 0x4087: 0x00c0, 0x4088: 0x00c0, 0x4089: 0x00c0, 0x408a: 0x00c0, 0x408b: 0x00c0, + 0x408c: 0x00c0, 0x408d: 0x00c0, 0x408e: 0x00c0, 0x408f: 0x00c0, 0x4090: 0x00c0, 0x4091: 0x00c0, + 0x4092: 0x00c0, 0x4093: 0x00c0, 0x4094: 0x00c0, 0x4095: 0x00c0, 0x4096: 0x00c0, 0x4097: 0x00c0, + 0x4098: 0x00c0, 0x4099: 0x00c0, 0x409a: 0x00c0, 0x409b: 0x00c0, 0x409c: 0x00c0, 0x409d: 0x00c0, + 0x409e: 0x00c0, 0x409f: 0x00c0, 0x40a0: 0x00c0, 0x40a1: 0x00c0, 0x40a2: 0x00c0, 0x40a3: 0x00c0, + 0x40a4: 0x00c0, 0x40a5: 0x00c0, 0x40a6: 0x00c0, 0x40a7: 0x00c0, 0x40a8: 0x00c0, 0x40a9: 0x00c0, + 0x40aa: 0x0080, 0x40ab: 0x0080, 0x40ac: 0x0080, 0x40ad: 0x0080, 0x40ae: 0x0080, 0x40af: 0x0080, + 0x40b0: 0x0080, 0x40b1: 0x0080, 0x40b2: 0x0080, + 0x40bf: 0x00c0, + // Block 0x103, offset 0x40c0 + 0x40c0: 0x00c0, 0x40c1: 0x00c0, 0x40c2: 0x00c0, 0x40c3: 0x00c0, 0x40c4: 0x00c0, 0x40c5: 0x00c0, + 0x40c6: 0x00c0, 0x40c9: 0x00c0, + 0x40cc: 0x00c0, 0x40cd: 0x00c0, 0x40ce: 0x00c0, 0x40cf: 0x00c0, 0x40d0: 0x00c0, 0x40d1: 0x00c0, + 0x40d2: 0x00c0, 0x40d3: 0x00c0, 0x40d5: 0x00c0, 0x40d6: 0x00c0, + 0x40d8: 0x00c0, 0x40d9: 0x00c0, 0x40da: 0x00c0, 0x40db: 0x00c0, 0x40dc: 0x00c0, 0x40dd: 0x00c0, + 0x40de: 0x00c0, 0x40df: 0x00c0, 0x40e0: 0x00c0, 0x40e1: 0x00c0, 0x40e2: 0x00c0, 0x40e3: 0x00c0, + 0x40e4: 0x00c0, 0x40e5: 0x00c0, 0x40e6: 0x00c0, 0x40e7: 0x00c0, 0x40e8: 0x00c0, 0x40e9: 0x00c0, + 0x40ea: 0x00c0, 0x40eb: 0x00c0, 0x40ec: 0x00c0, 0x40ed: 0x00c0, 0x40ee: 0x00c0, 0x40ef: 0x00c0, + 0x40f0: 0x00c0, 0x40f1: 0x00c0, 0x40f2: 0x00c0, 0x40f3: 0x00c0, 0x40f4: 0x00c0, 0x40f5: 0x00c0, + 0x40f7: 0x00c0, 0x40f8: 0x00c0, 0x40fb: 0x00c3, + 0x40fc: 0x00c3, 0x40fd: 0x00c5, 0x40fe: 0x00c6, 0x40ff: 0x00c0, + // Block 0x104, offset 0x4100 + 0x4100: 0x00c0, 0x4101: 0x00c0, 0x4102: 0x00c0, 0x4103: 0x00c3, 0x4104: 0x0080, 0x4105: 0x0080, + 0x4106: 0x0080, + 0x4110: 0x00c0, 0x4111: 0x00c0, + 0x4112: 0x00c0, 0x4113: 0x00c0, 0x4114: 0x00c0, 0x4115: 0x00c0, 0x4116: 0x00c0, 0x4117: 0x00c0, + 0x4118: 0x00c0, 0x4119: 0x00c0, + // Block 0x105, offset 0x4140 + 0x4160: 0x00c0, 0x4161: 0x00c0, 0x4162: 0x00c0, 0x4163: 0x00c0, + 0x4164: 0x00c0, 0x4165: 0x00c0, 0x4166: 0x00c0, 0x4167: 0x00c0, + 0x416a: 0x00c0, 0x416b: 0x00c0, 0x416c: 0x00c0, 0x416d: 0x00c0, 0x416e: 0x00c0, 0x416f: 0x00c0, + 0x4170: 0x00c0, 0x4171: 0x00c0, 0x4172: 0x00c0, 0x4173: 0x00c0, 0x4174: 0x00c0, 0x4175: 0x00c0, + 0x4176: 0x00c0, 0x4177: 0x00c0, 0x4178: 0x00c0, 0x4179: 0x00c0, 0x417a: 0x00c0, 0x417b: 0x00c0, + 0x417c: 0x00c0, 0x417d: 0x00c0, 0x417e: 0x00c0, 0x417f: 0x00c0, + // Block 0x106, offset 0x4180 + 0x4180: 0x00c0, 0x4181: 0x00c0, 0x4182: 0x00c0, 0x4183: 0x00c0, 0x4184: 0x00c0, 0x4185: 0x00c0, + 0x4186: 0x00c0, 0x4187: 0x00c0, 0x4188: 0x00c0, 0x4189: 0x00c0, 0x418a: 0x00c0, 0x418b: 0x00c0, + 0x418c: 0x00c0, 0x418d: 0x00c0, 0x418e: 0x00c0, 0x418f: 0x00c0, 0x4190: 0x00c0, 0x4191: 0x00c0, + 0x4192: 0x00c0, 0x4193: 0x00c0, 0x4194: 0x00c3, 0x4195: 0x00c3, 0x4196: 0x00c3, 0x4197: 0x00c3, + 0x419a: 0x00c3, 0x419b: 0x00c3, 0x419c: 0x00c0, 0x419d: 0x00c0, + 0x419e: 0x00c0, 0x419f: 0x00c0, 0x41a0: 0x00c6, 0x41a1: 0x00c0, 0x41a2: 0x0080, 0x41a3: 0x00c0, + 0x41a4: 0x00c0, + // Block 0x107, offset 0x41c0 + 0x41c0: 0x00c0, 0x41c1: 0x00c3, 0x41c2: 0x00c3, 0x41c3: 0x00c3, 0x41c4: 0x00c3, 0x41c5: 0x00c3, + 0x41c6: 0x00c3, 0x41c7: 0x00c3, 0x41c8: 0x00c3, 0x41c9: 0x00c3, 0x41ca: 0x00c3, 0x41cb: 0x00c0, + 0x41cc: 0x00c0, 0x41cd: 0x00c0, 0x41ce: 0x00c0, 0x41cf: 0x00c0, 0x41d0: 0x00c0, 0x41d1: 0x00c0, + 0x41d2: 0x00c0, 0x41d3: 0x00c0, 0x41d4: 0x00c0, 0x41d5: 0x00c0, 0x41d6: 0x00c0, 0x41d7: 0x00c0, + 0x41d8: 0x00c0, 0x41d9: 0x00c0, 0x41da: 0x00c0, 0x41db: 0x00c0, 0x41dc: 0x00c0, 0x41dd: 0x00c0, + 0x41de: 0x00c0, 0x41df: 0x00c0, 0x41e0: 0x00c0, 0x41e1: 0x00c0, 0x41e2: 0x00c0, 0x41e3: 0x00c0, + 0x41e4: 0x00c0, 0x41e5: 0x00c0, 0x41e6: 0x00c0, 0x41e7: 0x00c0, 0x41e8: 0x00c0, 0x41e9: 0x00c0, + 0x41ea: 0x00c0, 0x41eb: 0x00c0, 0x41ec: 0x00c0, 0x41ed: 0x00c0, 0x41ee: 0x00c0, 0x41ef: 0x00c0, + 0x41f0: 0x00c0, 0x41f1: 0x00c0, 0x41f2: 0x00c0, 0x41f3: 0x00c3, 0x41f4: 0x00c6, 0x41f5: 0x00c3, + 0x41f6: 0x00c3, 0x41f7: 0x00c3, 0x41f8: 0x00c3, 0x41f9: 0x00c0, 0x41fa: 0x00c0, 0x41fb: 0x00c3, + 0x41fc: 0x00c3, 0x41fd: 0x00c3, 0x41fe: 0x00c3, 0x41ff: 0x0080, + // Block 0x108, offset 0x4200 + 0x4200: 0x0080, 0x4201: 0x0080, 0x4202: 0x0080, 0x4203: 0x0080, 0x4204: 0x0080, 0x4205: 0x0080, + 0x4206: 0x0080, 0x4207: 0x00c6, + 0x4210: 0x00c0, 0x4211: 0x00c3, + 0x4212: 0x00c3, 0x4213: 0x00c3, 0x4214: 0x00c3, 0x4215: 0x00c3, 0x4216: 0x00c3, 0x4217: 0x00c0, + 0x4218: 0x00c0, 0x4219: 0x00c3, 0x421a: 0x00c3, 0x421b: 0x00c3, 0x421c: 0x00c0, 0x421d: 0x00c0, + 0x421e: 0x00c0, 0x421f: 0x00c0, 0x4220: 0x00c0, 0x4221: 0x00c0, 0x4222: 0x00c0, 0x4223: 0x00c0, + 0x4224: 0x00c0, 0x4225: 0x00c0, 0x4226: 0x00c0, 0x4227: 0x00c0, 0x4228: 0x00c0, 0x4229: 0x00c0, + 0x422a: 0x00c0, 0x422b: 0x00c0, 0x422c: 0x00c0, 0x422d: 0x00c0, 0x422e: 0x00c0, 0x422f: 0x00c0, + 0x4230: 0x00c0, 0x4231: 0x00c0, 0x4232: 0x00c0, 0x4233: 0x00c0, 0x4234: 0x00c0, 0x4235: 0x00c0, + 0x4236: 0x00c0, 0x4237: 0x00c0, 0x4238: 0x00c0, 0x4239: 0x00c0, 0x423a: 0x00c0, 0x423b: 0x00c0, + 0x423c: 0x00c0, 0x423d: 0x00c0, 0x423e: 0x00c0, 0x423f: 0x00c0, + // Block 0x109, offset 0x4240 + 0x4240: 0x00c0, 0x4241: 0x00c0, 0x4242: 0x00c0, 0x4243: 0x00c0, 0x4244: 0x00c0, 0x4245: 0x00c0, + 0x4246: 0x00c0, 0x4247: 0x00c0, 0x4248: 0x00c0, 0x4249: 0x00c0, 0x424a: 0x00c3, 0x424b: 0x00c3, + 0x424c: 0x00c3, 0x424d: 0x00c3, 0x424e: 0x00c3, 0x424f: 0x00c3, 0x4250: 0x00c3, 0x4251: 0x00c3, + 0x4252: 0x00c3, 0x4253: 0x00c3, 0x4254: 0x00c3, 0x4255: 0x00c3, 0x4256: 0x00c3, 0x4257: 0x00c0, + 0x4258: 0x00c3, 0x4259: 0x00c6, 0x425a: 0x0080, 0x425b: 0x0080, 0x425c: 0x0080, 0x425d: 0x00c0, + 0x425e: 0x0080, 0x425f: 0x0080, 0x4260: 0x0080, 0x4261: 0x0080, 0x4262: 0x0080, + 0x4270: 0x00c0, 0x4271: 0x00c0, 0x4272: 0x00c0, 0x4273: 0x00c0, 0x4274: 0x00c0, 0x4275: 0x00c0, + 0x4276: 0x00c0, 0x4277: 0x00c0, 0x4278: 0x00c0, 0x4279: 0x00c0, 0x427a: 0x00c0, 0x427b: 0x00c0, + 0x427c: 0x00c0, 0x427d: 0x00c0, 0x427e: 0x00c0, 0x427f: 0x00c0, + // Block 0x10a, offset 0x4280 + 0x4280: 0x00c0, 0x4281: 0x00c0, 0x4282: 0x00c0, 0x4283: 0x00c0, 0x4284: 0x00c0, 0x4285: 0x00c0, + 0x4286: 0x00c0, 0x4287: 0x00c0, 0x4288: 0x00c0, 0x4289: 0x00c0, 0x428a: 0x00c0, 0x428b: 0x00c0, + 0x428c: 0x00c0, 0x428d: 0x00c0, 0x428e: 0x00c0, 0x428f: 0x00c0, 0x4290: 0x00c0, 0x4291: 0x00c0, + 0x4292: 0x00c0, 0x4293: 0x00c0, 0x4294: 0x00c0, 0x4295: 0x00c0, 0x4296: 0x00c0, 0x4297: 0x00c0, + 0x4298: 0x00c0, 0x4299: 0x00c0, 0x429a: 0x00c0, 0x429b: 0x00c0, 0x429c: 0x00c0, 0x429d: 0x00c0, + 0x429e: 0x00c0, 0x429f: 0x00c0, 0x42a0: 0x00c0, 0x42a1: 0x00c0, 0x42a2: 0x00c0, 0x42a3: 0x00c0, + 0x42a4: 0x00c0, 0x42a5: 0x00c0, 0x42a6: 0x00c0, 0x42a7: 0x00c0, 0x42a8: 0x00c0, 0x42a9: 0x00c0, + 0x42aa: 0x00c0, 0x42ab: 0x00c0, 0x42ac: 0x00c0, 0x42ad: 0x00c0, 0x42ae: 0x00c0, 0x42af: 0x00c0, + 0x42b0: 0x00c0, 0x42b1: 0x00c0, 0x42b2: 0x00c0, 0x42b3: 0x00c0, 0x42b4: 0x00c0, 0x42b5: 0x00c0, + 0x42b6: 0x00c0, 0x42b7: 0x00c0, 0x42b8: 0x00c0, + // Block 0x10b, offset 0x42c0 + 0x42c0: 0x0080, 0x42c1: 0x0080, 0x42c2: 0x0080, 0x42c3: 0x0080, 0x42c4: 0x0080, 0x42c5: 0x0080, + 0x42c6: 0x0080, 0x42c7: 0x0080, 0x42c8: 0x0080, 0x42c9: 0x0080, + // Block 0x10c, offset 0x4300 + 0x4300: 0x00c0, 0x4301: 0x00c0, 0x4302: 0x00c0, 0x4303: 0x00c0, 0x4304: 0x00c0, 0x4305: 0x00c0, + 0x4306: 0x00c0, 0x4307: 0x00c0, 0x4308: 0x00c0, 0x430a: 0x00c0, 0x430b: 0x00c0, + 0x430c: 0x00c0, 0x430d: 0x00c0, 0x430e: 0x00c0, 0x430f: 0x00c0, 0x4310: 0x00c0, 0x4311: 0x00c0, + 0x4312: 0x00c0, 0x4313: 0x00c0, 0x4314: 0x00c0, 0x4315: 0x00c0, 0x4316: 0x00c0, 0x4317: 0x00c0, + 0x4318: 0x00c0, 0x4319: 0x00c0, 0x431a: 0x00c0, 0x431b: 0x00c0, 0x431c: 0x00c0, 0x431d: 0x00c0, + 0x431e: 0x00c0, 0x431f: 0x00c0, 0x4320: 0x00c0, 0x4321: 0x00c0, 0x4322: 0x00c0, 0x4323: 0x00c0, + 0x4324: 0x00c0, 0x4325: 0x00c0, 0x4326: 0x00c0, 0x4327: 0x00c0, 0x4328: 0x00c0, 0x4329: 0x00c0, + 0x432a: 0x00c0, 0x432b: 0x00c0, 0x432c: 0x00c0, 0x432d: 0x00c0, 0x432e: 0x00c0, 0x432f: 0x00c0, + 0x4330: 0x00c3, 0x4331: 0x00c3, 0x4332: 0x00c3, 0x4333: 0x00c3, 0x4334: 0x00c3, 0x4335: 0x00c3, + 0x4336: 0x00c3, 0x4338: 0x00c3, 0x4339: 0x00c3, 0x433a: 0x00c3, 0x433b: 0x00c3, + 0x433c: 0x00c3, 0x433d: 0x00c3, 0x433e: 0x00c0, 0x433f: 0x00c6, + // Block 0x10d, offset 0x4340 + 0x4340: 0x00c0, 0x4341: 0x0080, 0x4342: 0x0080, 0x4343: 0x0080, 0x4344: 0x0080, 0x4345: 0x0080, + 0x4350: 0x00c0, 0x4351: 0x00c0, + 0x4352: 0x00c0, 0x4353: 0x00c0, 0x4354: 0x00c0, 0x4355: 0x00c0, 0x4356: 0x00c0, 0x4357: 0x00c0, + 0x4358: 0x00c0, 0x4359: 0x00c0, 0x435a: 0x0080, 0x435b: 0x0080, 0x435c: 0x0080, 0x435d: 0x0080, + 0x435e: 0x0080, 0x435f: 0x0080, 0x4360: 0x0080, 0x4361: 0x0080, 0x4362: 0x0080, 0x4363: 0x0080, + 0x4364: 0x0080, 0x4365: 0x0080, 0x4366: 0x0080, 0x4367: 0x0080, 0x4368: 0x0080, 0x4369: 0x0080, + 0x436a: 0x0080, 0x436b: 0x0080, 0x436c: 0x0080, + 0x4370: 0x0080, 0x4371: 0x0080, 0x4372: 0x00c0, 0x4373: 0x00c0, 0x4374: 0x00c0, 0x4375: 0x00c0, + 0x4376: 0x00c0, 0x4377: 0x00c0, 0x4378: 0x00c0, 0x4379: 0x00c0, 0x437a: 0x00c0, 0x437b: 0x00c0, + 0x437c: 0x00c0, 0x437d: 0x00c0, 0x437e: 0x00c0, 0x437f: 0x00c0, + // Block 0x10e, offset 0x4380 + 0x4380: 0x00c0, 0x4381: 0x00c0, 0x4382: 0x00c0, 0x4383: 0x00c0, 0x4384: 0x00c0, 0x4385: 0x00c0, + 0x4386: 0x00c0, 0x4387: 0x00c0, 0x4388: 0x00c0, 0x4389: 0x00c0, 0x438a: 0x00c0, 0x438b: 0x00c0, + 0x438c: 0x00c0, 0x438d: 0x00c0, 0x438e: 0x00c0, 0x438f: 0x00c0, + 0x4392: 0x00c3, 0x4393: 0x00c3, 0x4394: 0x00c3, 0x4395: 0x00c3, 0x4396: 0x00c3, 0x4397: 0x00c3, + 0x4398: 0x00c3, 0x4399: 0x00c3, 0x439a: 0x00c3, 0x439b: 0x00c3, 0x439c: 0x00c3, 0x439d: 0x00c3, + 0x439e: 0x00c3, 0x439f: 0x00c3, 0x43a0: 0x00c3, 0x43a1: 0x00c3, 0x43a2: 0x00c3, 0x43a3: 0x00c3, + 0x43a4: 0x00c3, 0x43a5: 0x00c3, 0x43a6: 0x00c3, 0x43a7: 0x00c3, 0x43a9: 0x00c0, + 0x43aa: 0x00c3, 0x43ab: 0x00c3, 0x43ac: 0x00c3, 0x43ad: 0x00c3, 0x43ae: 0x00c3, 0x43af: 0x00c3, + 0x43b0: 0x00c3, 0x43b1: 0x00c0, 0x43b2: 0x00c3, 0x43b3: 0x00c3, 0x43b4: 0x00c0, 0x43b5: 0x00c3, + 0x43b6: 0x00c3, + // Block 0x10f, offset 0x43c0 + 0x43c0: 0x00c0, 0x43c1: 0x00c0, 0x43c2: 0x00c0, 0x43c3: 0x00c0, 0x43c4: 0x00c0, 0x43c5: 0x00c0, + 0x43c6: 0x00c0, 0x43c8: 0x00c0, 0x43c9: 0x00c0, 0x43cb: 0x00c0, + 0x43cc: 0x00c0, 0x43cd: 0x00c0, 0x43ce: 0x00c0, 0x43cf: 0x00c0, 0x43d0: 0x00c0, 0x43d1: 0x00c0, + 0x43d2: 0x00c0, 0x43d3: 0x00c0, 0x43d4: 0x00c0, 0x43d5: 0x00c0, 0x43d6: 0x00c0, 0x43d7: 0x00c0, + 0x43d8: 0x00c0, 0x43d9: 0x00c0, 0x43da: 0x00c0, 0x43db: 0x00c0, 0x43dc: 0x00c0, 0x43dd: 0x00c0, + 0x43de: 0x00c0, 0x43df: 0x00c0, 0x43e0: 0x00c0, 0x43e1: 0x00c0, 0x43e2: 0x00c0, 0x43e3: 0x00c0, + 0x43e4: 0x00c0, 0x43e5: 0x00c0, 0x43e6: 0x00c0, 0x43e7: 0x00c0, 0x43e8: 0x00c0, 0x43e9: 0x00c0, + 0x43ea: 0x00c0, 0x43eb: 0x00c0, 0x43ec: 0x00c0, 0x43ed: 0x00c0, 0x43ee: 0x00c0, 0x43ef: 0x00c0, + 0x43f0: 0x00c0, 0x43f1: 0x00c3, 0x43f2: 0x00c3, 0x43f3: 0x00c3, 0x43f4: 0x00c3, 0x43f5: 0x00c3, + 0x43f6: 0x00c3, 0x43fa: 0x00c3, + 0x43fc: 0x00c3, 0x43fd: 0x00c3, 0x43ff: 0x00c3, + // Block 0x110, offset 0x4400 + 0x4400: 0x00c3, 0x4401: 0x00c3, 0x4402: 0x00c3, 0x4403: 0x00c3, 0x4404: 0x00c6, 0x4405: 0x00c6, + 0x4406: 0x00c0, 0x4407: 0x00c3, + 0x4410: 0x00c0, 0x4411: 0x00c0, + 0x4412: 0x00c0, 0x4413: 0x00c0, 0x4414: 0x00c0, 0x4415: 0x00c0, 0x4416: 0x00c0, 0x4417: 0x00c0, + 0x4418: 0x00c0, 0x4419: 0x00c0, + 0x4420: 0x00c0, 0x4421: 0x00c0, 0x4422: 0x00c0, 0x4423: 0x00c0, + 0x4424: 0x00c0, 0x4425: 0x00c0, 0x4427: 0x00c0, 0x4428: 0x00c0, + 0x442a: 0x00c0, 0x442b: 0x00c0, 0x442c: 0x00c0, 0x442d: 0x00c0, 0x442e: 0x00c0, 0x442f: 0x00c0, + 0x4430: 0x00c0, 0x4431: 0x00c0, 0x4432: 0x00c0, 0x4433: 0x00c0, 0x4434: 0x00c0, 0x4435: 0x00c0, + 0x4436: 0x00c0, 0x4437: 0x00c0, 0x4438: 0x00c0, 0x4439: 0x00c0, 0x443a: 0x00c0, 0x443b: 0x00c0, + 0x443c: 0x00c0, 0x443d: 0x00c0, 0x443e: 0x00c0, 0x443f: 0x00c0, + // Block 0x111, offset 0x4440 + 0x4440: 0x00c0, 0x4441: 0x00c0, 0x4442: 0x00c0, 0x4443: 0x00c0, 0x4444: 0x00c0, 0x4445: 0x00c0, + 0x4446: 0x00c0, 0x4447: 0x00c0, 0x4448: 0x00c0, 0x4449: 0x00c0, 0x444a: 0x00c0, 0x444b: 0x00c0, + 0x444c: 0x00c0, 0x444d: 0x00c0, 0x444e: 0x00c0, 0x4450: 0x00c3, 0x4451: 0x00c3, + 0x4453: 0x00c0, 0x4454: 0x00c0, 0x4455: 0x00c3, 0x4456: 0x00c0, 0x4457: 0x00c6, + 0x4458: 0x00c0, + 0x4460: 0x00c0, 0x4461: 0x00c0, 0x4462: 0x00c0, 0x4463: 0x00c0, + 0x4464: 0x00c0, 0x4465: 0x00c0, 0x4466: 0x00c0, 0x4467: 0x00c0, 0x4468: 0x00c0, 0x4469: 0x00c0, + // Block 0x112, offset 0x4480 + 0x44a0: 0x00c0, 0x44a1: 0x00c0, 0x44a2: 0x00c0, 0x44a3: 0x00c0, + 0x44a4: 0x00c0, 0x44a5: 0x00c0, 0x44a6: 0x00c0, 0x44a7: 0x00c0, 0x44a8: 0x00c0, 0x44a9: 0x00c0, + 0x44aa: 0x00c0, 0x44ab: 0x00c0, 0x44ac: 0x00c0, 0x44ad: 0x00c0, 0x44ae: 0x00c0, 0x44af: 0x00c0, + 0x44b0: 0x00c0, 0x44b1: 0x00c0, 0x44b2: 0x00c0, 0x44b3: 0x00c3, 0x44b4: 0x00c3, 0x44b5: 0x00c0, + 0x44b6: 0x00c0, 0x44b7: 0x0080, 0x44b8: 0x0080, + // Block 0x113, offset 0x44c0 + 0x44c0: 0x00c3, 0x44c1: 0x00c3, 0x44c2: 0x00c0, 0x44c3: 0x00c0, 0x44c4: 0x00c0, 0x44c5: 0x00c0, + 0x44c6: 0x00c0, 0x44c7: 0x00c0, 0x44c8: 0x00c0, 0x44c9: 0x00c0, 0x44ca: 0x00c0, 0x44cb: 0x00c0, + 0x44cc: 0x00c0, 0x44cd: 0x00c0, 0x44ce: 0x00c0, 0x44cf: 0x00c0, 0x44d0: 0x00c0, + 0x44d2: 0x00c0, 0x44d3: 0x00c0, 0x44d4: 0x00c0, 0x44d5: 0x00c0, 0x44d6: 0x00c0, 0x44d7: 0x00c0, + 0x44d8: 0x00c0, 0x44d9: 0x00c0, 0x44da: 0x00c0, 0x44db: 0x00c0, 0x44dc: 0x00c0, 0x44dd: 0x00c0, + 0x44de: 0x00c0, 0x44df: 0x00c0, 0x44e0: 0x00c0, 0x44e1: 0x00c0, 0x44e2: 0x00c0, 0x44e3: 0x00c0, + 0x44e4: 0x00c0, 0x44e5: 0x00c0, 0x44e6: 0x00c0, 0x44e7: 0x00c0, 0x44e8: 0x00c0, 0x44e9: 0x00c0, + 0x44ea: 0x00c0, 0x44eb: 0x00c0, 0x44ec: 0x00c0, 0x44ed: 0x00c0, 0x44ee: 0x00c0, 0x44ef: 0x00c0, + 0x44f0: 0x00c0, 0x44f1: 0x00c0, 0x44f2: 0x00c0, 0x44f3: 0x00c0, 0x44f4: 0x00c0, 0x44f5: 0x00c0, + 0x44f6: 0x00c3, 0x44f7: 0x00c3, 0x44f8: 0x00c3, 0x44f9: 0x00c3, 0x44fa: 0x00c3, + 0x44fe: 0x00c0, 0x44ff: 0x00c0, + // Block 0x114, offset 0x4500 + 0x4500: 0x00c3, 0x4501: 0x00c5, 0x4502: 0x00c6, 0x4503: 0x0080, 0x4504: 0x0080, 0x4505: 0x0080, + 0x4506: 0x0080, 0x4507: 0x0080, 0x4508: 0x0080, 0x4509: 0x0080, 0x450a: 0x0080, 0x450b: 0x0080, + 0x450c: 0x0080, 0x450d: 0x0080, 0x450e: 0x0080, 0x450f: 0x0080, 0x4510: 0x00c0, 0x4511: 0x00c0, + 0x4512: 0x00c0, 0x4513: 0x00c0, 0x4514: 0x00c0, 0x4515: 0x00c0, 0x4516: 0x00c0, 0x4517: 0x00c0, + 0x4518: 0x00c0, 0x4519: 0x00c0, + // Block 0x115, offset 0x4540 + 0x4570: 0x00c0, + // Block 0x116, offset 0x4580 + 0x4580: 0x0080, 0x4581: 0x0080, 0x4582: 0x0080, 0x4583: 0x0080, 0x4584: 0x0080, 0x4585: 0x0080, + 0x4586: 0x0080, 0x4587: 0x0080, 0x4588: 0x0080, 0x4589: 0x0080, 0x458a: 0x0080, 0x458b: 0x0080, + 0x458c: 0x0080, 0x458d: 0x0080, 0x458e: 0x0080, 0x458f: 0x0080, 0x4590: 0x0080, 0x4591: 0x0080, + 0x4592: 0x0080, 0x4593: 0x0080, 0x4594: 0x0080, 0x4595: 0x0080, 0x4596: 0x0080, 0x4597: 0x0080, + 0x4598: 0x0080, 0x4599: 0x0080, 0x459a: 0x0080, 0x459b: 0x0080, 0x459c: 0x0080, 0x459d: 0x0080, + 0x459e: 0x0080, 0x459f: 0x0080, 0x45a0: 0x0080, 0x45a1: 0x0080, 0x45a2: 0x0080, 0x45a3: 0x0080, + 0x45a4: 0x0080, 0x45a5: 0x0080, 0x45a6: 0x0080, 0x45a7: 0x0080, 0x45a8: 0x0080, 0x45a9: 0x0080, + 0x45aa: 0x0080, 0x45ab: 0x0080, 0x45ac: 0x0080, 0x45ad: 0x0080, 0x45ae: 0x0080, 0x45af: 0x0080, + 0x45b0: 0x0080, 0x45b1: 0x0080, + 0x45bf: 0x0080, + // Block 0x117, offset 0x45c0 + 0x45c0: 0x00c0, 0x45c1: 0x00c0, 0x45c2: 0x00c0, 0x45c3: 0x00c0, 0x45c4: 0x00c0, 0x45c5: 0x00c0, + 0x45c6: 0x00c0, 0x45c7: 0x00c0, 0x45c8: 0x00c0, 0x45c9: 0x00c0, 0x45ca: 0x00c0, 0x45cb: 0x00c0, + 0x45cc: 0x00c0, 0x45cd: 0x00c0, 0x45ce: 0x00c0, 0x45cf: 0x00c0, 0x45d0: 0x00c0, 0x45d1: 0x00c0, + 0x45d2: 0x00c0, 0x45d3: 0x00c0, 0x45d4: 0x00c0, 0x45d5: 0x00c0, 0x45d6: 0x00c0, 0x45d7: 0x00c0, + 0x45d8: 0x00c0, 0x45d9: 0x00c0, + // Block 0x118, offset 0x4600 + 0x4600: 0x0080, 0x4601: 0x0080, 0x4602: 0x0080, 0x4603: 0x0080, 0x4604: 0x0080, 0x4605: 0x0080, + 0x4606: 0x0080, 0x4607: 0x0080, 0x4608: 0x0080, 0x4609: 0x0080, 0x460a: 0x0080, 0x460b: 0x0080, + 0x460c: 0x0080, 0x460d: 0x0080, 0x460e: 0x0080, 0x460f: 0x0080, 0x4610: 0x0080, 0x4611: 0x0080, + 0x4612: 0x0080, 0x4613: 0x0080, 0x4614: 0x0080, 0x4615: 0x0080, 0x4616: 0x0080, 0x4617: 0x0080, + 0x4618: 0x0080, 0x4619: 0x0080, 0x461a: 0x0080, 0x461b: 0x0080, 0x461c: 0x0080, 0x461d: 0x0080, + 0x461e: 0x0080, 0x461f: 0x0080, 0x4620: 0x0080, 0x4621: 0x0080, 0x4622: 0x0080, 0x4623: 0x0080, + 0x4624: 0x0080, 0x4625: 0x0080, 0x4626: 0x0080, 0x4627: 0x0080, 0x4628: 0x0080, 0x4629: 0x0080, + 0x462a: 0x0080, 0x462b: 0x0080, 0x462c: 0x0080, 0x462d: 0x0080, 0x462e: 0x0080, + 0x4630: 0x0080, 0x4631: 0x0080, 0x4632: 0x0080, 0x4633: 0x0080, 0x4634: 0x0080, + // Block 0x119, offset 0x4640 + 0x4640: 0x00c0, 0x4641: 0x00c0, 0x4642: 0x00c0, 0x4643: 0x00c0, + // Block 0x11a, offset 0x4680 + 0x4690: 0x00c0, 0x4691: 0x00c0, + 0x4692: 0x00c0, 0x4693: 0x00c0, 0x4694: 0x00c0, 0x4695: 0x00c0, 0x4696: 0x00c0, 0x4697: 0x00c0, + 0x4698: 0x00c0, 0x4699: 0x00c0, 0x469a: 0x00c0, 0x469b: 0x00c0, 0x469c: 0x00c0, 0x469d: 0x00c0, + 0x469e: 0x00c0, 0x469f: 0x00c0, 0x46a0: 0x00c0, 0x46a1: 0x00c0, 0x46a2: 0x00c0, 0x46a3: 0x00c0, + 0x46a4: 0x00c0, 0x46a5: 0x00c0, 0x46a6: 0x00c0, 0x46a7: 0x00c0, 0x46a8: 0x00c0, 0x46a9: 0x00c0, + 0x46aa: 0x00c0, 0x46ab: 0x00c0, 0x46ac: 0x00c0, 0x46ad: 0x00c0, 0x46ae: 0x00c0, 0x46af: 0x00c0, + 0x46b0: 0x00c0, 0x46b1: 0x00c0, 0x46b2: 0x00c0, 0x46b3: 0x00c0, 0x46b4: 0x00c0, 0x46b5: 0x00c0, + 0x46b6: 0x00c0, 0x46b7: 0x00c0, 0x46b8: 0x00c0, 0x46b9: 0x00c0, 0x46ba: 0x00c0, 0x46bb: 0x00c0, + 0x46bc: 0x00c0, 0x46bd: 0x00c0, 0x46be: 0x00c0, 0x46bf: 0x00c0, + // Block 0x11b, offset 0x46c0 + 0x46c0: 0x00c0, 0x46c1: 0x00c0, 0x46c2: 0x00c0, 0x46c3: 0x00c0, 0x46c4: 0x00c0, 0x46c5: 0x00c0, + 0x46c6: 0x00c0, 0x46c7: 0x00c0, 0x46c8: 0x00c0, 0x46c9: 0x00c0, 0x46ca: 0x00c0, 0x46cb: 0x00c0, + 0x46cc: 0x00c0, 0x46cd: 0x00c0, 0x46ce: 0x00c0, 0x46cf: 0x00c0, 0x46d0: 0x00c0, 0x46d1: 0x00c0, + 0x46d2: 0x00c0, 0x46d3: 0x00c0, 0x46d4: 0x00c0, 0x46d5: 0x00c0, 0x46d6: 0x00c0, 0x46d7: 0x00c0, + 0x46d8: 0x00c0, 0x46d9: 0x00c0, 0x46da: 0x00c0, 0x46db: 0x00c0, 0x46dc: 0x00c0, 0x46dd: 0x00c0, + 0x46de: 0x00c0, 0x46df: 0x00c0, 0x46e0: 0x00c0, 0x46e1: 0x00c0, 0x46e2: 0x00c0, 0x46e3: 0x00c0, + 0x46e4: 0x00c0, 0x46e5: 0x00c0, 0x46e6: 0x00c0, 0x46e7: 0x00c0, 0x46e8: 0x00c0, 0x46e9: 0x00c0, + 0x46ea: 0x00c0, 0x46eb: 0x00c0, 0x46ec: 0x00c0, 0x46ed: 0x00c0, 0x46ee: 0x00c0, 0x46ef: 0x00c0, + 0x46f0: 0x00c0, 0x46f1: 0x0080, 0x46f2: 0x0080, + // Block 0x11c, offset 0x4700 + 0x4700: 0x00c0, 0x4701: 0x00c0, 0x4702: 0x00c0, 0x4703: 0x00c0, 0x4704: 0x00c0, 0x4705: 0x00c0, + 0x4706: 0x00c0, 0x4707: 0x00c0, 0x4708: 0x00c0, 0x4709: 0x00c0, 0x470a: 0x00c0, 0x470b: 0x00c0, + 0x470c: 0x00c0, 0x470d: 0x00c0, 0x470e: 0x00c0, 0x470f: 0x00c0, 0x4710: 0x00c0, 0x4711: 0x00c0, + 0x4712: 0x00c0, 0x4713: 0x00c0, 0x4714: 0x00c0, 0x4715: 0x00c0, 0x4716: 0x00c0, 0x4717: 0x00c0, + 0x4718: 0x00c0, 0x4719: 0x00c0, 0x471a: 0x00c0, 0x471b: 0x00c0, 0x471c: 0x00c0, 0x471d: 0x00c0, + 0x471e: 0x00c0, 0x471f: 0x00c0, 0x4720: 0x00c0, 0x4721: 0x00c0, 0x4722: 0x00c0, 0x4723: 0x00c0, + 0x4724: 0x00c0, 0x4725: 0x00c0, 0x4726: 0x00c0, 0x4727: 0x00c0, 0x4728: 0x00c0, 0x4729: 0x00c0, + 0x472a: 0x00c0, 0x472b: 0x00c0, 0x472c: 0x00c0, 0x472d: 0x00c0, 0x472e: 0x00c0, 0x472f: 0x00c0, + 0x4730: 0x0040, 0x4731: 0x0040, 0x4732: 0x0040, 0x4733: 0x0040, 0x4734: 0x0040, 0x4735: 0x0040, + 0x4736: 0x0040, 0x4737: 0x0040, 0x4738: 0x0040, 0x4739: 0x0040, 0x473a: 0x0040, 0x473b: 0x0040, + 0x473c: 0x0040, 0x473d: 0x0040, 0x473e: 0x0040, 0x473f: 0x0040, + // Block 0x11d, offset 0x4740 + 0x4740: 0x00c3, 0x4741: 0x00c0, 0x4742: 0x00c0, 0x4743: 0x00c0, 0x4744: 0x00c0, 0x4745: 0x00c0, + 0x4746: 0x00c0, 0x4747: 0x00c3, 0x4748: 0x00c3, 0x4749: 0x00c3, 0x474a: 0x00c3, 0x474b: 0x00c3, + 0x474c: 0x00c3, 0x474d: 0x00c3, 0x474e: 0x00c3, 0x474f: 0x00c3, 0x4750: 0x00c3, 0x4751: 0x00c3, + 0x4752: 0x00c3, 0x4753: 0x00c3, 0x4754: 0x00c3, 0x4755: 0x00c3, + // Block 0x11e, offset 0x4780 + 0x4780: 0x00c0, 0x4781: 0x00c0, 0x4782: 0x00c0, 0x4783: 0x00c0, 0x4784: 0x00c0, 0x4785: 0x00c0, + 0x4786: 0x00c0, 0x4787: 0x00c0, 0x4788: 0x00c0, 0x4789: 0x00c0, 0x478a: 0x00c0, 0x478b: 0x00c0, + 0x478c: 0x00c0, 0x478d: 0x00c0, 0x478e: 0x00c0, 0x478f: 0x00c0, 0x4790: 0x00c0, 0x4791: 0x00c0, + 0x4792: 0x00c0, 0x4793: 0x00c0, 0x4794: 0x00c0, 0x4795: 0x00c0, 0x4796: 0x00c0, 0x4797: 0x00c0, + 0x4798: 0x00c0, 0x4799: 0x00c0, 0x479a: 0x00c0, 0x479b: 0x00c0, 0x479c: 0x00c0, 0x479d: 0x00c0, + 0x479e: 0x00c0, 0x47a0: 0x00c0, 0x47a1: 0x00c0, 0x47a2: 0x00c0, 0x47a3: 0x00c0, + 0x47a4: 0x00c0, 0x47a5: 0x00c0, 0x47a6: 0x00c0, 0x47a7: 0x00c0, 0x47a8: 0x00c0, 0x47a9: 0x00c0, + 0x47ae: 0x0080, 0x47af: 0x0080, + 0x47b0: 0x00c0, 0x47b1: 0x00c0, 0x47b2: 0x00c0, 0x47b3: 0x00c0, 0x47b4: 0x00c0, 0x47b5: 0x00c0, + 0x47b6: 0x00c0, 0x47b7: 0x00c0, 0x47b8: 0x00c0, 0x47b9: 0x00c0, 0x47ba: 0x00c0, 0x47bb: 0x00c0, + 0x47bc: 0x00c0, 0x47bd: 0x00c0, 0x47be: 0x00c0, 0x47bf: 0x00c0, + // Block 0x11f, offset 0x47c0 + 0x47c0: 0x00c0, 0x47c1: 0x00c0, 0x47c2: 0x00c0, 0x47c3: 0x00c0, 0x47c4: 0x00c0, 0x47c5: 0x00c0, + 0x47c6: 0x00c0, 0x47c7: 0x00c0, 0x47c8: 0x00c0, 0x47c9: 0x00c0, 0x47ca: 0x00c0, 0x47cb: 0x00c0, + 0x47cc: 0x00c0, 0x47cd: 0x00c0, 0x47ce: 0x00c0, 0x47cf: 0x00c0, 0x47d0: 0x00c0, 0x47d1: 0x00c0, + 0x47d2: 0x00c0, 0x47d3: 0x00c0, 0x47d4: 0x00c0, 0x47d5: 0x00c0, 0x47d6: 0x00c0, 0x47d7: 0x00c0, + 0x47d8: 0x00c0, 0x47d9: 0x00c0, 0x47da: 0x00c0, 0x47db: 0x00c0, 0x47dc: 0x00c0, 0x47dd: 0x00c0, + 0x47de: 0x00c0, 0x47df: 0x00c0, 0x47e0: 0x00c0, 0x47e1: 0x00c0, 0x47e2: 0x00c0, 0x47e3: 0x00c0, + 0x47e4: 0x00c0, 0x47e5: 0x00c0, 0x47e6: 0x00c0, 0x47e7: 0x00c0, 0x47e8: 0x00c0, 0x47e9: 0x00c0, + 0x47ea: 0x00c0, 0x47eb: 0x00c0, 0x47ec: 0x00c0, 0x47ed: 0x00c0, 0x47ee: 0x00c0, 0x47ef: 0x00c0, + 0x47f0: 0x00c0, 0x47f1: 0x00c0, 0x47f2: 0x00c0, 0x47f3: 0x00c0, 0x47f4: 0x00c0, 0x47f5: 0x00c0, + 0x47f6: 0x00c0, 0x47f7: 0x00c0, 0x47f8: 0x00c0, 0x47f9: 0x00c0, 0x47fa: 0x00c0, 0x47fb: 0x00c0, + 0x47fc: 0x00c0, 0x47fd: 0x00c0, 0x47fe: 0x00c0, + // Block 0x120, offset 0x4800 + 0x4800: 0x00c0, 0x4801: 0x00c0, 0x4802: 0x00c0, 0x4803: 0x00c0, 0x4804: 0x00c0, 0x4805: 0x00c0, + 0x4806: 0x00c0, 0x4807: 0x00c0, 0x4808: 0x00c0, 0x4809: 0x00c0, + 0x4810: 0x00c0, 0x4811: 0x00c0, + 0x4812: 0x00c0, 0x4813: 0x00c0, 0x4814: 0x00c0, 0x4815: 0x00c0, 0x4816: 0x00c0, 0x4817: 0x00c0, + 0x4818: 0x00c0, 0x4819: 0x00c0, 0x481a: 0x00c0, 0x481b: 0x00c0, 0x481c: 0x00c0, 0x481d: 0x00c0, + 0x481e: 0x00c0, 0x481f: 0x00c0, 0x4820: 0x00c0, 0x4821: 0x00c0, 0x4822: 0x00c0, 0x4823: 0x00c0, + 0x4824: 0x00c0, 0x4825: 0x00c0, 0x4826: 0x00c0, 0x4827: 0x00c0, 0x4828: 0x00c0, 0x4829: 0x00c0, + 0x482a: 0x00c0, 0x482b: 0x00c0, 0x482c: 0x00c0, 0x482d: 0x00c0, + 0x4830: 0x00c3, 0x4831: 0x00c3, 0x4832: 0x00c3, 0x4833: 0x00c3, 0x4834: 0x00c3, 0x4835: 0x0080, + // Block 0x121, offset 0x4840 + 0x4840: 0x00c0, 0x4841: 0x00c0, 0x4842: 0x00c0, 0x4843: 0x00c0, 0x4844: 0x00c0, 0x4845: 0x00c0, + 0x4846: 0x00c0, 0x4847: 0x00c0, 0x4848: 0x00c0, 0x4849: 0x00c0, 0x484a: 0x00c0, 0x484b: 0x00c0, + 0x484c: 0x00c0, 0x484d: 0x00c0, 0x484e: 0x00c0, 0x484f: 0x00c0, 0x4850: 0x00c0, 0x4851: 0x00c0, + 0x4852: 0x00c0, 0x4853: 0x00c0, 0x4854: 0x00c0, 0x4855: 0x00c0, 0x4856: 0x00c0, 0x4857: 0x00c0, + 0x4858: 0x00c0, 0x4859: 0x00c0, 0x485a: 0x00c0, 0x485b: 0x00c0, 0x485c: 0x00c0, 0x485d: 0x00c0, + 0x485e: 0x00c0, 0x485f: 0x00c0, 0x4860: 0x00c0, 0x4861: 0x00c0, 0x4862: 0x00c0, 0x4863: 0x00c0, + 0x4864: 0x00c0, 0x4865: 0x00c0, 0x4866: 0x00c0, 0x4867: 0x00c0, 0x4868: 0x00c0, 0x4869: 0x00c0, + 0x486a: 0x00c0, 0x486b: 0x00c0, 0x486c: 0x00c0, 0x486d: 0x00c0, 0x486e: 0x00c0, 0x486f: 0x00c0, + 0x4870: 0x00c3, 0x4871: 0x00c3, 0x4872: 0x00c3, 0x4873: 0x00c3, 0x4874: 0x00c3, 0x4875: 0x00c3, + 0x4876: 0x00c3, 0x4877: 0x0080, 0x4878: 0x0080, 0x4879: 0x0080, 0x487a: 0x0080, 0x487b: 0x0080, + 0x487c: 0x0080, 0x487d: 0x0080, 0x487e: 0x0080, 0x487f: 0x0080, + // Block 0x122, offset 0x4880 + 0x4880: 0x00c0, 0x4881: 0x00c0, 0x4882: 0x00c0, 0x4883: 0x00c0, 0x4884: 0x0080, 0x4885: 0x0080, + 0x4890: 0x00c0, 0x4891: 0x00c0, + 0x4892: 0x00c0, 0x4893: 0x00c0, 0x4894: 0x00c0, 0x4895: 0x00c0, 0x4896: 0x00c0, 0x4897: 0x00c0, + 0x4898: 0x00c0, 0x4899: 0x00c0, 0x489b: 0x0080, 0x489c: 0x0080, 0x489d: 0x0080, + 0x489e: 0x0080, 0x489f: 0x0080, 0x48a0: 0x0080, 0x48a1: 0x0080, 0x48a3: 0x00c0, + 0x48a4: 0x00c0, 0x48a5: 0x00c0, 0x48a6: 0x00c0, 0x48a7: 0x00c0, 0x48a8: 0x00c0, 0x48a9: 0x00c0, + 0x48aa: 0x00c0, 0x48ab: 0x00c0, 0x48ac: 0x00c0, 0x48ad: 0x00c0, 0x48ae: 0x00c0, 0x48af: 0x00c0, + 0x48b0: 0x00c0, 0x48b1: 0x00c0, 0x48b2: 0x00c0, 0x48b3: 0x00c0, 0x48b4: 0x00c0, 0x48b5: 0x00c0, + 0x48b6: 0x00c0, 0x48b7: 0x00c0, + 0x48bd: 0x00c0, 0x48be: 0x00c0, 0x48bf: 0x00c0, + // Block 0x123, offset 0x48c0 + 0x48c0: 0x00c0, 0x48c1: 0x00c0, 0x48c2: 0x00c0, 0x48c3: 0x00c0, 0x48c4: 0x00c0, 0x48c5: 0x00c0, + 0x48c6: 0x00c0, 0x48c7: 0x00c0, 0x48c8: 0x00c0, 0x48c9: 0x00c0, 0x48ca: 0x00c0, 0x48cb: 0x00c0, + 0x48cc: 0x00c0, 0x48cd: 0x00c0, 0x48ce: 0x00c0, 0x48cf: 0x00c0, + // Block 0x124, offset 0x4900 + 0x4900: 0x0080, 0x4901: 0x0080, 0x4902: 0x0080, 0x4903: 0x0080, 0x4904: 0x0080, 0x4905: 0x0080, + 0x4906: 0x0080, 0x4907: 0x0080, 0x4908: 0x0080, 0x4909: 0x0080, 0x490a: 0x0080, 0x490b: 0x0080, + 0x490c: 0x0080, 0x490d: 0x0080, 0x490e: 0x0080, 0x490f: 0x0080, 0x4910: 0x0080, 0x4911: 0x0080, + 0x4912: 0x0080, 0x4913: 0x0080, 0x4914: 0x0080, 0x4915: 0x0080, 0x4916: 0x0080, 0x4917: 0x0080, + 0x4918: 0x0080, 0x4919: 0x0080, 0x491a: 0x0080, + // Block 0x125, offset 0x4940 + 0x4940: 0x00c0, 0x4941: 0x00c0, 0x4942: 0x00c0, 0x4943: 0x00c0, 0x4944: 0x00c0, 0x4945: 0x00c0, + 0x4946: 0x00c0, 0x4947: 0x00c0, 0x4948: 0x00c0, 0x4949: 0x00c0, 0x494a: 0x00c0, + 0x494f: 0x00c3, 0x4950: 0x00c0, 0x4951: 0x00c0, + 0x4952: 0x00c0, 0x4953: 0x00c0, 0x4954: 0x00c0, 0x4955: 0x00c0, 0x4956: 0x00c0, 0x4957: 0x00c0, + 0x4958: 0x00c0, 0x4959: 0x00c0, 0x495a: 0x00c0, 0x495b: 0x00c0, 0x495c: 0x00c0, 0x495d: 0x00c0, + 0x495e: 0x00c0, 0x495f: 0x00c0, 0x4960: 0x00c0, 0x4961: 0x00c0, 0x4962: 0x00c0, 0x4963: 0x00c0, + 0x4964: 0x00c0, 0x4965: 0x00c0, 0x4966: 0x00c0, 0x4967: 0x00c0, 0x4968: 0x00c0, 0x4969: 0x00c0, + 0x496a: 0x00c0, 0x496b: 0x00c0, 0x496c: 0x00c0, 0x496d: 0x00c0, 0x496e: 0x00c0, 0x496f: 0x00c0, + 0x4970: 0x00c0, 0x4971: 0x00c0, 0x4972: 0x00c0, 0x4973: 0x00c0, 0x4974: 0x00c0, 0x4975: 0x00c0, + 0x4976: 0x00c0, 0x4977: 0x00c0, 0x4978: 0x00c0, 0x4979: 0x00c0, 0x497a: 0x00c0, 0x497b: 0x00c0, + 0x497c: 0x00c0, 0x497d: 0x00c0, 0x497e: 0x00c0, 0x497f: 0x00c0, + // Block 0x126, offset 0x4980 + 0x4980: 0x00c0, 0x4981: 0x00c0, 0x4982: 0x00c0, 0x4983: 0x00c0, 0x4984: 0x00c0, 0x4985: 0x00c0, + 0x4986: 0x00c0, 0x4987: 0x00c0, + 0x498f: 0x00c3, 0x4990: 0x00c3, 0x4991: 0x00c3, + 0x4992: 0x00c3, 0x4993: 0x00c0, 0x4994: 0x00c0, 0x4995: 0x00c0, 0x4996: 0x00c0, 0x4997: 0x00c0, + 0x4998: 0x00c0, 0x4999: 0x00c0, 0x499a: 0x00c0, 0x499b: 0x00c0, 0x499c: 0x00c0, 0x499d: 0x00c0, + 0x499e: 0x00c0, 0x499f: 0x00c0, + // Block 0x127, offset 0x49c0 + 0x49e0: 0x00c0, 0x49e1: 0x00c0, 0x49e2: 0x008c, 0x49e3: 0x00cc, + 0x49e4: 0x00c3, + 0x49f0: 0x00cc, 0x49f1: 0x00cc, + // Block 0x128, offset 0x4a00 + 0x4a00: 0x00c0, 0x4a01: 0x00c0, 0x4a02: 0x00c0, 0x4a03: 0x00c0, 0x4a04: 0x00c0, 0x4a05: 0x00c0, + 0x4a06: 0x00c0, 0x4a07: 0x00c0, 0x4a08: 0x00c0, 0x4a09: 0x00c0, 0x4a0a: 0x00c0, 0x4a0b: 0x00c0, + 0x4a0c: 0x00c0, 0x4a0d: 0x00c0, 0x4a0e: 0x00c0, 0x4a0f: 0x00c0, 0x4a10: 0x00c0, 0x4a11: 0x00c0, + 0x4a12: 0x00c0, 0x4a13: 0x00c0, 0x4a14: 0x00c0, 0x4a15: 0x00c0, 0x4a16: 0x00c0, 0x4a17: 0x00c0, + 0x4a18: 0x00c0, 0x4a19: 0x00c0, 0x4a1a: 0x00c0, 0x4a1b: 0x00c0, 0x4a1c: 0x00c0, 0x4a1d: 0x00c0, + 0x4a1e: 0x00c0, 0x4a1f: 0x00c0, 0x4a20: 0x00c0, 0x4a21: 0x00c0, 0x4a22: 0x00c0, 0x4a23: 0x00c0, + 0x4a24: 0x00c0, 0x4a25: 0x00c0, 0x4a26: 0x00c0, 0x4a27: 0x00c0, 0x4a28: 0x00c0, 0x4a29: 0x00c0, + 0x4a2a: 0x00c0, 0x4a2b: 0x00c0, 0x4a2c: 0x00c0, 0x4a2d: 0x00c0, 0x4a2e: 0x00c0, 0x4a2f: 0x00c0, + 0x4a30: 0x00c0, 0x4a31: 0x00c0, 0x4a32: 0x00c0, 0x4a33: 0x00c0, 0x4a34: 0x00c0, 0x4a35: 0x00c0, + 0x4a36: 0x00c0, 0x4a37: 0x00c0, + // Block 0x129, offset 0x4a40 + 0x4a40: 0x00c0, 0x4a41: 0x00c0, 0x4a42: 0x00c0, 0x4a43: 0x00c0, 0x4a44: 0x00c0, 0x4a45: 0x00c0, + 0x4a46: 0x00c0, 0x4a47: 0x00c0, 0x4a48: 0x00c0, 0x4a49: 0x00c0, 0x4a4a: 0x00c0, 0x4a4b: 0x00c0, + 0x4a4c: 0x00c0, 0x4a4d: 0x00c0, 0x4a4e: 0x00c0, 0x4a4f: 0x00c0, 0x4a50: 0x00c0, 0x4a51: 0x00c0, + 0x4a52: 0x00c0, 0x4a53: 0x00c0, 0x4a54: 0x00c0, 0x4a55: 0x00c0, + // Block 0x12a, offset 0x4a80 + 0x4ab0: 0x00cc, 0x4ab1: 0x00cc, 0x4ab2: 0x00cc, 0x4ab3: 0x00cc, 0x4ab5: 0x00cc, + 0x4ab6: 0x00cc, 0x4ab7: 0x00cc, 0x4ab8: 0x00cc, 0x4ab9: 0x00cc, 0x4aba: 0x00cc, 0x4abb: 0x00cc, + 0x4abd: 0x00cc, 0x4abe: 0x00cc, + // Block 0x12b, offset 0x4ac0 + 0x4ac0: 0x00cc, 0x4ac1: 0x00cc, 0x4ac2: 0x00cc, 0x4ac3: 0x00cc, 0x4ac4: 0x00cc, 0x4ac5: 0x00cc, + 0x4ac6: 0x00cc, 0x4ac7: 0x00cc, 0x4ac8: 0x00cc, 0x4ac9: 0x00cc, 0x4aca: 0x00cc, 0x4acb: 0x00cc, + 0x4acc: 0x00cc, 0x4acd: 0x00cc, 0x4ace: 0x00cc, 0x4acf: 0x00cc, 0x4ad0: 0x00cc, 0x4ad1: 0x00cc, + 0x4ad2: 0x00cc, 0x4ad3: 0x00cc, 0x4ad4: 0x00cc, 0x4ad5: 0x00cc, 0x4ad6: 0x00cc, 0x4ad7: 0x00cc, + 0x4ad8: 0x00cc, 0x4ad9: 0x00cc, 0x4ada: 0x00cc, 0x4adb: 0x00cc, 0x4adc: 0x00cc, 0x4add: 0x00cc, + 0x4ade: 0x00cc, 0x4adf: 0x00cc, 0x4ae0: 0x00cc, 0x4ae1: 0x00cc, 0x4ae2: 0x00cc, + 0x4af2: 0x00cc, + // Block 0x12c, offset 0x4b00 + 0x4b10: 0x00cc, 0x4b11: 0x00cc, + 0x4b12: 0x00cc, 0x4b15: 0x00cc, + 0x4b24: 0x00cc, 0x4b25: 0x00cc, 0x4b26: 0x00cc, 0x4b27: 0x00cc, + 0x4b30: 0x00c0, 0x4b31: 0x00c0, 0x4b32: 0x00c0, 0x4b33: 0x00c0, 0x4b34: 0x00c0, 0x4b35: 0x00c0, + 0x4b36: 0x00c0, 0x4b37: 0x00c0, 0x4b38: 0x00c0, 0x4b39: 0x00c0, 0x4b3a: 0x00c0, 0x4b3b: 0x00c0, + 0x4b3c: 0x00c0, 0x4b3d: 0x00c0, 0x4b3e: 0x00c0, 0x4b3f: 0x00c0, + // Block 0x12d, offset 0x4b40 + 0x4b40: 0x00c0, 0x4b41: 0x00c0, 0x4b42: 0x00c0, 0x4b43: 0x00c0, 0x4b44: 0x00c0, 0x4b45: 0x00c0, + 0x4b46: 0x00c0, 0x4b47: 0x00c0, 0x4b48: 0x00c0, 0x4b49: 0x00c0, 0x4b4a: 0x00c0, 0x4b4b: 0x00c0, + 0x4b4c: 0x00c0, 0x4b4d: 0x00c0, 0x4b4e: 0x00c0, 0x4b4f: 0x00c0, 0x4b50: 0x00c0, 0x4b51: 0x00c0, + 0x4b52: 0x00c0, 0x4b53: 0x00c0, 0x4b54: 0x00c0, 0x4b55: 0x00c0, 0x4b56: 0x00c0, 0x4b57: 0x00c0, + 0x4b58: 0x00c0, 0x4b59: 0x00c0, 0x4b5a: 0x00c0, 0x4b5b: 0x00c0, 0x4b5c: 0x00c0, 0x4b5d: 0x00c0, + 0x4b5e: 0x00c0, 0x4b5f: 0x00c0, 0x4b60: 0x00c0, 0x4b61: 0x00c0, 0x4b62: 0x00c0, 0x4b63: 0x00c0, + 0x4b64: 0x00c0, 0x4b65: 0x00c0, 0x4b66: 0x00c0, 0x4b67: 0x00c0, 0x4b68: 0x00c0, 0x4b69: 0x00c0, + 0x4b6a: 0x00c0, 0x4b6b: 0x00c0, 0x4b6c: 0x00c0, 0x4b6d: 0x00c0, 0x4b6e: 0x00c0, 0x4b6f: 0x00c0, + 0x4b70: 0x00c0, 0x4b71: 0x00c0, 0x4b72: 0x00c0, 0x4b73: 0x00c0, 0x4b74: 0x00c0, 0x4b75: 0x00c0, + 0x4b76: 0x00c0, 0x4b77: 0x00c0, 0x4b78: 0x00c0, 0x4b79: 0x00c0, 0x4b7a: 0x00c0, 0x4b7b: 0x00c0, + // Block 0x12e, offset 0x4b80 + 0x4b80: 0x00c0, 0x4b81: 0x00c0, 0x4b82: 0x00c0, 0x4b83: 0x00c0, 0x4b84: 0x00c0, 0x4b85: 0x00c0, + 0x4b86: 0x00c0, 0x4b87: 0x00c0, 0x4b88: 0x00c0, 0x4b89: 0x00c0, 0x4b8a: 0x00c0, 0x4b8b: 0x00c0, + 0x4b8c: 0x00c0, 0x4b8d: 0x00c0, 0x4b8e: 0x00c0, 0x4b8f: 0x00c0, 0x4b90: 0x00c0, 0x4b91: 0x00c0, + 0x4b92: 0x00c0, 0x4b93: 0x00c0, 0x4b94: 0x00c0, 0x4b95: 0x00c0, 0x4b96: 0x00c0, 0x4b97: 0x00c0, + 0x4b98: 0x00c0, 0x4b99: 0x00c0, 0x4b9a: 0x00c0, 0x4b9b: 0x00c0, 0x4b9c: 0x00c0, 0x4b9d: 0x00c0, + 0x4b9e: 0x00c0, 0x4b9f: 0x00c0, 0x4ba0: 0x00c0, 0x4ba1: 0x00c0, 0x4ba2: 0x00c0, 0x4ba3: 0x00c0, + 0x4ba4: 0x00c0, 0x4ba5: 0x00c0, 0x4ba6: 0x00c0, 0x4ba7: 0x00c0, 0x4ba8: 0x00c0, 0x4ba9: 0x00c0, + 0x4baa: 0x00c0, + 0x4bb0: 0x00c0, 0x4bb1: 0x00c0, 0x4bb2: 0x00c0, 0x4bb3: 0x00c0, 0x4bb4: 0x00c0, 0x4bb5: 0x00c0, + 0x4bb6: 0x00c0, 0x4bb7: 0x00c0, 0x4bb8: 0x00c0, 0x4bb9: 0x00c0, 0x4bba: 0x00c0, 0x4bbb: 0x00c0, + 0x4bbc: 0x00c0, + // Block 0x12f, offset 0x4bc0 + 0x4bc0: 0x00c0, 0x4bc1: 0x00c0, 0x4bc2: 0x00c0, 0x4bc3: 0x00c0, 0x4bc4: 0x00c0, 0x4bc5: 0x00c0, + 0x4bc6: 0x00c0, 0x4bc7: 0x00c0, 0x4bc8: 0x00c0, + 0x4bd0: 0x00c0, 0x4bd1: 0x00c0, + 0x4bd2: 0x00c0, 0x4bd3: 0x00c0, 0x4bd4: 0x00c0, 0x4bd5: 0x00c0, 0x4bd6: 0x00c0, 0x4bd7: 0x00c0, + 0x4bd8: 0x00c0, 0x4bd9: 0x00c0, 0x4bdc: 0x0080, 0x4bdd: 0x00c3, + 0x4bde: 0x00c3, 0x4bdf: 0x0080, 0x4be0: 0x0040, 0x4be1: 0x0040, 0x4be2: 0x0040, 0x4be3: 0x0040, + // Block 0x130, offset 0x4c00 + 0x4c00: 0x00c3, 0x4c01: 0x00c3, 0x4c02: 0x00c3, 0x4c03: 0x00c3, 0x4c04: 0x00c3, 0x4c05: 0x00c3, + 0x4c06: 0x00c3, 0x4c07: 0x00c3, 0x4c08: 0x00c3, 0x4c09: 0x00c3, 0x4c0a: 0x00c3, 0x4c0b: 0x00c3, + 0x4c0c: 0x00c3, 0x4c0d: 0x00c3, 0x4c0e: 0x00c3, 0x4c0f: 0x00c3, 0x4c10: 0x00c3, 0x4c11: 0x00c3, + 0x4c12: 0x00c3, 0x4c13: 0x00c3, 0x4c14: 0x00c3, 0x4c15: 0x00c3, 0x4c16: 0x00c3, 0x4c17: 0x00c3, + 0x4c18: 0x00c3, 0x4c19: 0x00c3, 0x4c1a: 0x00c3, 0x4c1b: 0x00c3, 0x4c1c: 0x00c3, 0x4c1d: 0x00c3, + 0x4c1e: 0x00c3, 0x4c1f: 0x00c3, 0x4c20: 0x00c3, 0x4c21: 0x00c3, 0x4c22: 0x00c3, 0x4c23: 0x00c3, + 0x4c24: 0x00c3, 0x4c25: 0x00c3, 0x4c26: 0x00c3, 0x4c27: 0x00c3, 0x4c28: 0x00c3, 0x4c29: 0x00c3, + 0x4c2a: 0x00c3, 0x4c2b: 0x00c3, 0x4c2c: 0x00c3, 0x4c2d: 0x00c3, + 0x4c30: 0x00c3, 0x4c31: 0x00c3, 0x4c32: 0x00c3, 0x4c33: 0x00c3, 0x4c34: 0x00c3, 0x4c35: 0x00c3, + 0x4c36: 0x00c3, 0x4c37: 0x00c3, 0x4c38: 0x00c3, 0x4c39: 0x00c3, 0x4c3a: 0x00c3, 0x4c3b: 0x00c3, + 0x4c3c: 0x00c3, 0x4c3d: 0x00c3, 0x4c3e: 0x00c3, 0x4c3f: 0x00c3, + // Block 0x131, offset 0x4c40 + 0x4c40: 0x00c3, 0x4c41: 0x00c3, 0x4c42: 0x00c3, 0x4c43: 0x00c3, 0x4c44: 0x00c3, 0x4c45: 0x00c3, + 0x4c46: 0x00c3, + 0x4c50: 0x0080, 0x4c51: 0x0080, + 0x4c52: 0x0080, 0x4c53: 0x0080, 0x4c54: 0x0080, 0x4c55: 0x0080, 0x4c56: 0x0080, 0x4c57: 0x0080, + 0x4c58: 0x0080, 0x4c59: 0x0080, 0x4c5a: 0x0080, 0x4c5b: 0x0080, 0x4c5c: 0x0080, 0x4c5d: 0x0080, + 0x4c5e: 0x0080, 0x4c5f: 0x0080, 0x4c60: 0x0080, 0x4c61: 0x0080, 0x4c62: 0x0080, 0x4c63: 0x0080, + 0x4c64: 0x0080, 0x4c65: 0x0080, 0x4c66: 0x0080, 0x4c67: 0x0080, 0x4c68: 0x0080, 0x4c69: 0x0080, + 0x4c6a: 0x0080, 0x4c6b: 0x0080, 0x4c6c: 0x0080, 0x4c6d: 0x0080, 0x4c6e: 0x0080, 0x4c6f: 0x0080, + 0x4c70: 0x0080, 0x4c71: 0x0080, 0x4c72: 0x0080, 0x4c73: 0x0080, 0x4c74: 0x0080, 0x4c75: 0x0080, + 0x4c76: 0x0080, 0x4c77: 0x0080, 0x4c78: 0x0080, 0x4c79: 0x0080, 0x4c7a: 0x0080, 0x4c7b: 0x0080, + 0x4c7c: 0x0080, 0x4c7d: 0x0080, 0x4c7e: 0x0080, 0x4c7f: 0x0080, + // Block 0x132, offset 0x4c80 + 0x4c80: 0x0080, 0x4c81: 0x0080, 0x4c82: 0x0080, 0x4c83: 0x0080, + // Block 0x133, offset 0x4cc0 + 0x4cc0: 0x0080, 0x4cc1: 0x0080, 0x4cc2: 0x0080, 0x4cc3: 0x0080, 0x4cc4: 0x0080, 0x4cc5: 0x0080, + 0x4cc6: 0x0080, 0x4cc7: 0x0080, 0x4cc8: 0x0080, 0x4cc9: 0x0080, 0x4cca: 0x0080, 0x4ccb: 0x0080, + 0x4ccc: 0x0080, 0x4ccd: 0x0080, 0x4cce: 0x0080, 0x4ccf: 0x0080, 0x4cd0: 0x0080, 0x4cd1: 0x0080, + 0x4cd2: 0x0080, 0x4cd3: 0x0080, 0x4cd4: 0x0080, 0x4cd5: 0x0080, 0x4cd6: 0x0080, 0x4cd7: 0x0080, + 0x4cd8: 0x0080, 0x4cd9: 0x0080, 0x4cda: 0x0080, 0x4cdb: 0x0080, 0x4cdc: 0x0080, 0x4cdd: 0x0080, + 0x4cde: 0x0080, 0x4cdf: 0x0080, 0x4ce0: 0x0080, 0x4ce1: 0x0080, 0x4ce2: 0x0080, 0x4ce3: 0x0080, + 0x4ce4: 0x0080, 0x4ce5: 0x0080, 0x4ce6: 0x0080, 0x4ce7: 0x0080, 0x4ce8: 0x0080, 0x4ce9: 0x0080, + 0x4cea: 0x0080, 0x4ceb: 0x0080, 0x4cec: 0x0080, 0x4ced: 0x0080, 0x4cee: 0x0080, 0x4cef: 0x0080, + 0x4cf0: 0x0080, 0x4cf1: 0x0080, 0x4cf2: 0x0080, 0x4cf3: 0x0080, 0x4cf4: 0x0080, 0x4cf5: 0x0080, + // Block 0x134, offset 0x4d00 + 0x4d00: 0x0080, 0x4d01: 0x0080, 0x4d02: 0x0080, 0x4d03: 0x0080, 0x4d04: 0x0080, 0x4d05: 0x0080, + 0x4d06: 0x0080, 0x4d07: 0x0080, 0x4d08: 0x0080, 0x4d09: 0x0080, 0x4d0a: 0x0080, 0x4d0b: 0x0080, + 0x4d0c: 0x0080, 0x4d0d: 0x0080, 0x4d0e: 0x0080, 0x4d0f: 0x0080, 0x4d10: 0x0080, 0x4d11: 0x0080, + 0x4d12: 0x0080, 0x4d13: 0x0080, 0x4d14: 0x0080, 0x4d15: 0x0080, 0x4d16: 0x0080, 0x4d17: 0x0080, + 0x4d18: 0x0080, 0x4d19: 0x0080, 0x4d1a: 0x0080, 0x4d1b: 0x0080, 0x4d1c: 0x0080, 0x4d1d: 0x0080, + 0x4d1e: 0x0080, 0x4d1f: 0x0080, 0x4d20: 0x0080, 0x4d21: 0x0080, 0x4d22: 0x0080, 0x4d23: 0x0080, + 0x4d24: 0x0080, 0x4d25: 0x0080, 0x4d26: 0x0080, 0x4d29: 0x0080, + 0x4d2a: 0x0080, 0x4d2b: 0x0080, 0x4d2c: 0x0080, 0x4d2d: 0x0080, 0x4d2e: 0x0080, 0x4d2f: 0x0080, + 0x4d30: 0x0080, 0x4d31: 0x0080, 0x4d32: 0x0080, 0x4d33: 0x0080, 0x4d34: 0x0080, 0x4d35: 0x0080, + 0x4d36: 0x0080, 0x4d37: 0x0080, 0x4d38: 0x0080, 0x4d39: 0x0080, 0x4d3a: 0x0080, 0x4d3b: 0x0080, + 0x4d3c: 0x0080, 0x4d3d: 0x0080, 0x4d3e: 0x0080, 0x4d3f: 0x0080, + // Block 0x135, offset 0x4d40 + 0x4d40: 0x0080, 0x4d41: 0x0080, 0x4d42: 0x0080, 0x4d43: 0x0080, 0x4d44: 0x0080, 0x4d45: 0x0080, + 0x4d46: 0x0080, 0x4d47: 0x0080, 0x4d48: 0x0080, 0x4d49: 0x0080, 0x4d4a: 0x0080, 0x4d4b: 0x0080, + 0x4d4c: 0x0080, 0x4d4d: 0x0080, 0x4d4e: 0x0080, 0x4d4f: 0x0080, 0x4d50: 0x0080, 0x4d51: 0x0080, + 0x4d52: 0x0080, 0x4d53: 0x0080, 0x4d54: 0x0080, 0x4d55: 0x0080, 0x4d56: 0x0080, 0x4d57: 0x0080, + 0x4d58: 0x0080, 0x4d59: 0x0080, 0x4d5a: 0x0080, 0x4d5b: 0x0080, 0x4d5c: 0x0080, 0x4d5d: 0x0080, + 0x4d5e: 0x0080, 0x4d5f: 0x0080, 0x4d60: 0x0080, 0x4d61: 0x0080, 0x4d62: 0x0080, 0x4d63: 0x0080, + 0x4d64: 0x0080, 0x4d65: 0x00c0, 0x4d66: 0x00c0, 0x4d67: 0x00c3, 0x4d68: 0x00c3, 0x4d69: 0x00c3, + 0x4d6a: 0x0080, 0x4d6b: 0x0080, 0x4d6c: 0x0080, 0x4d6d: 0x00c0, 0x4d6e: 0x00c0, 0x4d6f: 0x00c0, + 0x4d70: 0x00c0, 0x4d71: 0x00c0, 0x4d72: 0x00c0, 0x4d73: 0x0040, 0x4d74: 0x0040, 0x4d75: 0x0040, + 0x4d76: 0x0040, 0x4d77: 0x0040, 0x4d78: 0x0040, 0x4d79: 0x0040, 0x4d7a: 0x0040, 0x4d7b: 0x00c3, + 0x4d7c: 0x00c3, 0x4d7d: 0x00c3, 0x4d7e: 0x00c3, 0x4d7f: 0x00c3, + // Block 0x136, offset 0x4d80 + 0x4d80: 0x00c3, 0x4d81: 0x00c3, 0x4d82: 0x00c3, 0x4d83: 0x0080, 0x4d84: 0x0080, 0x4d85: 0x00c3, + 0x4d86: 0x00c3, 0x4d87: 0x00c3, 0x4d88: 0x00c3, 0x4d89: 0x00c3, 0x4d8a: 0x00c3, 0x4d8b: 0x00c3, + 0x4d8c: 0x0080, 0x4d8d: 0x0080, 0x4d8e: 0x0080, 0x4d8f: 0x0080, 0x4d90: 0x0080, 0x4d91: 0x0080, + 0x4d92: 0x0080, 0x4d93: 0x0080, 0x4d94: 0x0080, 0x4d95: 0x0080, 0x4d96: 0x0080, 0x4d97: 0x0080, + 0x4d98: 0x0080, 0x4d99: 0x0080, 0x4d9a: 0x0080, 0x4d9b: 0x0080, 0x4d9c: 0x0080, 0x4d9d: 0x0080, + 0x4d9e: 0x0080, 0x4d9f: 0x0080, 0x4da0: 0x0080, 0x4da1: 0x0080, 0x4da2: 0x0080, 0x4da3: 0x0080, + 0x4da4: 0x0080, 0x4da5: 0x0080, 0x4da6: 0x0080, 0x4da7: 0x0080, 0x4da8: 0x0080, 0x4da9: 0x0080, + 0x4daa: 0x00c3, 0x4dab: 0x00c3, 0x4dac: 0x00c3, 0x4dad: 0x00c3, 0x4dae: 0x0080, 0x4daf: 0x0080, + 0x4db0: 0x0080, 0x4db1: 0x0080, 0x4db2: 0x0080, 0x4db3: 0x0080, 0x4db4: 0x0080, 0x4db5: 0x0080, + 0x4db6: 0x0080, 0x4db7: 0x0080, 0x4db8: 0x0080, 0x4db9: 0x0080, 0x4dba: 0x0080, 0x4dbb: 0x0080, + 0x4dbc: 0x0080, 0x4dbd: 0x0080, 0x4dbe: 0x0080, 0x4dbf: 0x0080, + // Block 0x137, offset 0x4dc0 + 0x4dc0: 0x0080, 0x4dc1: 0x0080, 0x4dc2: 0x0080, 0x4dc3: 0x0080, 0x4dc4: 0x0080, 0x4dc5: 0x0080, + 0x4dc6: 0x0080, 0x4dc7: 0x0080, 0x4dc8: 0x0080, 0x4dc9: 0x0080, 0x4dca: 0x0080, 0x4dcb: 0x0080, + 0x4dcc: 0x0080, 0x4dcd: 0x0080, 0x4dce: 0x0080, 0x4dcf: 0x0080, 0x4dd0: 0x0080, 0x4dd1: 0x0080, + 0x4dd2: 0x0080, 0x4dd3: 0x0080, 0x4dd4: 0x0080, 0x4dd5: 0x0080, 0x4dd6: 0x0080, 0x4dd7: 0x0080, + 0x4dd8: 0x0080, 0x4dd9: 0x0080, 0x4dda: 0x0080, 0x4ddb: 0x0080, 0x4ddc: 0x0080, 0x4ddd: 0x0080, + 0x4dde: 0x0080, 0x4ddf: 0x0080, 0x4de0: 0x0080, 0x4de1: 0x0080, 0x4de2: 0x0080, 0x4de3: 0x0080, + 0x4de4: 0x0080, 0x4de5: 0x0080, 0x4de6: 0x0080, 0x4de7: 0x0080, 0x4de8: 0x0080, 0x4de9: 0x0080, + 0x4dea: 0x0080, + // Block 0x138, offset 0x4e00 + 0x4e00: 0x0088, 0x4e01: 0x0088, 0x4e02: 0x00c9, 0x4e03: 0x00c9, 0x4e04: 0x00c9, 0x4e05: 0x0088, + // Block 0x139, offset 0x4e40 + 0x4e40: 0x0080, 0x4e41: 0x0080, 0x4e42: 0x0080, 0x4e43: 0x0080, 0x4e44: 0x0080, 0x4e45: 0x0080, + 0x4e46: 0x0080, 0x4e47: 0x0080, 0x4e48: 0x0080, 0x4e49: 0x0080, 0x4e4a: 0x0080, 0x4e4b: 0x0080, + 0x4e4c: 0x0080, 0x4e4d: 0x0080, 0x4e4e: 0x0080, 0x4e4f: 0x0080, 0x4e50: 0x0080, 0x4e51: 0x0080, + 0x4e52: 0x0080, 0x4e53: 0x0080, + 0x4e60: 0x0080, 0x4e61: 0x0080, 0x4e62: 0x0080, 0x4e63: 0x0080, + 0x4e64: 0x0080, 0x4e65: 0x0080, 0x4e66: 0x0080, 0x4e67: 0x0080, 0x4e68: 0x0080, 0x4e69: 0x0080, + 0x4e6a: 0x0080, 0x4e6b: 0x0080, 0x4e6c: 0x0080, 0x4e6d: 0x0080, 0x4e6e: 0x0080, 0x4e6f: 0x0080, + 0x4e70: 0x0080, 0x4e71: 0x0080, 0x4e72: 0x0080, 0x4e73: 0x0080, + // Block 0x13a, offset 0x4e80 + 0x4e80: 0x0080, 0x4e81: 0x0080, 0x4e82: 0x0080, 0x4e83: 0x0080, 0x4e84: 0x0080, 0x4e85: 0x0080, + 0x4e86: 0x0080, 0x4e87: 0x0080, 0x4e88: 0x0080, 0x4e89: 0x0080, 0x4e8a: 0x0080, 0x4e8b: 0x0080, + 0x4e8c: 0x0080, 0x4e8d: 0x0080, 0x4e8e: 0x0080, 0x4e8f: 0x0080, 0x4e90: 0x0080, 0x4e91: 0x0080, + 0x4e92: 0x0080, 0x4e93: 0x0080, 0x4e94: 0x0080, 0x4e95: 0x0080, 0x4e96: 0x0080, + 0x4ea0: 0x0080, 0x4ea1: 0x0080, 0x4ea2: 0x0080, 0x4ea3: 0x0080, + 0x4ea4: 0x0080, 0x4ea5: 0x0080, 0x4ea6: 0x0080, 0x4ea7: 0x0080, 0x4ea8: 0x0080, 0x4ea9: 0x0080, + 0x4eaa: 0x0080, 0x4eab: 0x0080, 0x4eac: 0x0080, 0x4ead: 0x0080, 0x4eae: 0x0080, 0x4eaf: 0x0080, + 0x4eb0: 0x0080, 0x4eb1: 0x0080, 0x4eb2: 0x0080, 0x4eb3: 0x0080, 0x4eb4: 0x0080, 0x4eb5: 0x0080, + 0x4eb6: 0x0080, 0x4eb7: 0x0080, 0x4eb8: 0x0080, + // Block 0x13b, offset 0x4ec0 + 0x4ec0: 0x0080, 0x4ec1: 0x0080, 0x4ec2: 0x0080, 0x4ec3: 0x0080, 0x4ec4: 0x0080, 0x4ec5: 0x0080, + 0x4ec6: 0x0080, 0x4ec7: 0x0080, 0x4ec8: 0x0080, 0x4ec9: 0x0080, 0x4eca: 0x0080, 0x4ecb: 0x0080, + 0x4ecc: 0x0080, 0x4ecd: 0x0080, 0x4ece: 0x0080, 0x4ecf: 0x0080, 0x4ed0: 0x0080, 0x4ed1: 0x0080, + 0x4ed2: 0x0080, 0x4ed3: 0x0080, 0x4ed4: 0x0080, 0x4ed6: 0x0080, 0x4ed7: 0x0080, + 0x4ed8: 0x0080, 0x4ed9: 0x0080, 0x4eda: 0x0080, 0x4edb: 0x0080, 0x4edc: 0x0080, 0x4edd: 0x0080, + 0x4ede: 0x0080, 0x4edf: 0x0080, 0x4ee0: 0x0080, 0x4ee1: 0x0080, 0x4ee2: 0x0080, 0x4ee3: 0x0080, + 0x4ee4: 0x0080, 0x4ee5: 0x0080, 0x4ee6: 0x0080, 0x4ee7: 0x0080, 0x4ee8: 0x0080, 0x4ee9: 0x0080, + 0x4eea: 0x0080, 0x4eeb: 0x0080, 0x4eec: 0x0080, 0x4eed: 0x0080, 0x4eee: 0x0080, 0x4eef: 0x0080, + 0x4ef0: 0x0080, 0x4ef1: 0x0080, 0x4ef2: 0x0080, 0x4ef3: 0x0080, 0x4ef4: 0x0080, 0x4ef5: 0x0080, + 0x4ef6: 0x0080, 0x4ef7: 0x0080, 0x4ef8: 0x0080, 0x4ef9: 0x0080, 0x4efa: 0x0080, 0x4efb: 0x0080, + 0x4efc: 0x0080, 0x4efd: 0x0080, 0x4efe: 0x0080, 0x4eff: 0x0080, + // Block 0x13c, offset 0x4f00 + 0x4f00: 0x0080, 0x4f01: 0x0080, 0x4f02: 0x0080, 0x4f03: 0x0080, 0x4f04: 0x0080, 0x4f05: 0x0080, + 0x4f06: 0x0080, 0x4f07: 0x0080, 0x4f08: 0x0080, 0x4f09: 0x0080, 0x4f0a: 0x0080, 0x4f0b: 0x0080, + 0x4f0c: 0x0080, 0x4f0d: 0x0080, 0x4f0e: 0x0080, 0x4f0f: 0x0080, 0x4f10: 0x0080, 0x4f11: 0x0080, + 0x4f12: 0x0080, 0x4f13: 0x0080, 0x4f14: 0x0080, 0x4f15: 0x0080, 0x4f16: 0x0080, 0x4f17: 0x0080, + 0x4f18: 0x0080, 0x4f19: 0x0080, 0x4f1a: 0x0080, 0x4f1b: 0x0080, 0x4f1c: 0x0080, + 0x4f1e: 0x0080, 0x4f1f: 0x0080, 0x4f22: 0x0080, + 0x4f25: 0x0080, 0x4f26: 0x0080, 0x4f29: 0x0080, + 0x4f2a: 0x0080, 0x4f2b: 0x0080, 0x4f2c: 0x0080, 0x4f2e: 0x0080, 0x4f2f: 0x0080, + 0x4f30: 0x0080, 0x4f31: 0x0080, 0x4f32: 0x0080, 0x4f33: 0x0080, 0x4f34: 0x0080, 0x4f35: 0x0080, + 0x4f36: 0x0080, 0x4f37: 0x0080, 0x4f38: 0x0080, 0x4f39: 0x0080, 0x4f3b: 0x0080, + 0x4f3d: 0x0080, 0x4f3e: 0x0080, 0x4f3f: 0x0080, + // Block 0x13d, offset 0x4f40 + 0x4f40: 0x0080, 0x4f41: 0x0080, 0x4f42: 0x0080, 0x4f43: 0x0080, 0x4f45: 0x0080, + 0x4f46: 0x0080, 0x4f47: 0x0080, 0x4f48: 0x0080, 0x4f49: 0x0080, 0x4f4a: 0x0080, 0x4f4b: 0x0080, + 0x4f4c: 0x0080, 0x4f4d: 0x0080, 0x4f4e: 0x0080, 0x4f4f: 0x0080, 0x4f50: 0x0080, 0x4f51: 0x0080, + 0x4f52: 0x0080, 0x4f53: 0x0080, 0x4f54: 0x0080, 0x4f55: 0x0080, 0x4f56: 0x0080, 0x4f57: 0x0080, + 0x4f58: 0x0080, 0x4f59: 0x0080, 0x4f5a: 0x0080, 0x4f5b: 0x0080, 0x4f5c: 0x0080, 0x4f5d: 0x0080, + 0x4f5e: 0x0080, 0x4f5f: 0x0080, 0x4f60: 0x0080, 0x4f61: 0x0080, 0x4f62: 0x0080, 0x4f63: 0x0080, + 0x4f64: 0x0080, 0x4f65: 0x0080, 0x4f66: 0x0080, 0x4f67: 0x0080, 0x4f68: 0x0080, 0x4f69: 0x0080, + 0x4f6a: 0x0080, 0x4f6b: 0x0080, 0x4f6c: 0x0080, 0x4f6d: 0x0080, 0x4f6e: 0x0080, 0x4f6f: 0x0080, + 0x4f70: 0x0080, 0x4f71: 0x0080, 0x4f72: 0x0080, 0x4f73: 0x0080, 0x4f74: 0x0080, 0x4f75: 0x0080, + 0x4f76: 0x0080, 0x4f77: 0x0080, 0x4f78: 0x0080, 0x4f79: 0x0080, 0x4f7a: 0x0080, 0x4f7b: 0x0080, + 0x4f7c: 0x0080, 0x4f7d: 0x0080, 0x4f7e: 0x0080, 0x4f7f: 0x0080, + // Block 0x13e, offset 0x4f80 + 0x4f80: 0x0080, 0x4f81: 0x0080, 0x4f82: 0x0080, 0x4f83: 0x0080, 0x4f84: 0x0080, 0x4f85: 0x0080, + 0x4f87: 0x0080, 0x4f88: 0x0080, 0x4f89: 0x0080, 0x4f8a: 0x0080, + 0x4f8d: 0x0080, 0x4f8e: 0x0080, 0x4f8f: 0x0080, 0x4f90: 0x0080, 0x4f91: 0x0080, + 0x4f92: 0x0080, 0x4f93: 0x0080, 0x4f94: 0x0080, 0x4f96: 0x0080, 0x4f97: 0x0080, + 0x4f98: 0x0080, 0x4f99: 0x0080, 0x4f9a: 0x0080, 0x4f9b: 0x0080, 0x4f9c: 0x0080, + 0x4f9e: 0x0080, 0x4f9f: 0x0080, 0x4fa0: 0x0080, 0x4fa1: 0x0080, 0x4fa2: 0x0080, 0x4fa3: 0x0080, + 0x4fa4: 0x0080, 0x4fa5: 0x0080, 0x4fa6: 0x0080, 0x4fa7: 0x0080, 0x4fa8: 0x0080, 0x4fa9: 0x0080, + 0x4faa: 0x0080, 0x4fab: 0x0080, 0x4fac: 0x0080, 0x4fad: 0x0080, 0x4fae: 0x0080, 0x4faf: 0x0080, + 0x4fb0: 0x0080, 0x4fb1: 0x0080, 0x4fb2: 0x0080, 0x4fb3: 0x0080, 0x4fb4: 0x0080, 0x4fb5: 0x0080, + 0x4fb6: 0x0080, 0x4fb7: 0x0080, 0x4fb8: 0x0080, 0x4fb9: 0x0080, 0x4fbb: 0x0080, + 0x4fbc: 0x0080, 0x4fbd: 0x0080, 0x4fbe: 0x0080, + // Block 0x13f, offset 0x4fc0 + 0x4fc0: 0x0080, 0x4fc1: 0x0080, 0x4fc2: 0x0080, 0x4fc3: 0x0080, 0x4fc4: 0x0080, + 0x4fc6: 0x0080, 0x4fca: 0x0080, 0x4fcb: 0x0080, + 0x4fcc: 0x0080, 0x4fcd: 0x0080, 0x4fce: 0x0080, 0x4fcf: 0x0080, 0x4fd0: 0x0080, + 0x4fd2: 0x0080, 0x4fd3: 0x0080, 0x4fd4: 0x0080, 0x4fd5: 0x0080, 0x4fd6: 0x0080, 0x4fd7: 0x0080, + 0x4fd8: 0x0080, 0x4fd9: 0x0080, 0x4fda: 0x0080, 0x4fdb: 0x0080, 0x4fdc: 0x0080, 0x4fdd: 0x0080, + 0x4fde: 0x0080, 0x4fdf: 0x0080, 0x4fe0: 0x0080, 0x4fe1: 0x0080, 0x4fe2: 0x0080, 0x4fe3: 0x0080, + 0x4fe4: 0x0080, 0x4fe5: 0x0080, 0x4fe6: 0x0080, 0x4fe7: 0x0080, 0x4fe8: 0x0080, 0x4fe9: 0x0080, + 0x4fea: 0x0080, 0x4feb: 0x0080, 0x4fec: 0x0080, 0x4fed: 0x0080, 0x4fee: 0x0080, 0x4fef: 0x0080, + 0x4ff0: 0x0080, 0x4ff1: 0x0080, 0x4ff2: 0x0080, 0x4ff3: 0x0080, 0x4ff4: 0x0080, 0x4ff5: 0x0080, + 0x4ff6: 0x0080, 0x4ff7: 0x0080, 0x4ff8: 0x0080, 0x4ff9: 0x0080, 0x4ffa: 0x0080, 0x4ffb: 0x0080, + 0x4ffc: 0x0080, 0x4ffd: 0x0080, 0x4ffe: 0x0080, 0x4fff: 0x0080, + // Block 0x140, offset 0x5000 + 0x5000: 0x0080, 0x5001: 0x0080, 0x5002: 0x0080, 0x5003: 0x0080, 0x5004: 0x0080, 0x5005: 0x0080, + 0x5006: 0x0080, 0x5007: 0x0080, 0x5008: 0x0080, 0x5009: 0x0080, 0x500a: 0x0080, 0x500b: 0x0080, + 0x500c: 0x0080, 0x500d: 0x0080, 0x500e: 0x0080, 0x500f: 0x0080, 0x5010: 0x0080, 0x5011: 0x0080, + 0x5012: 0x0080, 0x5013: 0x0080, 0x5014: 0x0080, 0x5015: 0x0080, 0x5016: 0x0080, 0x5017: 0x0080, + 0x5018: 0x0080, 0x5019: 0x0080, 0x501a: 0x0080, 0x501b: 0x0080, 0x501c: 0x0080, 0x501d: 0x0080, + 0x501e: 0x0080, 0x501f: 0x0080, 0x5020: 0x0080, 0x5021: 0x0080, 0x5022: 0x0080, 0x5023: 0x0080, + 0x5024: 0x0080, 0x5025: 0x0080, 0x5028: 0x0080, 0x5029: 0x0080, + 0x502a: 0x0080, 0x502b: 0x0080, 0x502c: 0x0080, 0x502d: 0x0080, 0x502e: 0x0080, 0x502f: 0x0080, + 0x5030: 0x0080, 0x5031: 0x0080, 0x5032: 0x0080, 0x5033: 0x0080, 0x5034: 0x0080, 0x5035: 0x0080, + 0x5036: 0x0080, 0x5037: 0x0080, 0x5038: 0x0080, 0x5039: 0x0080, 0x503a: 0x0080, 0x503b: 0x0080, + 0x503c: 0x0080, 0x503d: 0x0080, 0x503e: 0x0080, 0x503f: 0x0080, + // Block 0x141, offset 0x5040 + 0x5040: 0x0080, 0x5041: 0x0080, 0x5042: 0x0080, 0x5043: 0x0080, 0x5044: 0x0080, 0x5045: 0x0080, + 0x5046: 0x0080, 0x5047: 0x0080, 0x5048: 0x0080, 0x5049: 0x0080, 0x504a: 0x0080, 0x504b: 0x0080, + 0x504e: 0x0080, 0x504f: 0x0080, 0x5050: 0x0080, 0x5051: 0x0080, + 0x5052: 0x0080, 0x5053: 0x0080, 0x5054: 0x0080, 0x5055: 0x0080, 0x5056: 0x0080, 0x5057: 0x0080, + 0x5058: 0x0080, 0x5059: 0x0080, 0x505a: 0x0080, 0x505b: 0x0080, 0x505c: 0x0080, 0x505d: 0x0080, + 0x505e: 0x0080, 0x505f: 0x0080, 0x5060: 0x0080, 0x5061: 0x0080, 0x5062: 0x0080, 0x5063: 0x0080, + 0x5064: 0x0080, 0x5065: 0x0080, 0x5066: 0x0080, 0x5067: 0x0080, 0x5068: 0x0080, 0x5069: 0x0080, + 0x506a: 0x0080, 0x506b: 0x0080, 0x506c: 0x0080, 0x506d: 0x0080, 0x506e: 0x0080, 0x506f: 0x0080, + 0x5070: 0x0080, 0x5071: 0x0080, 0x5072: 0x0080, 0x5073: 0x0080, 0x5074: 0x0080, 0x5075: 0x0080, + 0x5076: 0x0080, 0x5077: 0x0080, 0x5078: 0x0080, 0x5079: 0x0080, 0x507a: 0x0080, 0x507b: 0x0080, + 0x507c: 0x0080, 0x507d: 0x0080, 0x507e: 0x0080, 0x507f: 0x0080, + // Block 0x142, offset 0x5080 + 0x5080: 0x00c3, 0x5081: 0x00c3, 0x5082: 0x00c3, 0x5083: 0x00c3, 0x5084: 0x00c3, 0x5085: 0x00c3, + 0x5086: 0x00c3, 0x5087: 0x00c3, 0x5088: 0x00c3, 0x5089: 0x00c3, 0x508a: 0x00c3, 0x508b: 0x00c3, + 0x508c: 0x00c3, 0x508d: 0x00c3, 0x508e: 0x00c3, 0x508f: 0x00c3, 0x5090: 0x00c3, 0x5091: 0x00c3, + 0x5092: 0x00c3, 0x5093: 0x00c3, 0x5094: 0x00c3, 0x5095: 0x00c3, 0x5096: 0x00c3, 0x5097: 0x00c3, + 0x5098: 0x00c3, 0x5099: 0x00c3, 0x509a: 0x00c3, 0x509b: 0x00c3, 0x509c: 0x00c3, 0x509d: 0x00c3, + 0x509e: 0x00c3, 0x509f: 0x00c3, 0x50a0: 0x00c3, 0x50a1: 0x00c3, 0x50a2: 0x00c3, 0x50a3: 0x00c3, + 0x50a4: 0x00c3, 0x50a5: 0x00c3, 0x50a6: 0x00c3, 0x50a7: 0x00c3, 0x50a8: 0x00c3, 0x50a9: 0x00c3, + 0x50aa: 0x00c3, 0x50ab: 0x00c3, 0x50ac: 0x00c3, 0x50ad: 0x00c3, 0x50ae: 0x00c3, 0x50af: 0x00c3, + 0x50b0: 0x00c3, 0x50b1: 0x00c3, 0x50b2: 0x00c3, 0x50b3: 0x00c3, 0x50b4: 0x00c3, 0x50b5: 0x00c3, + 0x50b6: 0x00c3, 0x50b7: 0x0080, 0x50b8: 0x0080, 0x50b9: 0x0080, 0x50ba: 0x0080, 0x50bb: 0x00c3, + 0x50bc: 0x00c3, 0x50bd: 0x00c3, 0x50be: 0x00c3, 0x50bf: 0x00c3, + // Block 0x143, offset 0x50c0 + 0x50c0: 0x00c3, 0x50c1: 0x00c3, 0x50c2: 0x00c3, 0x50c3: 0x00c3, 0x50c4: 0x00c3, 0x50c5: 0x00c3, + 0x50c6: 0x00c3, 0x50c7: 0x00c3, 0x50c8: 0x00c3, 0x50c9: 0x00c3, 0x50ca: 0x00c3, 0x50cb: 0x00c3, + 0x50cc: 0x00c3, 0x50cd: 0x00c3, 0x50ce: 0x00c3, 0x50cf: 0x00c3, 0x50d0: 0x00c3, 0x50d1: 0x00c3, + 0x50d2: 0x00c3, 0x50d3: 0x00c3, 0x50d4: 0x00c3, 0x50d5: 0x00c3, 0x50d6: 0x00c3, 0x50d7: 0x00c3, + 0x50d8: 0x00c3, 0x50d9: 0x00c3, 0x50da: 0x00c3, 0x50db: 0x00c3, 0x50dc: 0x00c3, 0x50dd: 0x00c3, + 0x50de: 0x00c3, 0x50df: 0x00c3, 0x50e0: 0x00c3, 0x50e1: 0x00c3, 0x50e2: 0x00c3, 0x50e3: 0x00c3, + 0x50e4: 0x00c3, 0x50e5: 0x00c3, 0x50e6: 0x00c3, 0x50e7: 0x00c3, 0x50e8: 0x00c3, 0x50e9: 0x00c3, + 0x50ea: 0x00c3, 0x50eb: 0x00c3, 0x50ec: 0x00c3, 0x50ed: 0x0080, 0x50ee: 0x0080, 0x50ef: 0x0080, + 0x50f0: 0x0080, 0x50f1: 0x0080, 0x50f2: 0x0080, 0x50f3: 0x0080, 0x50f4: 0x0080, 0x50f5: 0x00c3, + 0x50f6: 0x0080, 0x50f7: 0x0080, 0x50f8: 0x0080, 0x50f9: 0x0080, 0x50fa: 0x0080, 0x50fb: 0x0080, + 0x50fc: 0x0080, 0x50fd: 0x0080, 0x50fe: 0x0080, 0x50ff: 0x0080, + // Block 0x144, offset 0x5100 + 0x5100: 0x0080, 0x5101: 0x0080, 0x5102: 0x0080, 0x5103: 0x0080, 0x5104: 0x00c3, 0x5105: 0x0080, + 0x5106: 0x0080, 0x5107: 0x0080, 0x5108: 0x0080, 0x5109: 0x0080, 0x510a: 0x0080, 0x510b: 0x0080, + 0x511b: 0x00c3, 0x511c: 0x00c3, 0x511d: 0x00c3, + 0x511e: 0x00c3, 0x511f: 0x00c3, 0x5121: 0x00c3, 0x5122: 0x00c3, 0x5123: 0x00c3, + 0x5124: 0x00c3, 0x5125: 0x00c3, 0x5126: 0x00c3, 0x5127: 0x00c3, 0x5128: 0x00c3, 0x5129: 0x00c3, + 0x512a: 0x00c3, 0x512b: 0x00c3, 0x512c: 0x00c3, 0x512d: 0x00c3, 0x512e: 0x00c3, 0x512f: 0x00c3, + // Block 0x145, offset 0x5140 + 0x5140: 0x00c0, 0x5141: 0x00c0, 0x5142: 0x00c0, 0x5143: 0x00c0, 0x5144: 0x00c0, 0x5145: 0x00c0, + 0x5146: 0x00c0, 0x5147: 0x00c0, 0x5148: 0x00c0, 0x5149: 0x00c0, 0x514a: 0x00c0, 0x514b: 0x00c0, + 0x514c: 0x00c0, 0x514d: 0x00c0, 0x514e: 0x00c0, 0x514f: 0x00c0, 0x5150: 0x00c0, 0x5151: 0x00c0, + 0x5152: 0x00c0, 0x5153: 0x00c0, 0x5154: 0x00c0, 0x5155: 0x00c0, 0x5156: 0x00c0, 0x5157: 0x00c0, + 0x5158: 0x00c0, 0x5159: 0x00c0, 0x515a: 0x00c0, 0x515b: 0x00c0, 0x515c: 0x00c0, 0x515d: 0x00c0, + 0x515e: 0x00c0, + 0x5165: 0x00c0, 0x5166: 0x00c0, 0x5167: 0x00c0, 0x5168: 0x00c0, 0x5169: 0x00c0, + 0x516a: 0x00c0, + // Block 0x146, offset 0x5180 + 0x5180: 0x00c3, 0x5181: 0x00c3, 0x5182: 0x00c3, 0x5183: 0x00c3, 0x5184: 0x00c3, 0x5185: 0x00c3, + 0x5186: 0x00c3, 0x5188: 0x00c3, 0x5189: 0x00c3, 0x518a: 0x00c3, 0x518b: 0x00c3, + 0x518c: 0x00c3, 0x518d: 0x00c3, 0x518e: 0x00c3, 0x518f: 0x00c3, 0x5190: 0x00c3, 0x5191: 0x00c3, + 0x5192: 0x00c3, 0x5193: 0x00c3, 0x5194: 0x00c3, 0x5195: 0x00c3, 0x5196: 0x00c3, 0x5197: 0x00c3, + 0x5198: 0x00c3, 0x519b: 0x00c3, 0x519c: 0x00c3, 0x519d: 0x00c3, + 0x519e: 0x00c3, 0x519f: 0x00c3, 0x51a0: 0x00c3, 0x51a1: 0x00c3, 0x51a3: 0x00c3, + 0x51a4: 0x00c3, 0x51a6: 0x00c3, 0x51a7: 0x00c3, 0x51a8: 0x00c3, 0x51a9: 0x00c3, + 0x51aa: 0x00c3, + 0x51b0: 0x0080, 0x51b1: 0x0080, 0x51b2: 0x0080, 0x51b3: 0x0080, 0x51b4: 0x0080, 0x51b5: 0x0080, + 0x51b6: 0x0080, 0x51b7: 0x0080, 0x51b8: 0x0080, 0x51b9: 0x0080, 0x51ba: 0x0080, 0x51bb: 0x0080, + 0x51bc: 0x0080, 0x51bd: 0x0080, 0x51be: 0x0080, 0x51bf: 0x0080, + // Block 0x147, offset 0x51c0 + 0x51c0: 0x0080, 0x51c1: 0x0080, 0x51c2: 0x0080, 0x51c3: 0x0080, 0x51c4: 0x0080, 0x51c5: 0x0080, + 0x51c6: 0x0080, 0x51c7: 0x0080, 0x51c8: 0x0080, 0x51c9: 0x0080, 0x51ca: 0x0080, 0x51cb: 0x0080, + 0x51cc: 0x0080, 0x51cd: 0x0080, 0x51ce: 0x0080, 0x51cf: 0x0080, 0x51d0: 0x0080, 0x51d1: 0x0080, + 0x51d2: 0x0080, 0x51d3: 0x0080, 0x51d4: 0x0080, 0x51d5: 0x0080, 0x51d6: 0x0080, 0x51d7: 0x0080, + 0x51d8: 0x0080, 0x51d9: 0x0080, 0x51da: 0x0080, 0x51db: 0x0080, 0x51dc: 0x0080, 0x51dd: 0x0080, + 0x51de: 0x0080, 0x51df: 0x0080, 0x51e0: 0x0080, 0x51e1: 0x0080, 0x51e2: 0x0080, 0x51e3: 0x0080, + 0x51e4: 0x0080, 0x51e5: 0x0080, 0x51e6: 0x0080, 0x51e7: 0x0080, 0x51e8: 0x0080, 0x51e9: 0x0080, + 0x51ea: 0x0080, 0x51eb: 0x0080, 0x51ec: 0x0080, 0x51ed: 0x0080, + // Block 0x148, offset 0x5200 + 0x520f: 0x00c3, + // Block 0x149, offset 0x5240 + 0x5240: 0x00c0, 0x5241: 0x00c0, 0x5242: 0x00c0, 0x5243: 0x00c0, 0x5244: 0x00c0, 0x5245: 0x00c0, + 0x5246: 0x00c0, 0x5247: 0x00c0, 0x5248: 0x00c0, 0x5249: 0x00c0, 0x524a: 0x00c0, 0x524b: 0x00c0, + 0x524c: 0x00c0, 0x524d: 0x00c0, 0x524e: 0x00c0, 0x524f: 0x00c0, 0x5250: 0x00c0, 0x5251: 0x00c0, + 0x5252: 0x00c0, 0x5253: 0x00c0, 0x5254: 0x00c0, 0x5255: 0x00c0, 0x5256: 0x00c0, 0x5257: 0x00c0, + 0x5258: 0x00c0, 0x5259: 0x00c0, 0x525a: 0x00c0, 0x525b: 0x00c0, 0x525c: 0x00c0, 0x525d: 0x00c0, + 0x525e: 0x00c0, 0x525f: 0x00c0, 0x5260: 0x00c0, 0x5261: 0x00c0, 0x5262: 0x00c0, 0x5263: 0x00c0, + 0x5264: 0x00c0, 0x5265: 0x00c0, 0x5266: 0x00c0, 0x5267: 0x00c0, 0x5268: 0x00c0, 0x5269: 0x00c0, + 0x526a: 0x00c0, 0x526b: 0x00c0, 0x526c: 0x00c0, + 0x5270: 0x00c3, 0x5271: 0x00c3, 0x5272: 0x00c3, 0x5273: 0x00c3, 0x5274: 0x00c3, 0x5275: 0x00c3, + 0x5276: 0x00c3, 0x5277: 0x00c0, 0x5278: 0x00c0, 0x5279: 0x00c0, 0x527a: 0x00c0, 0x527b: 0x00c0, + 0x527c: 0x00c0, 0x527d: 0x00c0, + // Block 0x14a, offset 0x5280 + 0x5280: 0x00c0, 0x5281: 0x00c0, 0x5282: 0x00c0, 0x5283: 0x00c0, 0x5284: 0x00c0, 0x5285: 0x00c0, + 0x5286: 0x00c0, 0x5287: 0x00c0, 0x5288: 0x00c0, 0x5289: 0x00c0, + 0x528e: 0x00c0, 0x528f: 0x0080, + // Block 0x14b, offset 0x52c0 + 0x52d0: 0x00c0, 0x52d1: 0x00c0, + 0x52d2: 0x00c0, 0x52d3: 0x00c0, 0x52d4: 0x00c0, 0x52d5: 0x00c0, 0x52d6: 0x00c0, 0x52d7: 0x00c0, + 0x52d8: 0x00c0, 0x52d9: 0x00c0, 0x52da: 0x00c0, 0x52db: 0x00c0, 0x52dc: 0x00c0, 0x52dd: 0x00c0, + 0x52de: 0x00c0, 0x52df: 0x00c0, 0x52e0: 0x00c0, 0x52e1: 0x00c0, 0x52e2: 0x00c0, 0x52e3: 0x00c0, + 0x52e4: 0x00c0, 0x52e5: 0x00c0, 0x52e6: 0x00c0, 0x52e7: 0x00c0, 0x52e8: 0x00c0, 0x52e9: 0x00c0, + 0x52ea: 0x00c0, 0x52eb: 0x00c0, 0x52ec: 0x00c0, 0x52ed: 0x00c0, 0x52ee: 0x00c3, + // Block 0x14c, offset 0x5300 + 0x5300: 0x00c0, 0x5301: 0x00c0, 0x5302: 0x00c0, 0x5303: 0x00c0, 0x5304: 0x00c0, 0x5305: 0x00c0, + 0x5306: 0x00c0, 0x5307: 0x00c0, 0x5308: 0x00c0, 0x5309: 0x00c0, 0x530a: 0x00c0, 0x530b: 0x00c0, + 0x530c: 0x00c0, 0x530d: 0x00c0, 0x530e: 0x00c0, 0x530f: 0x00c0, 0x5310: 0x00c0, 0x5311: 0x00c0, + 0x5312: 0x00c0, 0x5313: 0x00c0, 0x5314: 0x00c0, 0x5315: 0x00c0, 0x5316: 0x00c0, 0x5317: 0x00c0, + 0x5318: 0x00c0, 0x5319: 0x00c0, 0x531a: 0x00c0, 0x531b: 0x00c0, 0x531c: 0x00c0, 0x531d: 0x00c0, + 0x531e: 0x00c0, 0x531f: 0x00c0, 0x5320: 0x00c0, 0x5321: 0x00c0, 0x5322: 0x00c0, 0x5323: 0x00c0, + 0x5324: 0x00c0, 0x5325: 0x00c0, 0x5326: 0x00c0, 0x5327: 0x00c0, 0x5328: 0x00c0, 0x5329: 0x00c0, + 0x532a: 0x00c0, 0x532b: 0x00c0, 0x532c: 0x00c3, 0x532d: 0x00c3, 0x532e: 0x00c3, 0x532f: 0x00c3, + 0x5330: 0x00c0, 0x5331: 0x00c0, 0x5332: 0x00c0, 0x5333: 0x00c0, 0x5334: 0x00c0, 0x5335: 0x00c0, + 0x5336: 0x00c0, 0x5337: 0x00c0, 0x5338: 0x00c0, 0x5339: 0x00c0, + 0x533f: 0x0080, + // Block 0x14d, offset 0x5340 + 0x5350: 0x00c0, 0x5351: 0x00c0, + 0x5352: 0x00c0, 0x5353: 0x00c0, 0x5354: 0x00c0, 0x5355: 0x00c0, 0x5356: 0x00c0, 0x5357: 0x00c0, + 0x5358: 0x00c0, 0x5359: 0x00c0, 0x535a: 0x00c0, 0x535b: 0x00c0, 0x535c: 0x00c0, 0x535d: 0x00c0, + 0x535e: 0x00c0, 0x535f: 0x00c0, 0x5360: 0x00c0, 0x5361: 0x00c0, 0x5362: 0x00c0, 0x5363: 0x00c0, + 0x5364: 0x00c0, 0x5365: 0x00c0, 0x5366: 0x00c0, 0x5367: 0x00c0, 0x5368: 0x00c0, 0x5369: 0x00c0, + 0x536a: 0x00c0, 0x536b: 0x00c0, 0x536c: 0x00c3, 0x536d: 0x00c3, 0x536e: 0x00c3, 0x536f: 0x00c3, + 0x5370: 0x00c0, 0x5371: 0x00c0, 0x5372: 0x00c0, 0x5373: 0x00c0, 0x5374: 0x00c0, 0x5375: 0x00c0, + 0x5376: 0x00c0, 0x5377: 0x00c0, 0x5378: 0x00c0, 0x5379: 0x00c0, + // Block 0x14e, offset 0x5380 + 0x53a0: 0x00c0, 0x53a1: 0x00c0, 0x53a2: 0x00c0, 0x53a3: 0x00c0, + 0x53a4: 0x00c0, 0x53a5: 0x00c0, 0x53a6: 0x00c0, 0x53a8: 0x00c0, 0x53a9: 0x00c0, + 0x53aa: 0x00c0, 0x53ab: 0x00c0, 0x53ad: 0x00c0, 0x53ae: 0x00c0, + 0x53b0: 0x00c0, 0x53b1: 0x00c0, 0x53b2: 0x00c0, 0x53b3: 0x00c0, 0x53b4: 0x00c0, 0x53b5: 0x00c0, + 0x53b6: 0x00c0, 0x53b7: 0x00c0, 0x53b8: 0x00c0, 0x53b9: 0x00c0, 0x53ba: 0x00c0, 0x53bb: 0x00c0, + 0x53bc: 0x00c0, 0x53bd: 0x00c0, 0x53be: 0x00c0, + // Block 0x14f, offset 0x53c0 + 0x53c0: 0x00c0, 0x53c1: 0x00c0, 0x53c2: 0x00c0, 0x53c3: 0x00c0, 0x53c4: 0x00c0, + 0x53c7: 0x0080, 0x53c8: 0x0080, 0x53c9: 0x0080, 0x53ca: 0x0080, 0x53cb: 0x0080, + 0x53cc: 0x0080, 0x53cd: 0x0080, 0x53ce: 0x0080, 0x53cf: 0x0080, 0x53d0: 0x00c3, 0x53d1: 0x00c3, + 0x53d2: 0x00c3, 0x53d3: 0x00c3, 0x53d4: 0x00c3, 0x53d5: 0x00c3, 0x53d6: 0x00c3, + // Block 0x150, offset 0x5400 + 0x5400: 0x00c2, 0x5401: 0x00c2, 0x5402: 0x00c2, 0x5403: 0x00c2, 0x5404: 0x00c2, 0x5405: 0x00c2, + 0x5406: 0x00c2, 0x5407: 0x00c2, 0x5408: 0x00c2, 0x5409: 0x00c2, 0x540a: 0x00c2, 0x540b: 0x00c2, + 0x540c: 0x00c2, 0x540d: 0x00c2, 0x540e: 0x00c2, 0x540f: 0x00c2, 0x5410: 0x00c2, 0x5411: 0x00c2, + 0x5412: 0x00c2, 0x5413: 0x00c2, 0x5414: 0x00c2, 0x5415: 0x00c2, 0x5416: 0x00c2, 0x5417: 0x00c2, + 0x5418: 0x00c2, 0x5419: 0x00c2, 0x541a: 0x00c2, 0x541b: 0x00c2, 0x541c: 0x00c2, 0x541d: 0x00c2, + 0x541e: 0x00c2, 0x541f: 0x00c2, 0x5420: 0x00c2, 0x5421: 0x00c2, 0x5422: 0x00c2, 0x5423: 0x00c2, + 0x5424: 0x00c2, 0x5425: 0x00c2, 0x5426: 0x00c2, 0x5427: 0x00c2, 0x5428: 0x00c2, 0x5429: 0x00c2, + 0x542a: 0x00c2, 0x542b: 0x00c2, 0x542c: 0x00c2, 0x542d: 0x00c2, 0x542e: 0x00c2, 0x542f: 0x00c2, + 0x5430: 0x00c2, 0x5431: 0x00c2, 0x5432: 0x00c2, 0x5433: 0x00c2, 0x5434: 0x00c2, 0x5435: 0x00c2, + 0x5436: 0x00c2, 0x5437: 0x00c2, 0x5438: 0x00c2, 0x5439: 0x00c2, 0x543a: 0x00c2, 0x543b: 0x00c2, + 0x543c: 0x00c2, 0x543d: 0x00c2, 0x543e: 0x00c2, 0x543f: 0x00c2, + // Block 0x151, offset 0x5440 + 0x5440: 0x00c2, 0x5441: 0x00c2, 0x5442: 0x00c2, 0x5443: 0x00c2, 0x5444: 0x00c3, 0x5445: 0x00c3, + 0x5446: 0x00c3, 0x5447: 0x00c3, 0x5448: 0x00c3, 0x5449: 0x00c3, 0x544a: 0x00c3, 0x544b: 0x00c3, + 0x5450: 0x00c0, 0x5451: 0x00c0, + 0x5452: 0x00c0, 0x5453: 0x00c0, 0x5454: 0x00c0, 0x5455: 0x00c0, 0x5456: 0x00c0, 0x5457: 0x00c0, + 0x5458: 0x00c0, 0x5459: 0x00c0, + 0x545e: 0x0080, 0x545f: 0x0080, + // Block 0x152, offset 0x5480 + 0x54b1: 0x0080, 0x54b2: 0x0080, 0x54b3: 0x0080, 0x54b4: 0x0080, 0x54b5: 0x0080, + 0x54b6: 0x0080, 0x54b7: 0x0080, 0x54b8: 0x0080, 0x54b9: 0x0080, 0x54ba: 0x0080, 0x54bb: 0x0080, + 0x54bc: 0x0080, 0x54bd: 0x0080, 0x54be: 0x0080, 0x54bf: 0x0080, + // Block 0x153, offset 0x54c0 + 0x54c0: 0x0080, 0x54c1: 0x0080, 0x54c2: 0x0080, 0x54c3: 0x0080, 0x54c4: 0x0080, 0x54c5: 0x0080, + 0x54c6: 0x0080, 0x54c7: 0x0080, 0x54c8: 0x0080, 0x54c9: 0x0080, 0x54ca: 0x0080, 0x54cb: 0x0080, + 0x54cc: 0x0080, 0x54cd: 0x0080, 0x54ce: 0x0080, 0x54cf: 0x0080, 0x54d0: 0x0080, 0x54d1: 0x0080, + 0x54d2: 0x0080, 0x54d3: 0x0080, 0x54d4: 0x0080, 0x54d5: 0x0080, 0x54d6: 0x0080, 0x54d7: 0x0080, + 0x54d8: 0x0080, 0x54d9: 0x0080, 0x54da: 0x0080, 0x54db: 0x0080, 0x54dc: 0x0080, 0x54dd: 0x0080, + 0x54de: 0x0080, 0x54df: 0x0080, 0x54e0: 0x0080, 0x54e1: 0x0080, 0x54e2: 0x0080, 0x54e3: 0x0080, + 0x54e4: 0x0080, 0x54e5: 0x0080, 0x54e6: 0x0080, 0x54e7: 0x0080, 0x54e8: 0x0080, 0x54e9: 0x0080, + 0x54ea: 0x0080, 0x54eb: 0x0080, 0x54ec: 0x0080, 0x54ed: 0x0080, 0x54ee: 0x0080, 0x54ef: 0x0080, + 0x54f0: 0x0080, 0x54f1: 0x0080, 0x54f2: 0x0080, 0x54f3: 0x0080, 0x54f4: 0x0080, + // Block 0x154, offset 0x5500 + 0x5501: 0x0080, 0x5502: 0x0080, 0x5503: 0x0080, 0x5504: 0x0080, 0x5505: 0x0080, + 0x5506: 0x0080, 0x5507: 0x0080, 0x5508: 0x0080, 0x5509: 0x0080, 0x550a: 0x0080, 0x550b: 0x0080, + 0x550c: 0x0080, 0x550d: 0x0080, 0x550e: 0x0080, 0x550f: 0x0080, 0x5510: 0x0080, 0x5511: 0x0080, + 0x5512: 0x0080, 0x5513: 0x0080, 0x5514: 0x0080, 0x5515: 0x0080, 0x5516: 0x0080, 0x5517: 0x0080, + 0x5518: 0x0080, 0x5519: 0x0080, 0x551a: 0x0080, 0x551b: 0x0080, 0x551c: 0x0080, 0x551d: 0x0080, + 0x551e: 0x0080, 0x551f: 0x0080, 0x5520: 0x0080, 0x5521: 0x0080, 0x5522: 0x0080, 0x5523: 0x0080, + 0x5524: 0x0080, 0x5525: 0x0080, 0x5526: 0x0080, 0x5527: 0x0080, 0x5528: 0x0080, 0x5529: 0x0080, + 0x552a: 0x0080, 0x552b: 0x0080, 0x552c: 0x0080, 0x552d: 0x0080, 0x552e: 0x0080, 0x552f: 0x0080, + 0x5530: 0x0080, 0x5531: 0x0080, 0x5532: 0x0080, 0x5533: 0x0080, 0x5534: 0x0080, 0x5535: 0x0080, + 0x5536: 0x0080, 0x5537: 0x0080, 0x5538: 0x0080, 0x5539: 0x0080, 0x553a: 0x0080, 0x553b: 0x0080, + 0x553c: 0x0080, 0x553d: 0x0080, + // Block 0x155, offset 0x5540 + 0x5540: 0x0080, 0x5541: 0x0080, 0x5542: 0x0080, 0x5543: 0x0080, 0x5545: 0x0080, + 0x5546: 0x0080, 0x5547: 0x0080, 0x5548: 0x0080, 0x5549: 0x0080, 0x554a: 0x0080, 0x554b: 0x0080, + 0x554c: 0x0080, 0x554d: 0x0080, 0x554e: 0x0080, 0x554f: 0x0080, 0x5550: 0x0080, 0x5551: 0x0080, + 0x5552: 0x0080, 0x5553: 0x0080, 0x5554: 0x0080, 0x5555: 0x0080, 0x5556: 0x0080, 0x5557: 0x0080, + 0x5558: 0x0080, 0x5559: 0x0080, 0x555a: 0x0080, 0x555b: 0x0080, 0x555c: 0x0080, 0x555d: 0x0080, + 0x555e: 0x0080, 0x555f: 0x0080, 0x5561: 0x0080, 0x5562: 0x0080, + 0x5564: 0x0080, 0x5567: 0x0080, 0x5569: 0x0080, + 0x556a: 0x0080, 0x556b: 0x0080, 0x556c: 0x0080, 0x556d: 0x0080, 0x556e: 0x0080, 0x556f: 0x0080, + 0x5570: 0x0080, 0x5571: 0x0080, 0x5572: 0x0080, 0x5574: 0x0080, 0x5575: 0x0080, + 0x5576: 0x0080, 0x5577: 0x0080, 0x5579: 0x0080, 0x557b: 0x0080, + // Block 0x156, offset 0x5580 + 0x5582: 0x0080, + 0x5587: 0x0080, 0x5589: 0x0080, 0x558b: 0x0080, + 0x558d: 0x0080, 0x558e: 0x0080, 0x558f: 0x0080, 0x5591: 0x0080, + 0x5592: 0x0080, 0x5594: 0x0080, 0x5597: 0x0080, + 0x5599: 0x0080, 0x559b: 0x0080, 0x559d: 0x0080, + 0x559f: 0x0080, 0x55a1: 0x0080, 0x55a2: 0x0080, + 0x55a4: 0x0080, 0x55a7: 0x0080, 0x55a8: 0x0080, 0x55a9: 0x0080, + 0x55aa: 0x0080, 0x55ac: 0x0080, 0x55ad: 0x0080, 0x55ae: 0x0080, 0x55af: 0x0080, + 0x55b0: 0x0080, 0x55b1: 0x0080, 0x55b2: 0x0080, 0x55b4: 0x0080, 0x55b5: 0x0080, + 0x55b6: 0x0080, 0x55b7: 0x0080, 0x55b9: 0x0080, 0x55ba: 0x0080, 0x55bb: 0x0080, + 0x55bc: 0x0080, 0x55be: 0x0080, + // Block 0x157, offset 0x55c0 + 0x55c0: 0x0080, 0x55c1: 0x0080, 0x55c2: 0x0080, 0x55c3: 0x0080, 0x55c4: 0x0080, 0x55c5: 0x0080, + 0x55c6: 0x0080, 0x55c7: 0x0080, 0x55c8: 0x0080, 0x55c9: 0x0080, 0x55cb: 0x0080, + 0x55cc: 0x0080, 0x55cd: 0x0080, 0x55ce: 0x0080, 0x55cf: 0x0080, 0x55d0: 0x0080, 0x55d1: 0x0080, + 0x55d2: 0x0080, 0x55d3: 0x0080, 0x55d4: 0x0080, 0x55d5: 0x0080, 0x55d6: 0x0080, 0x55d7: 0x0080, + 0x55d8: 0x0080, 0x55d9: 0x0080, 0x55da: 0x0080, 0x55db: 0x0080, + 0x55e1: 0x0080, 0x55e2: 0x0080, 0x55e3: 0x0080, + 0x55e5: 0x0080, 0x55e6: 0x0080, 0x55e7: 0x0080, 0x55e8: 0x0080, 0x55e9: 0x0080, + 0x55eb: 0x0080, 0x55ec: 0x0080, 0x55ed: 0x0080, 0x55ee: 0x0080, 0x55ef: 0x0080, + 0x55f0: 0x0080, 0x55f1: 0x0080, 0x55f2: 0x0080, 0x55f3: 0x0080, 0x55f4: 0x0080, 0x55f5: 0x0080, + 0x55f6: 0x0080, 0x55f7: 0x0080, 0x55f8: 0x0080, 0x55f9: 0x0080, 0x55fa: 0x0080, 0x55fb: 0x0080, + // Block 0x158, offset 0x5600 + 0x5630: 0x0080, 0x5631: 0x0080, + // Block 0x159, offset 0x5640 + 0x5640: 0x0080, 0x5641: 0x0080, 0x5642: 0x0080, 0x5643: 0x0080, 0x5644: 0x0080, 0x5645: 0x0080, + 0x5646: 0x0080, 0x5647: 0x0080, 0x5648: 0x0080, 0x5649: 0x0080, 0x564a: 0x0080, 0x564b: 0x0080, + 0x564c: 0x0080, 0x564d: 0x0080, 0x564e: 0x0080, 0x564f: 0x0080, 0x5650: 0x0080, 0x5651: 0x0080, + 0x5652: 0x0080, 0x5653: 0x0080, 0x5654: 0x0080, 0x5655: 0x0080, 0x5656: 0x0080, 0x5657: 0x0080, + 0x5658: 0x0080, 0x5659: 0x0080, 0x565a: 0x0080, 0x565b: 0x0080, 0x565c: 0x0080, 0x565d: 0x0080, + 0x565e: 0x0080, 0x565f: 0x0080, 0x5660: 0x0080, 0x5661: 0x0080, 0x5662: 0x0080, 0x5663: 0x0080, + 0x5664: 0x0080, 0x5665: 0x0080, 0x5666: 0x0080, 0x5667: 0x0080, 0x5668: 0x0080, 0x5669: 0x0080, + 0x566a: 0x0080, 0x566b: 0x0080, + 0x5670: 0x0080, 0x5671: 0x0080, 0x5672: 0x0080, 0x5673: 0x0080, 0x5674: 0x0080, 0x5675: 0x0080, + 0x5676: 0x0080, 0x5677: 0x0080, 0x5678: 0x0080, 0x5679: 0x0080, 0x567a: 0x0080, 0x567b: 0x0080, + 0x567c: 0x0080, 0x567d: 0x0080, 0x567e: 0x0080, 0x567f: 0x0080, + // Block 0x15a, offset 0x5680 + 0x5680: 0x0080, 0x5681: 0x0080, 0x5682: 0x0080, 0x5683: 0x0080, 0x5684: 0x0080, 0x5685: 0x0080, + 0x5686: 0x0080, 0x5687: 0x0080, 0x5688: 0x0080, 0x5689: 0x0080, 0x568a: 0x0080, 0x568b: 0x0080, + 0x568c: 0x0080, 0x568d: 0x0080, 0x568e: 0x0080, 0x568f: 0x0080, 0x5690: 0x0080, 0x5691: 0x0080, + 0x5692: 0x0080, 0x5693: 0x0080, + 0x56a0: 0x0080, 0x56a1: 0x0080, 0x56a2: 0x0080, 0x56a3: 0x0080, + 0x56a4: 0x0080, 0x56a5: 0x0080, 0x56a6: 0x0080, 0x56a7: 0x0080, 0x56a8: 0x0080, 0x56a9: 0x0080, + 0x56aa: 0x0080, 0x56ab: 0x0080, 0x56ac: 0x0080, 0x56ad: 0x0080, 0x56ae: 0x0080, + 0x56b1: 0x0080, 0x56b2: 0x0080, 0x56b3: 0x0080, 0x56b4: 0x0080, 0x56b5: 0x0080, + 0x56b6: 0x0080, 0x56b7: 0x0080, 0x56b8: 0x0080, 0x56b9: 0x0080, 0x56ba: 0x0080, 0x56bb: 0x0080, + 0x56bc: 0x0080, 0x56bd: 0x0080, 0x56be: 0x0080, 0x56bf: 0x0080, + // Block 0x15b, offset 0x56c0 + 0x56c1: 0x0080, 0x56c2: 0x0080, 0x56c3: 0x0080, 0x56c4: 0x0080, 0x56c5: 0x0080, + 0x56c6: 0x0080, 0x56c7: 0x0080, 0x56c8: 0x0080, 0x56c9: 0x0080, 0x56ca: 0x0080, 0x56cb: 0x0080, + 0x56cc: 0x0080, 0x56cd: 0x0080, 0x56ce: 0x0080, 0x56cf: 0x0080, 0x56d1: 0x0080, + 0x56d2: 0x0080, 0x56d3: 0x0080, 0x56d4: 0x0080, 0x56d5: 0x0080, 0x56d6: 0x0080, 0x56d7: 0x0080, + 0x56d8: 0x0080, 0x56d9: 0x0080, 0x56da: 0x0080, 0x56db: 0x0080, 0x56dc: 0x0080, 0x56dd: 0x0080, + 0x56de: 0x0080, 0x56df: 0x0080, 0x56e0: 0x0080, 0x56e1: 0x0080, 0x56e2: 0x0080, 0x56e3: 0x0080, + 0x56e4: 0x0080, 0x56e5: 0x0080, 0x56e6: 0x0080, 0x56e7: 0x0080, 0x56e8: 0x0080, 0x56e9: 0x0080, + 0x56ea: 0x0080, 0x56eb: 0x0080, 0x56ec: 0x0080, 0x56ed: 0x0080, 0x56ee: 0x0080, 0x56ef: 0x0080, + 0x56f0: 0x0080, 0x56f1: 0x0080, 0x56f2: 0x0080, 0x56f3: 0x0080, 0x56f4: 0x0080, 0x56f5: 0x0080, + // Block 0x15c, offset 0x5700 + 0x5726: 0x0080, 0x5727: 0x0080, 0x5728: 0x0080, 0x5729: 0x0080, + 0x572a: 0x0080, 0x572b: 0x0080, 0x572c: 0x0080, 0x572d: 0x0080, 0x572e: 0x0080, 0x572f: 0x0080, + 0x5730: 0x0080, 0x5731: 0x0080, 0x5732: 0x0080, 0x5733: 0x0080, 0x5734: 0x0080, 0x5735: 0x0080, + 0x5736: 0x0080, 0x5737: 0x0080, 0x5738: 0x0080, 0x5739: 0x0080, 0x573a: 0x0080, 0x573b: 0x0080, + 0x573c: 0x0080, 0x573d: 0x0080, 0x573e: 0x0080, 0x573f: 0x0080, + // Block 0x15d, offset 0x5740 + 0x5740: 0x008c, 0x5741: 0x0080, 0x5742: 0x0080, + 0x5750: 0x0080, 0x5751: 0x0080, + 0x5752: 0x0080, 0x5753: 0x0080, 0x5754: 0x0080, 0x5755: 0x0080, 0x5756: 0x0080, 0x5757: 0x0080, + 0x5758: 0x0080, 0x5759: 0x0080, 0x575a: 0x0080, 0x575b: 0x0080, 0x575c: 0x0080, 0x575d: 0x0080, + 0x575e: 0x0080, 0x575f: 0x0080, 0x5760: 0x0080, 0x5761: 0x0080, 0x5762: 0x0080, 0x5763: 0x0080, + 0x5764: 0x0080, 0x5765: 0x0080, 0x5766: 0x0080, 0x5767: 0x0080, 0x5768: 0x0080, 0x5769: 0x0080, + 0x576a: 0x0080, 0x576b: 0x0080, 0x576c: 0x0080, 0x576d: 0x0080, 0x576e: 0x0080, 0x576f: 0x0080, + 0x5770: 0x0080, 0x5771: 0x0080, 0x5772: 0x0080, 0x5773: 0x0080, 0x5774: 0x0080, 0x5775: 0x0080, + 0x5776: 0x0080, 0x5777: 0x0080, 0x5778: 0x0080, 0x5779: 0x0080, 0x577a: 0x0080, 0x577b: 0x0080, + // Block 0x15e, offset 0x5780 + 0x5780: 0x0080, 0x5781: 0x0080, 0x5782: 0x0080, 0x5783: 0x0080, 0x5784: 0x0080, 0x5785: 0x0080, + 0x5786: 0x0080, 0x5787: 0x0080, 0x5788: 0x0080, + 0x5790: 0x0080, 0x5791: 0x0080, + 0x57a0: 0x0080, 0x57a1: 0x0080, 0x57a2: 0x0080, 0x57a3: 0x0080, + 0x57a4: 0x0080, 0x57a5: 0x0080, + // Block 0x15f, offset 0x57c0 + 0x57c0: 0x0080, 0x57c1: 0x0080, 0x57c2: 0x0080, 0x57c3: 0x0080, 0x57c4: 0x0080, 0x57c5: 0x0080, + 0x57c6: 0x0080, 0x57c7: 0x0080, 0x57c8: 0x0080, 0x57c9: 0x0080, 0x57ca: 0x0080, 0x57cb: 0x0080, + 0x57cc: 0x0080, 0x57cd: 0x0080, 0x57ce: 0x0080, 0x57cf: 0x0080, 0x57d0: 0x0080, 0x57d1: 0x0080, + 0x57d2: 0x0080, 0x57d3: 0x0080, 0x57d4: 0x0080, 0x57d5: 0x0080, 0x57d6: 0x0080, 0x57d7: 0x0080, + 0x57dc: 0x0080, 0x57dd: 0x0080, + 0x57de: 0x0080, 0x57df: 0x0080, 0x57e0: 0x0080, 0x57e1: 0x0080, 0x57e2: 0x0080, 0x57e3: 0x0080, + 0x57e4: 0x0080, 0x57e5: 0x0080, 0x57e6: 0x0080, 0x57e7: 0x0080, 0x57e8: 0x0080, 0x57e9: 0x0080, + 0x57ea: 0x0080, 0x57eb: 0x0080, 0x57ec: 0x0080, + 0x57f0: 0x0080, 0x57f1: 0x0080, 0x57f2: 0x0080, 0x57f3: 0x0080, 0x57f4: 0x0080, 0x57f5: 0x0080, + 0x57f6: 0x0080, 0x57f7: 0x0080, 0x57f8: 0x0080, 0x57f9: 0x0080, 0x57fa: 0x0080, 0x57fb: 0x0080, + 0x57fc: 0x0080, + // Block 0x160, offset 0x5800 + 0x5800: 0x0080, 0x5801: 0x0080, 0x5802: 0x0080, 0x5803: 0x0080, 0x5804: 0x0080, 0x5805: 0x0080, + 0x5806: 0x0080, 0x5807: 0x0080, 0x5808: 0x0080, 0x5809: 0x0080, 0x580a: 0x0080, 0x580b: 0x0080, + 0x580c: 0x0080, 0x580d: 0x0080, 0x580e: 0x0080, 0x580f: 0x0080, 0x5810: 0x0080, 0x5811: 0x0080, + 0x5812: 0x0080, 0x5813: 0x0080, 0x5814: 0x0080, 0x5815: 0x0080, 0x5816: 0x0080, 0x5817: 0x0080, + 0x5818: 0x0080, 0x5819: 0x0080, 0x581a: 0x0080, 0x581b: 0x0080, 0x581c: 0x0080, 0x581d: 0x0080, + 0x581e: 0x0080, 0x581f: 0x0080, 0x5820: 0x0080, 0x5821: 0x0080, 0x5822: 0x0080, 0x5823: 0x0080, + 0x5824: 0x0080, 0x5825: 0x0080, 0x5826: 0x0080, 0x5827: 0x0080, 0x5828: 0x0080, 0x5829: 0x0080, + 0x582a: 0x0080, 0x582b: 0x0080, 0x582c: 0x0080, 0x582d: 0x0080, 0x582e: 0x0080, 0x582f: 0x0080, + 0x5830: 0x0080, 0x5831: 0x0080, 0x5832: 0x0080, 0x5833: 0x0080, 0x5834: 0x0080, 0x5835: 0x0080, + 0x5836: 0x0080, 0x583b: 0x0080, + 0x583c: 0x0080, 0x583d: 0x0080, 0x583e: 0x0080, 0x583f: 0x0080, + // Block 0x161, offset 0x5840 + 0x5840: 0x0080, 0x5841: 0x0080, 0x5842: 0x0080, 0x5843: 0x0080, 0x5844: 0x0080, 0x5845: 0x0080, + 0x5846: 0x0080, 0x5847: 0x0080, 0x5848: 0x0080, 0x5849: 0x0080, 0x584a: 0x0080, 0x584b: 0x0080, + 0x584c: 0x0080, 0x584d: 0x0080, 0x584e: 0x0080, 0x584f: 0x0080, 0x5850: 0x0080, 0x5851: 0x0080, + 0x5852: 0x0080, 0x5853: 0x0080, 0x5854: 0x0080, 0x5855: 0x0080, 0x5856: 0x0080, 0x5857: 0x0080, + 0x5858: 0x0080, 0x5859: 0x0080, + 0x5860: 0x0080, 0x5861: 0x0080, 0x5862: 0x0080, 0x5863: 0x0080, + 0x5864: 0x0080, 0x5865: 0x0080, 0x5866: 0x0080, 0x5867: 0x0080, 0x5868: 0x0080, 0x5869: 0x0080, + 0x586a: 0x0080, 0x586b: 0x0080, + 0x5870: 0x0080, + // Block 0x162, offset 0x5880 + 0x5880: 0x0080, 0x5881: 0x0080, 0x5882: 0x0080, 0x5883: 0x0080, 0x5884: 0x0080, 0x5885: 0x0080, + 0x5886: 0x0080, 0x5887: 0x0080, 0x5888: 0x0080, 0x5889: 0x0080, 0x588a: 0x0080, 0x588b: 0x0080, + 0x5890: 0x0080, 0x5891: 0x0080, + 0x5892: 0x0080, 0x5893: 0x0080, 0x5894: 0x0080, 0x5895: 0x0080, 0x5896: 0x0080, 0x5897: 0x0080, + 0x5898: 0x0080, 0x5899: 0x0080, 0x589a: 0x0080, 0x589b: 0x0080, 0x589c: 0x0080, 0x589d: 0x0080, + 0x589e: 0x0080, 0x589f: 0x0080, 0x58a0: 0x0080, 0x58a1: 0x0080, 0x58a2: 0x0080, 0x58a3: 0x0080, + 0x58a4: 0x0080, 0x58a5: 0x0080, 0x58a6: 0x0080, 0x58a7: 0x0080, 0x58a8: 0x0080, 0x58a9: 0x0080, + 0x58aa: 0x0080, 0x58ab: 0x0080, 0x58ac: 0x0080, 0x58ad: 0x0080, 0x58ae: 0x0080, 0x58af: 0x0080, + 0x58b0: 0x0080, 0x58b1: 0x0080, 0x58b2: 0x0080, 0x58b3: 0x0080, 0x58b4: 0x0080, 0x58b5: 0x0080, + 0x58b6: 0x0080, 0x58b7: 0x0080, 0x58b8: 0x0080, 0x58b9: 0x0080, 0x58ba: 0x0080, 0x58bb: 0x0080, + 0x58bc: 0x0080, 0x58bd: 0x0080, 0x58be: 0x0080, 0x58bf: 0x0080, + // Block 0x163, offset 0x58c0 + 0x58c0: 0x0080, 0x58c1: 0x0080, 0x58c2: 0x0080, 0x58c3: 0x0080, 0x58c4: 0x0080, 0x58c5: 0x0080, + 0x58c6: 0x0080, 0x58c7: 0x0080, + 0x58d0: 0x0080, 0x58d1: 0x0080, + 0x58d2: 0x0080, 0x58d3: 0x0080, 0x58d4: 0x0080, 0x58d5: 0x0080, 0x58d6: 0x0080, 0x58d7: 0x0080, + 0x58d8: 0x0080, 0x58d9: 0x0080, + 0x58e0: 0x0080, 0x58e1: 0x0080, 0x58e2: 0x0080, 0x58e3: 0x0080, + 0x58e4: 0x0080, 0x58e5: 0x0080, 0x58e6: 0x0080, 0x58e7: 0x0080, 0x58e8: 0x0080, 0x58e9: 0x0080, + 0x58ea: 0x0080, 0x58eb: 0x0080, 0x58ec: 0x0080, 0x58ed: 0x0080, 0x58ee: 0x0080, 0x58ef: 0x0080, + 0x58f0: 0x0080, 0x58f1: 0x0080, 0x58f2: 0x0080, 0x58f3: 0x0080, 0x58f4: 0x0080, 0x58f5: 0x0080, + 0x58f6: 0x0080, 0x58f7: 0x0080, 0x58f8: 0x0080, 0x58f9: 0x0080, 0x58fa: 0x0080, 0x58fb: 0x0080, + 0x58fc: 0x0080, 0x58fd: 0x0080, 0x58fe: 0x0080, 0x58ff: 0x0080, + // Block 0x164, offset 0x5900 + 0x5900: 0x0080, 0x5901: 0x0080, 0x5902: 0x0080, 0x5903: 0x0080, 0x5904: 0x0080, 0x5905: 0x0080, + 0x5906: 0x0080, 0x5907: 0x0080, + 0x5910: 0x0080, 0x5911: 0x0080, + 0x5912: 0x0080, 0x5913: 0x0080, 0x5914: 0x0080, 0x5915: 0x0080, 0x5916: 0x0080, 0x5917: 0x0080, + 0x5918: 0x0080, 0x5919: 0x0080, 0x591a: 0x0080, 0x591b: 0x0080, 0x591c: 0x0080, 0x591d: 0x0080, + 0x591e: 0x0080, 0x591f: 0x0080, 0x5920: 0x0080, 0x5921: 0x0080, 0x5922: 0x0080, 0x5923: 0x0080, + 0x5924: 0x0080, 0x5925: 0x0080, 0x5926: 0x0080, 0x5927: 0x0080, 0x5928: 0x0080, 0x5929: 0x0080, + 0x592a: 0x0080, 0x592b: 0x0080, 0x592c: 0x0080, 0x592d: 0x0080, + 0x5930: 0x0080, 0x5931: 0x0080, + // Block 0x165, offset 0x5940 + 0x5940: 0x0080, 0x5941: 0x0080, 0x5942: 0x0080, 0x5943: 0x0080, 0x5944: 0x0080, 0x5945: 0x0080, + 0x5946: 0x0080, 0x5947: 0x0080, 0x5948: 0x0080, 0x5949: 0x0080, 0x594a: 0x0080, 0x594b: 0x0080, + 0x594c: 0x0080, 0x594d: 0x0080, 0x594e: 0x0080, 0x594f: 0x0080, 0x5950: 0x0080, 0x5951: 0x0080, + 0x5952: 0x0080, 0x5953: 0x0080, + 0x5960: 0x0080, 0x5961: 0x0080, 0x5962: 0x0080, 0x5963: 0x0080, + 0x5964: 0x0080, 0x5965: 0x0080, 0x5966: 0x0080, 0x5967: 0x0080, 0x5968: 0x0080, 0x5969: 0x0080, + 0x596a: 0x0080, 0x596b: 0x0080, 0x596c: 0x0080, 0x596d: 0x0080, + 0x5970: 0x0080, 0x5971: 0x0080, 0x5972: 0x0080, 0x5973: 0x0080, 0x5974: 0x0080, 0x5975: 0x0080, + 0x5976: 0x0080, 0x5977: 0x0080, 0x5978: 0x0080, 0x5979: 0x0080, 0x597a: 0x0080, 0x597b: 0x0080, + 0x597c: 0x0080, + // Block 0x166, offset 0x5980 + 0x5980: 0x0080, 0x5981: 0x0080, 0x5982: 0x0080, 0x5983: 0x0080, 0x5984: 0x0080, 0x5985: 0x0080, + 0x5986: 0x0080, 0x5987: 0x0080, 0x5988: 0x0080, + 0x5990: 0x0080, 0x5991: 0x0080, + 0x5992: 0x0080, 0x5993: 0x0080, 0x5994: 0x0080, 0x5995: 0x0080, 0x5996: 0x0080, 0x5997: 0x0080, + 0x5998: 0x0080, 0x5999: 0x0080, 0x599a: 0x0080, 0x599b: 0x0080, 0x599c: 0x0080, 0x599d: 0x0080, + 0x599e: 0x0080, 0x599f: 0x0080, 0x59a0: 0x0080, 0x59a1: 0x0080, 0x59a2: 0x0080, 0x59a3: 0x0080, + 0x59a4: 0x0080, 0x59a5: 0x0080, 0x59a6: 0x0080, 0x59a7: 0x0080, 0x59a8: 0x0080, 0x59a9: 0x0080, + 0x59aa: 0x0080, 0x59ab: 0x0080, 0x59ac: 0x0080, 0x59ad: 0x0080, 0x59ae: 0x0080, 0x59af: 0x0080, + 0x59b0: 0x0080, 0x59b1: 0x0080, 0x59b2: 0x0080, 0x59b3: 0x0080, 0x59b4: 0x0080, 0x59b5: 0x0080, + 0x59b6: 0x0080, 0x59b7: 0x0080, 0x59b8: 0x0080, 0x59b9: 0x0080, 0x59ba: 0x0080, 0x59bb: 0x0080, + 0x59bc: 0x0080, 0x59bd: 0x0080, 0x59bf: 0x0080, + // Block 0x167, offset 0x59c0 + 0x59c0: 0x0080, 0x59c1: 0x0080, 0x59c2: 0x0080, 0x59c3: 0x0080, 0x59c4: 0x0080, 0x59c5: 0x0080, + 0x59ce: 0x0080, 0x59cf: 0x0080, 0x59d0: 0x0080, 0x59d1: 0x0080, + 0x59d2: 0x0080, 0x59d3: 0x0080, 0x59d4: 0x0080, 0x59d5: 0x0080, 0x59d6: 0x0080, 0x59d7: 0x0080, + 0x59d8: 0x0080, 0x59d9: 0x0080, 0x59da: 0x0080, 0x59db: 0x0080, + 0x59e0: 0x0080, 0x59e1: 0x0080, 0x59e2: 0x0080, 0x59e3: 0x0080, + 0x59e4: 0x0080, 0x59e5: 0x0080, 0x59e6: 0x0080, 0x59e7: 0x0080, 0x59e8: 0x0080, + 0x59f0: 0x0080, 0x59f1: 0x0080, 0x59f2: 0x0080, 0x59f3: 0x0080, 0x59f4: 0x0080, 0x59f5: 0x0080, + 0x59f6: 0x0080, 0x59f7: 0x0080, 0x59f8: 0x0080, + // Block 0x168, offset 0x5a00 + 0x5a00: 0x0080, 0x5a01: 0x0080, 0x5a02: 0x0080, 0x5a03: 0x0080, 0x5a04: 0x0080, 0x5a05: 0x0080, + 0x5a06: 0x0080, 0x5a07: 0x0080, 0x5a08: 0x0080, 0x5a09: 0x0080, 0x5a0a: 0x0080, 0x5a0b: 0x0080, + 0x5a0c: 0x0080, 0x5a0d: 0x0080, 0x5a0e: 0x0080, 0x5a0f: 0x0080, 0x5a10: 0x0080, 0x5a11: 0x0080, + 0x5a12: 0x0080, 0x5a14: 0x0080, 0x5a15: 0x0080, 0x5a16: 0x0080, 0x5a17: 0x0080, + 0x5a18: 0x0080, 0x5a19: 0x0080, 0x5a1a: 0x0080, 0x5a1b: 0x0080, 0x5a1c: 0x0080, 0x5a1d: 0x0080, + 0x5a1e: 0x0080, 0x5a1f: 0x0080, 0x5a20: 0x0080, 0x5a21: 0x0080, 0x5a22: 0x0080, 0x5a23: 0x0080, + 0x5a24: 0x0080, 0x5a25: 0x0080, 0x5a26: 0x0080, 0x5a27: 0x0080, 0x5a28: 0x0080, 0x5a29: 0x0080, + 0x5a2a: 0x0080, 0x5a2b: 0x0080, 0x5a2c: 0x0080, 0x5a2d: 0x0080, 0x5a2e: 0x0080, 0x5a2f: 0x0080, + 0x5a30: 0x0080, 0x5a31: 0x0080, 0x5a32: 0x0080, 0x5a33: 0x0080, 0x5a34: 0x0080, 0x5a35: 0x0080, + 0x5a36: 0x0080, 0x5a37: 0x0080, 0x5a38: 0x0080, 0x5a39: 0x0080, 0x5a3a: 0x0080, 0x5a3b: 0x0080, + 0x5a3c: 0x0080, 0x5a3d: 0x0080, 0x5a3e: 0x0080, 0x5a3f: 0x0080, + // Block 0x169, offset 0x5a40 + 0x5a40: 0x0080, 0x5a41: 0x0080, 0x5a42: 0x0080, 0x5a43: 0x0080, 0x5a44: 0x0080, 0x5a45: 0x0080, + 0x5a46: 0x0080, 0x5a47: 0x0080, 0x5a48: 0x0080, 0x5a49: 0x0080, 0x5a4a: 0x0080, + 0x5a70: 0x0080, 0x5a71: 0x0080, 0x5a72: 0x0080, 0x5a73: 0x0080, 0x5a74: 0x0080, 0x5a75: 0x0080, + 0x5a76: 0x0080, 0x5a77: 0x0080, 0x5a78: 0x0080, 0x5a79: 0x0080, + // Block 0x16a, offset 0x5a80 + 0x5a80: 0x00cc, 0x5a81: 0x00cc, 0x5a82: 0x00cc, 0x5a83: 0x00cc, 0x5a84: 0x00cc, 0x5a85: 0x00cc, + 0x5a86: 0x00cc, 0x5a87: 0x00cc, 0x5a88: 0x00cc, 0x5a89: 0x00cc, 0x5a8a: 0x00cc, 0x5a8b: 0x00cc, + 0x5a8c: 0x00cc, 0x5a8d: 0x00cc, 0x5a8e: 0x00cc, 0x5a8f: 0x00cc, 0x5a90: 0x00cc, 0x5a91: 0x00cc, + 0x5a92: 0x00cc, 0x5a93: 0x00cc, 0x5a94: 0x00cc, 0x5a95: 0x00cc, 0x5a96: 0x00cc, 0x5a97: 0x00cc, + 0x5a98: 0x00cc, 0x5a99: 0x00cc, 0x5a9a: 0x00cc, 0x5a9b: 0x00cc, 0x5a9c: 0x00cc, 0x5a9d: 0x00cc, + 0x5a9e: 0x00cc, 0x5a9f: 0x00cc, + // Block 0x16b, offset 0x5ac0 + 0x5ac0: 0x00cc, 0x5ac1: 0x00cc, 0x5ac2: 0x00cc, 0x5ac3: 0x00cc, 0x5ac4: 0x00cc, 0x5ac5: 0x00cc, + 0x5ac6: 0x00cc, 0x5ac7: 0x00cc, 0x5ac8: 0x00cc, 0x5ac9: 0x00cc, 0x5aca: 0x00cc, 0x5acb: 0x00cc, + 0x5acc: 0x00cc, 0x5acd: 0x00cc, 0x5ace: 0x00cc, 0x5acf: 0x00cc, 0x5ad0: 0x00cc, 0x5ad1: 0x00cc, + 0x5ad2: 0x00cc, 0x5ad3: 0x00cc, 0x5ad4: 0x00cc, 0x5ad5: 0x00cc, 0x5ad6: 0x00cc, 0x5ad7: 0x00cc, + 0x5ad8: 0x00cc, 0x5ad9: 0x00cc, 0x5ada: 0x00cc, 0x5adb: 0x00cc, 0x5adc: 0x00cc, 0x5add: 0x00cc, + 0x5ade: 0x00cc, 0x5adf: 0x00cc, 0x5ae0: 0x00cc, 0x5ae1: 0x00cc, 0x5ae2: 0x00cc, 0x5ae3: 0x00cc, + 0x5ae4: 0x00cc, 0x5ae5: 0x00cc, 0x5ae6: 0x00cc, 0x5ae7: 0x00cc, 0x5ae8: 0x00cc, 0x5ae9: 0x00cc, + 0x5aea: 0x00cc, 0x5aeb: 0x00cc, 0x5aec: 0x00cc, 0x5aed: 0x00cc, 0x5aee: 0x00cc, 0x5aef: 0x00cc, + 0x5af0: 0x00cc, 0x5af1: 0x00cc, 0x5af2: 0x00cc, 0x5af3: 0x00cc, 0x5af4: 0x00cc, 0x5af5: 0x00cc, + 0x5af6: 0x00cc, 0x5af7: 0x00cc, 0x5af8: 0x00cc, 0x5af9: 0x00cc, + // Block 0x16c, offset 0x5b00 + 0x5b00: 0x00cc, 0x5b01: 0x00cc, 0x5b02: 0x00cc, 0x5b03: 0x00cc, 0x5b04: 0x00cc, 0x5b05: 0x00cc, + 0x5b06: 0x00cc, 0x5b07: 0x00cc, 0x5b08: 0x00cc, 0x5b09: 0x00cc, 0x5b0a: 0x00cc, 0x5b0b: 0x00cc, + 0x5b0c: 0x00cc, 0x5b0d: 0x00cc, 0x5b0e: 0x00cc, 0x5b0f: 0x00cc, 0x5b10: 0x00cc, 0x5b11: 0x00cc, + 0x5b12: 0x00cc, 0x5b13: 0x00cc, 0x5b14: 0x00cc, 0x5b15: 0x00cc, 0x5b16: 0x00cc, 0x5b17: 0x00cc, + 0x5b18: 0x00cc, 0x5b19: 0x00cc, 0x5b1a: 0x00cc, 0x5b1b: 0x00cc, 0x5b1c: 0x00cc, 0x5b1d: 0x00cc, + 0x5b20: 0x00cc, 0x5b21: 0x00cc, 0x5b22: 0x00cc, 0x5b23: 0x00cc, + 0x5b24: 0x00cc, 0x5b25: 0x00cc, 0x5b26: 0x00cc, 0x5b27: 0x00cc, 0x5b28: 0x00cc, 0x5b29: 0x00cc, + 0x5b2a: 0x00cc, 0x5b2b: 0x00cc, 0x5b2c: 0x00cc, 0x5b2d: 0x00cc, 0x5b2e: 0x00cc, 0x5b2f: 0x00cc, + 0x5b30: 0x00cc, 0x5b31: 0x00cc, 0x5b32: 0x00cc, 0x5b33: 0x00cc, 0x5b34: 0x00cc, 0x5b35: 0x00cc, + 0x5b36: 0x00cc, 0x5b37: 0x00cc, 0x5b38: 0x00cc, 0x5b39: 0x00cc, 0x5b3a: 0x00cc, 0x5b3b: 0x00cc, + 0x5b3c: 0x00cc, 0x5b3d: 0x00cc, 0x5b3e: 0x00cc, 0x5b3f: 0x00cc, + // Block 0x16d, offset 0x5b40 + 0x5b40: 0x00cc, 0x5b41: 0x00cc, 0x5b42: 0x00cc, 0x5b43: 0x00cc, 0x5b44: 0x00cc, 0x5b45: 0x00cc, + 0x5b46: 0x00cc, 0x5b47: 0x00cc, 0x5b48: 0x00cc, 0x5b49: 0x00cc, 0x5b4a: 0x00cc, 0x5b4b: 0x00cc, + 0x5b4c: 0x00cc, 0x5b4d: 0x00cc, 0x5b4e: 0x00cc, 0x5b4f: 0x00cc, 0x5b50: 0x00cc, 0x5b51: 0x00cc, + 0x5b52: 0x00cc, 0x5b53: 0x00cc, 0x5b54: 0x00cc, 0x5b55: 0x00cc, 0x5b56: 0x00cc, 0x5b57: 0x00cc, + 0x5b58: 0x00cc, 0x5b59: 0x00cc, 0x5b5a: 0x00cc, 0x5b5b: 0x00cc, 0x5b5c: 0x00cc, 0x5b5d: 0x00cc, + 0x5b5e: 0x00cc, 0x5b5f: 0x00cc, 0x5b60: 0x00cc, 0x5b61: 0x00cc, + 0x5b70: 0x00cc, 0x5b71: 0x00cc, 0x5b72: 0x00cc, 0x5b73: 0x00cc, 0x5b74: 0x00cc, 0x5b75: 0x00cc, + 0x5b76: 0x00cc, 0x5b77: 0x00cc, 0x5b78: 0x00cc, 0x5b79: 0x00cc, 0x5b7a: 0x00cc, 0x5b7b: 0x00cc, + 0x5b7c: 0x00cc, 0x5b7d: 0x00cc, 0x5b7e: 0x00cc, 0x5b7f: 0x00cc, + // Block 0x16e, offset 0x5b80 + 0x5b80: 0x00cc, 0x5b81: 0x00cc, 0x5b82: 0x00cc, 0x5b83: 0x00cc, 0x5b84: 0x00cc, 0x5b85: 0x00cc, + 0x5b86: 0x00cc, 0x5b87: 0x00cc, 0x5b88: 0x00cc, 0x5b89: 0x00cc, 0x5b8a: 0x00cc, 0x5b8b: 0x00cc, + 0x5b8c: 0x00cc, 0x5b8d: 0x00cc, 0x5b8e: 0x00cc, 0x5b8f: 0x00cc, 0x5b90: 0x00cc, 0x5b91: 0x00cc, + 0x5b92: 0x00cc, 0x5b93: 0x00cc, 0x5b94: 0x00cc, 0x5b95: 0x00cc, 0x5b96: 0x00cc, 0x5b97: 0x00cc, + 0x5b98: 0x00cc, 0x5b99: 0x00cc, 0x5b9a: 0x00cc, 0x5b9b: 0x00cc, 0x5b9c: 0x00cc, 0x5b9d: 0x00cc, + 0x5b9e: 0x00cc, 0x5b9f: 0x00cc, 0x5ba0: 0x00cc, + // Block 0x16f, offset 0x5bc0 + 0x5bc0: 0x008c, 0x5bc1: 0x008c, 0x5bc2: 0x008c, 0x5bc3: 0x008c, 0x5bc4: 0x008c, 0x5bc5: 0x008c, + 0x5bc6: 0x008c, 0x5bc7: 0x008c, 0x5bc8: 0x008c, 0x5bc9: 0x008c, 0x5bca: 0x008c, 0x5bcb: 0x008c, + 0x5bcc: 0x008c, 0x5bcd: 0x008c, 0x5bce: 0x008c, 0x5bcf: 0x008c, 0x5bd0: 0x008c, 0x5bd1: 0x008c, + 0x5bd2: 0x008c, 0x5bd3: 0x008c, 0x5bd4: 0x008c, 0x5bd5: 0x008c, 0x5bd6: 0x008c, 0x5bd7: 0x008c, + 0x5bd8: 0x008c, 0x5bd9: 0x008c, 0x5bda: 0x008c, 0x5bdb: 0x008c, 0x5bdc: 0x008c, 0x5bdd: 0x008c, + // Block 0x170, offset 0x5c00 + 0x5c00: 0x00cc, 0x5c01: 0x00cc, 0x5c02: 0x00cc, 0x5c03: 0x00cc, 0x5c04: 0x00cc, 0x5c05: 0x00cc, + 0x5c06: 0x00cc, 0x5c07: 0x00cc, 0x5c08: 0x00cc, 0x5c09: 0x00cc, 0x5c0a: 0x00cc, + 0x5c10: 0x00cc, 0x5c11: 0x00cc, + 0x5c12: 0x00cc, 0x5c13: 0x00cc, 0x5c14: 0x00cc, 0x5c15: 0x00cc, 0x5c16: 0x00cc, 0x5c17: 0x00cc, + 0x5c18: 0x00cc, 0x5c19: 0x00cc, 0x5c1a: 0x00cc, 0x5c1b: 0x00cc, 0x5c1c: 0x00cc, 0x5c1d: 0x00cc, + 0x5c1e: 0x00cc, 0x5c1f: 0x00cc, 0x5c20: 0x00cc, 0x5c21: 0x00cc, 0x5c22: 0x00cc, 0x5c23: 0x00cc, + 0x5c24: 0x00cc, 0x5c25: 0x00cc, 0x5c26: 0x00cc, 0x5c27: 0x00cc, 0x5c28: 0x00cc, 0x5c29: 0x00cc, + 0x5c2a: 0x00cc, 0x5c2b: 0x00cc, 0x5c2c: 0x00cc, 0x5c2d: 0x00cc, 0x5c2e: 0x00cc, 0x5c2f: 0x00cc, + 0x5c30: 0x00cc, 0x5c31: 0x00cc, 0x5c32: 0x00cc, 0x5c33: 0x00cc, 0x5c34: 0x00cc, 0x5c35: 0x00cc, + 0x5c36: 0x00cc, 0x5c37: 0x00cc, 0x5c38: 0x00cc, 0x5c39: 0x00cc, 0x5c3a: 0x00cc, 0x5c3b: 0x00cc, + 0x5c3c: 0x00cc, 0x5c3d: 0x00cc, 0x5c3e: 0x00cc, 0x5c3f: 0x00cc, + // Block 0x171, offset 0x5c40 + 0x5c40: 0x00cc, 0x5c41: 0x00cc, 0x5c42: 0x00cc, 0x5c43: 0x00cc, 0x5c44: 0x00cc, 0x5c45: 0x00cc, + 0x5c46: 0x00cc, 0x5c47: 0x00cc, 0x5c48: 0x00cc, 0x5c49: 0x00cc, 0x5c4a: 0x00cc, 0x5c4b: 0x00cc, + 0x5c4c: 0x00cc, 0x5c4d: 0x00cc, 0x5c4e: 0x00cc, 0x5c4f: 0x00cc, 0x5c50: 0x00cc, 0x5c51: 0x00cc, + 0x5c52: 0x00cc, 0x5c53: 0x00cc, 0x5c54: 0x00cc, 0x5c55: 0x00cc, 0x5c56: 0x00cc, 0x5c57: 0x00cc, + 0x5c58: 0x00cc, 0x5c59: 0x00cc, 0x5c5a: 0x00cc, 0x5c5b: 0x00cc, 0x5c5c: 0x00cc, 0x5c5d: 0x00cc, + 0x5c5e: 0x00cc, 0x5c5f: 0x00cc, 0x5c60: 0x00cc, 0x5c61: 0x00cc, 0x5c62: 0x00cc, 0x5c63: 0x00cc, + 0x5c64: 0x00cc, 0x5c65: 0x00cc, 0x5c66: 0x00cc, 0x5c67: 0x00cc, 0x5c68: 0x00cc, 0x5c69: 0x00cc, + 0x5c6a: 0x00cc, 0x5c6b: 0x00cc, 0x5c6c: 0x00cc, 0x5c6d: 0x00cc, 0x5c6e: 0x00cc, 0x5c6f: 0x00cc, + // Block 0x172, offset 0x5c80 + 0x5c81: 0x0040, + 0x5ca0: 0x0040, 0x5ca1: 0x0040, 0x5ca2: 0x0040, 0x5ca3: 0x0040, + 0x5ca4: 0x0040, 0x5ca5: 0x0040, 0x5ca6: 0x0040, 0x5ca7: 0x0040, 0x5ca8: 0x0040, 0x5ca9: 0x0040, + 0x5caa: 0x0040, 0x5cab: 0x0040, 0x5cac: 0x0040, 0x5cad: 0x0040, 0x5cae: 0x0040, 0x5caf: 0x0040, + 0x5cb0: 0x0040, 0x5cb1: 0x0040, 0x5cb2: 0x0040, 0x5cb3: 0x0040, 0x5cb4: 0x0040, 0x5cb5: 0x0040, + 0x5cb6: 0x0040, 0x5cb7: 0x0040, 0x5cb8: 0x0040, 0x5cb9: 0x0040, 0x5cba: 0x0040, 0x5cbb: 0x0040, + 0x5cbc: 0x0040, 0x5cbd: 0x0040, 0x5cbe: 0x0040, 0x5cbf: 0x0040, + // Block 0x173, offset 0x5cc0 + 0x5cc0: 0x0040, 0x5cc1: 0x0040, 0x5cc2: 0x0040, 0x5cc3: 0x0040, 0x5cc4: 0x0040, 0x5cc5: 0x0040, + 0x5cc6: 0x0040, 0x5cc7: 0x0040, 0x5cc8: 0x0040, 0x5cc9: 0x0040, 0x5cca: 0x0040, 0x5ccb: 0x0040, + 0x5ccc: 0x0040, 0x5ccd: 0x0040, 0x5cce: 0x0040, 0x5ccf: 0x0040, 0x5cd0: 0x0040, 0x5cd1: 0x0040, + 0x5cd2: 0x0040, 0x5cd3: 0x0040, 0x5cd4: 0x0040, 0x5cd5: 0x0040, 0x5cd6: 0x0040, 0x5cd7: 0x0040, + 0x5cd8: 0x0040, 0x5cd9: 0x0040, 0x5cda: 0x0040, 0x5cdb: 0x0040, 0x5cdc: 0x0040, 0x5cdd: 0x0040, + 0x5cde: 0x0040, 0x5cdf: 0x0040, 0x5ce0: 0x0040, 0x5ce1: 0x0040, 0x5ce2: 0x0040, 0x5ce3: 0x0040, + 0x5ce4: 0x0040, 0x5ce5: 0x0040, 0x5ce6: 0x0040, 0x5ce7: 0x0040, 0x5ce8: 0x0040, 0x5ce9: 0x0040, + 0x5cea: 0x0040, 0x5ceb: 0x0040, 0x5cec: 0x0040, 0x5ced: 0x0040, 0x5cee: 0x0040, 0x5cef: 0x0040, + // Block 0x174, offset 0x5d00 + 0x5d00: 0x0040, 0x5d01: 0x0040, 0x5d02: 0x0040, 0x5d03: 0x0040, 0x5d04: 0x0040, 0x5d05: 0x0040, + 0x5d06: 0x0040, 0x5d07: 0x0040, 0x5d08: 0x0040, 0x5d09: 0x0040, 0x5d0a: 0x0040, 0x5d0b: 0x0040, + 0x5d0c: 0x0040, 0x5d0d: 0x0040, 0x5d0e: 0x0040, 0x5d0f: 0x0040, 0x5d10: 0x0040, 0x5d11: 0x0040, + 0x5d12: 0x0040, 0x5d13: 0x0040, 0x5d14: 0x0040, 0x5d15: 0x0040, 0x5d16: 0x0040, 0x5d17: 0x0040, + 0x5d18: 0x0040, 0x5d19: 0x0040, 0x5d1a: 0x0040, 0x5d1b: 0x0040, 0x5d1c: 0x0040, 0x5d1d: 0x0040, + 0x5d1e: 0x0040, 0x5d1f: 0x0040, 0x5d20: 0x0040, 0x5d21: 0x0040, 0x5d22: 0x0040, 0x5d23: 0x0040, + 0x5d24: 0x0040, 0x5d25: 0x0040, 0x5d26: 0x0040, 0x5d27: 0x0040, 0x5d28: 0x0040, 0x5d29: 0x0040, + 0x5d2a: 0x0040, 0x5d2b: 0x0040, 0x5d2c: 0x0040, 0x5d2d: 0x0040, 0x5d2e: 0x0040, 0x5d2f: 0x0040, + 0x5d30: 0x0040, 0x5d31: 0x0040, 0x5d32: 0x0040, 0x5d33: 0x0040, 0x5d34: 0x0040, 0x5d35: 0x0040, + 0x5d36: 0x0040, 0x5d37: 0x0040, 0x5d38: 0x0040, 0x5d39: 0x0040, 0x5d3a: 0x0040, 0x5d3b: 0x0040, + 0x5d3c: 0x0040, 0x5d3d: 0x0040, +} + +// derivedPropertiesIndex: 40 blocks, 2560 entries, 5120 bytes +// Block 0 is the zero block. +var derivedPropertiesIndex = [2560]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc6: 0x05, 0xc7: 0x06, + 0xc8: 0x05, 0xc9: 0x05, 0xca: 0x07, 0xcb: 0x08, 0xcc: 0x09, 0xcd: 0x0a, 0xce: 0x0b, 0xcf: 0x0c, + 0xd0: 0x05, 0xd1: 0x05, 0xd2: 0x0d, 0xd3: 0x05, 0xd4: 0x0e, 0xd5: 0x0f, 0xd6: 0x10, 0xd7: 0x11, + 0xd8: 0x12, 0xd9: 0x13, 0xda: 0x14, 0xdb: 0x15, 0xdc: 0x16, 0xdd: 0x17, 0xde: 0x18, 0xdf: 0x19, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x07, 0xea: 0x08, 0xeb: 0x09, 0xec: 0x09, 0xed: 0x0a, 0xee: 0x0b, 0xef: 0x0c, + 0xf0: 0x21, 0xf3: 0x24, 0xf4: 0x25, + // Block 0x4, offset 0x100 + 0x120: 0x1a, 0x121: 0x1b, 0x122: 0x1c, 0x123: 0x1d, 0x124: 0x1e, 0x125: 0x1f, 0x126: 0x20, 0x127: 0x21, + 0x128: 0x22, 0x129: 0x23, 0x12a: 0x24, 0x12b: 0x25, 0x12c: 0x26, 0x12d: 0x27, 0x12e: 0x28, 0x12f: 0x29, + 0x130: 0x2a, 0x131: 0x2b, 0x132: 0x2c, 0x133: 0x2d, 0x134: 0x2e, 0x135: 0x2f, 0x136: 0x30, 0x137: 0x31, + 0x138: 0x32, 0x139: 0x33, 0x13a: 0x34, 0x13b: 0x35, 0x13c: 0x36, 0x13d: 0x37, 0x13e: 0x38, 0x13f: 0x39, + // Block 0x5, offset 0x140 + 0x140: 0x3a, 0x141: 0x3b, 0x142: 0x3c, 0x143: 0x3d, 0x144: 0x3e, 0x145: 0x3e, 0x146: 0x3e, 0x147: 0x3e, + 0x148: 0x05, 0x149: 0x3f, 0x14a: 0x40, 0x14b: 0x41, 0x14c: 0x42, 0x14d: 0x43, 0x14e: 0x44, 0x14f: 0x45, + 0x150: 0x46, 0x151: 0x05, 0x152: 0x05, 0x153: 0x05, 0x154: 0x05, 0x155: 0x05, 0x156: 0x05, 0x157: 0x05, + 0x158: 0x05, 0x159: 0x47, 0x15a: 0x48, 0x15b: 0x49, 0x15c: 0x4a, 0x15d: 0x4b, 0x15e: 0x4c, 0x15f: 0x4d, + 0x160: 0x4e, 0x161: 0x4f, 0x162: 0x50, 0x163: 0x51, 0x164: 0x52, 0x165: 0x53, 0x166: 0x54, 0x167: 0x55, + 0x168: 0x56, 0x169: 0x57, 0x16a: 0x58, 0x16b: 0x59, 0x16c: 0x5a, 0x16d: 0x5b, 0x16e: 0x5c, 0x16f: 0x5d, + 0x170: 0x5e, 0x171: 0x5f, 0x172: 0x60, 0x173: 0x61, 0x174: 0x62, 0x175: 0x63, 0x176: 0x64, 0x177: 0x09, + 0x178: 0x05, 0x179: 0x05, 0x17a: 0x65, 0x17b: 0x05, 0x17c: 0x66, 0x17d: 0x67, 0x17e: 0x68, 0x17f: 0x69, + // Block 0x6, offset 0x180 + 0x180: 0x6a, 0x181: 0x6b, 0x182: 0x6c, 0x183: 0x6d, 0x184: 0x6e, 0x185: 0x6f, 0x186: 0x70, 0x187: 0x71, + 0x188: 0x71, 0x189: 0x71, 0x18a: 0x71, 0x18b: 0x71, 0x18c: 0x71, 0x18d: 0x71, 0x18e: 0x71, 0x18f: 0x71, + 0x190: 0x72, 0x191: 0x73, 0x192: 0x71, 0x193: 0x71, 0x194: 0x71, 0x195: 0x71, 0x196: 0x71, 0x197: 0x71, + 0x198: 0x71, 0x199: 0x71, 0x19a: 0x71, 0x19b: 0x71, 0x19c: 0x71, 0x19d: 0x71, 0x19e: 0x71, 0x19f: 0x71, + 0x1a0: 0x71, 0x1a1: 0x71, 0x1a2: 0x71, 0x1a3: 0x71, 0x1a4: 0x71, 0x1a5: 0x71, 0x1a6: 0x71, 0x1a7: 0x71, + 0x1a8: 0x71, 0x1a9: 0x71, 0x1aa: 0x71, 0x1ab: 0x71, 0x1ac: 0x71, 0x1ad: 0x74, 0x1ae: 0x75, 0x1af: 0x71, + 0x1b0: 0x05, 0x1b1: 0x76, 0x1b2: 0x05, 0x1b3: 0x77, 0x1b4: 0x78, 0x1b5: 0x79, 0x1b6: 0x7a, 0x1b7: 0x7b, + 0x1b8: 0x7c, 0x1b9: 0x7d, 0x1ba: 0x7e, 0x1bb: 0x7f, 0x1bc: 0x80, 0x1bd: 0x80, 0x1be: 0x80, 0x1bf: 0x81, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x82, 0x1c1: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x87, 0x1c6: 0x88, 0x1c7: 0x89, + 0x1c8: 0x8a, 0x1c9: 0x71, 0x1ca: 0x71, 0x1cb: 0x8b, 0x1cc: 0x80, 0x1cd: 0x8c, 0x1ce: 0x71, 0x1cf: 0x71, + 0x1d0: 0x8d, 0x1d1: 0x8d, 0x1d2: 0x8d, 0x1d3: 0x8d, 0x1d4: 0x8d, 0x1d5: 0x8d, 0x1d6: 0x8d, 0x1d7: 0x8d, + 0x1d8: 0x8d, 0x1d9: 0x8d, 0x1da: 0x8d, 0x1db: 0x8d, 0x1dc: 0x8d, 0x1dd: 0x8d, 0x1de: 0x8d, 0x1df: 0x8d, + 0x1e0: 0x8d, 0x1e1: 0x8d, 0x1e2: 0x8d, 0x1e3: 0x8d, 0x1e4: 0x8d, 0x1e5: 0x8d, 0x1e6: 0x8d, 0x1e7: 0x8d, + 0x1e8: 0x8d, 0x1e9: 0x8d, 0x1ea: 0x8d, 0x1eb: 0x8d, 0x1ec: 0x8d, 0x1ed: 0x8d, 0x1ee: 0x8d, 0x1ef: 0x8d, + 0x1f0: 0x8d, 0x1f1: 0x8d, 0x1f2: 0x8d, 0x1f3: 0x8d, 0x1f4: 0x8d, 0x1f5: 0x8d, 0x1f6: 0x8d, 0x1f7: 0x8d, + 0x1f8: 0x8d, 0x1f9: 0x8d, 0x1fa: 0x8d, 0x1fb: 0x8d, 0x1fc: 0x8d, 0x1fd: 0x8d, 0x1fe: 0x8d, 0x1ff: 0x8d, + // Block 0x8, offset 0x200 + 0x200: 0x8d, 0x201: 0x8d, 0x202: 0x8d, 0x203: 0x8d, 0x204: 0x8d, 0x205: 0x8d, 0x206: 0x8d, 0x207: 0x8d, + 0x208: 0x8d, 0x209: 0x8d, 0x20a: 0x8d, 0x20b: 0x8d, 0x20c: 0x8d, 0x20d: 0x8d, 0x20e: 0x8d, 0x20f: 0x8d, + 0x210: 0x8d, 0x211: 0x8d, 0x212: 0x8d, 0x213: 0x8d, 0x214: 0x8d, 0x215: 0x8d, 0x216: 0x8d, 0x217: 0x8d, + 0x218: 0x8d, 0x219: 0x8d, 0x21a: 0x8d, 0x21b: 0x8d, 0x21c: 0x8d, 0x21d: 0x8d, 0x21e: 0x8d, 0x21f: 0x8d, + 0x220: 0x8d, 0x221: 0x8d, 0x222: 0x8d, 0x223: 0x8d, 0x224: 0x8d, 0x225: 0x8d, 0x226: 0x8d, 0x227: 0x8d, + 0x228: 0x8d, 0x229: 0x8d, 0x22a: 0x8d, 0x22b: 0x8d, 0x22c: 0x8d, 0x22d: 0x8d, 0x22e: 0x8d, 0x22f: 0x8d, + 0x230: 0x8d, 0x231: 0x8d, 0x232: 0x8d, 0x233: 0x8d, 0x234: 0x8d, 0x235: 0x8d, 0x236: 0x8d, 0x237: 0x71, + 0x238: 0x8d, 0x239: 0x8d, 0x23a: 0x8d, 0x23b: 0x8d, 0x23c: 0x8d, 0x23d: 0x8d, 0x23e: 0x8d, 0x23f: 0x8d, + // Block 0x9, offset 0x240 + 0x240: 0x8d, 0x241: 0x8d, 0x242: 0x8d, 0x243: 0x8d, 0x244: 0x8d, 0x245: 0x8d, 0x246: 0x8d, 0x247: 0x8d, + 0x248: 0x8d, 0x249: 0x8d, 0x24a: 0x8d, 0x24b: 0x8d, 0x24c: 0x8d, 0x24d: 0x8d, 0x24e: 0x8d, 0x24f: 0x8d, + 0x250: 0x8d, 0x251: 0x8d, 0x252: 0x8d, 0x253: 0x8d, 0x254: 0x8d, 0x255: 0x8d, 0x256: 0x8d, 0x257: 0x8d, + 0x258: 0x8d, 0x259: 0x8d, 0x25a: 0x8d, 0x25b: 0x8d, 0x25c: 0x8d, 0x25d: 0x8d, 0x25e: 0x8d, 0x25f: 0x8d, + 0x260: 0x8d, 0x261: 0x8d, 0x262: 0x8d, 0x263: 0x8d, 0x264: 0x8d, 0x265: 0x8d, 0x266: 0x8d, 0x267: 0x8d, + 0x268: 0x8d, 0x269: 0x8d, 0x26a: 0x8d, 0x26b: 0x8d, 0x26c: 0x8d, 0x26d: 0x8d, 0x26e: 0x8d, 0x26f: 0x8d, + 0x270: 0x8d, 0x271: 0x8d, 0x272: 0x8d, 0x273: 0x8d, 0x274: 0x8d, 0x275: 0x8d, 0x276: 0x8d, 0x277: 0x8d, + 0x278: 0x8d, 0x279: 0x8d, 0x27a: 0x8d, 0x27b: 0x8d, 0x27c: 0x8d, 0x27d: 0x8d, 0x27e: 0x8d, 0x27f: 0x8d, + // Block 0xa, offset 0x280 + 0x280: 0x05, 0x281: 0x05, 0x282: 0x05, 0x283: 0x05, 0x284: 0x05, 0x285: 0x05, 0x286: 0x05, 0x287: 0x05, + 0x288: 0x05, 0x289: 0x05, 0x28a: 0x05, 0x28b: 0x05, 0x28c: 0x05, 0x28d: 0x05, 0x28e: 0x05, 0x28f: 0x05, + 0x290: 0x05, 0x291: 0x05, 0x292: 0x8e, 0x293: 0x8f, 0x294: 0x05, 0x295: 0x05, 0x296: 0x05, 0x297: 0x05, + 0x298: 0x90, 0x299: 0x91, 0x29a: 0x92, 0x29b: 0x93, 0x29c: 0x94, 0x29d: 0x95, 0x29e: 0x96, 0x29f: 0x97, + 0x2a0: 0x98, 0x2a1: 0x99, 0x2a2: 0x05, 0x2a3: 0x9a, 0x2a4: 0x9b, 0x2a5: 0x9c, 0x2a6: 0x9d, 0x2a7: 0x9e, + 0x2a8: 0x9f, 0x2a9: 0xa0, 0x2aa: 0xa1, 0x2ab: 0xa2, 0x2ac: 0xa3, 0x2ad: 0xa4, 0x2ae: 0x05, 0x2af: 0xa5, + 0x2b0: 0x05, 0x2b1: 0x05, 0x2b2: 0x05, 0x2b3: 0x05, 0x2b4: 0x05, 0x2b5: 0x05, 0x2b6: 0x05, 0x2b7: 0x05, + 0x2b8: 0x05, 0x2b9: 0x05, 0x2ba: 0x05, 0x2bb: 0x05, 0x2bc: 0x05, 0x2bd: 0x05, 0x2be: 0x05, 0x2bf: 0x05, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x05, 0x2c1: 0x05, 0x2c2: 0x05, 0x2c3: 0x05, 0x2c4: 0x05, 0x2c5: 0x05, 0x2c6: 0x05, 0x2c7: 0x05, + 0x2c8: 0x05, 0x2c9: 0x05, 0x2ca: 0x05, 0x2cb: 0x05, 0x2cc: 0x05, 0x2cd: 0x05, 0x2ce: 0x05, 0x2cf: 0x05, + 0x2d0: 0x05, 0x2d1: 0x05, 0x2d2: 0x05, 0x2d3: 0x05, 0x2d4: 0x05, 0x2d5: 0x05, 0x2d6: 0x05, 0x2d7: 0x05, + 0x2d8: 0x05, 0x2d9: 0x05, 0x2da: 0x05, 0x2db: 0x05, 0x2dc: 0x05, 0x2dd: 0x05, 0x2de: 0x05, 0x2df: 0x05, + 0x2e0: 0x05, 0x2e1: 0x05, 0x2e2: 0x05, 0x2e3: 0x05, 0x2e4: 0x05, 0x2e5: 0x05, 0x2e6: 0x05, 0x2e7: 0x05, + 0x2e8: 0x05, 0x2e9: 0x05, 0x2ea: 0x05, 0x2eb: 0x05, 0x2ec: 0x05, 0x2ed: 0x05, 0x2ee: 0x05, 0x2ef: 0x05, + 0x2f0: 0x05, 0x2f1: 0x05, 0x2f2: 0x05, 0x2f3: 0x05, 0x2f4: 0x05, 0x2f5: 0x05, 0x2f6: 0x05, 0x2f7: 0x05, + 0x2f8: 0x05, 0x2f9: 0x05, 0x2fa: 0x05, 0x2fb: 0x05, 0x2fc: 0x05, 0x2fd: 0x05, 0x2fe: 0x05, 0x2ff: 0x05, + // Block 0xc, offset 0x300 + 0x300: 0x05, 0x301: 0x05, 0x302: 0x05, 0x303: 0x05, 0x304: 0x05, 0x305: 0x05, 0x306: 0x05, 0x307: 0x05, + 0x308: 0x05, 0x309: 0x05, 0x30a: 0x05, 0x30b: 0x05, 0x30c: 0x05, 0x30d: 0x05, 0x30e: 0x05, 0x30f: 0x05, + 0x310: 0x05, 0x311: 0x05, 0x312: 0x05, 0x313: 0x05, 0x314: 0x05, 0x315: 0x05, 0x316: 0x05, 0x317: 0x05, + 0x318: 0x05, 0x319: 0x05, 0x31a: 0x05, 0x31b: 0x05, 0x31c: 0x05, 0x31d: 0x05, 0x31e: 0xa6, 0x31f: 0xa7, + // Block 0xd, offset 0x340 + 0x340: 0x3e, 0x341: 0x3e, 0x342: 0x3e, 0x343: 0x3e, 0x344: 0x3e, 0x345: 0x3e, 0x346: 0x3e, 0x347: 0x3e, + 0x348: 0x3e, 0x349: 0x3e, 0x34a: 0x3e, 0x34b: 0x3e, 0x34c: 0x3e, 0x34d: 0x3e, 0x34e: 0x3e, 0x34f: 0x3e, + 0x350: 0x3e, 0x351: 0x3e, 0x352: 0x3e, 0x353: 0x3e, 0x354: 0x3e, 0x355: 0x3e, 0x356: 0x3e, 0x357: 0x3e, + 0x358: 0x3e, 0x359: 0x3e, 0x35a: 0x3e, 0x35b: 0x3e, 0x35c: 0x3e, 0x35d: 0x3e, 0x35e: 0x3e, 0x35f: 0x3e, + 0x360: 0x3e, 0x361: 0x3e, 0x362: 0x3e, 0x363: 0x3e, 0x364: 0x3e, 0x365: 0x3e, 0x366: 0x3e, 0x367: 0x3e, + 0x368: 0x3e, 0x369: 0x3e, 0x36a: 0x3e, 0x36b: 0x3e, 0x36c: 0x3e, 0x36d: 0x3e, 0x36e: 0x3e, 0x36f: 0x3e, + 0x370: 0x3e, 0x371: 0x3e, 0x372: 0x3e, 0x373: 0x3e, 0x374: 0x3e, 0x375: 0x3e, 0x376: 0x3e, 0x377: 0x3e, + 0x378: 0x3e, 0x379: 0x3e, 0x37a: 0x3e, 0x37b: 0x3e, 0x37c: 0x3e, 0x37d: 0x3e, 0x37e: 0x3e, 0x37f: 0x3e, + // Block 0xe, offset 0x380 + 0x380: 0x3e, 0x381: 0x3e, 0x382: 0x3e, 0x383: 0x3e, 0x384: 0x3e, 0x385: 0x3e, 0x386: 0x3e, 0x387: 0x3e, + 0x388: 0x3e, 0x389: 0x3e, 0x38a: 0x3e, 0x38b: 0x3e, 0x38c: 0x3e, 0x38d: 0x3e, 0x38e: 0x3e, 0x38f: 0x3e, + 0x390: 0x3e, 0x391: 0x3e, 0x392: 0x3e, 0x393: 0x3e, 0x394: 0x3e, 0x395: 0x3e, 0x396: 0x3e, 0x397: 0x3e, + 0x398: 0x3e, 0x399: 0x3e, 0x39a: 0x3e, 0x39b: 0x3e, 0x39c: 0x3e, 0x39d: 0x3e, 0x39e: 0x3e, 0x39f: 0x3e, + 0x3a0: 0x3e, 0x3a1: 0x3e, 0x3a2: 0x3e, 0x3a3: 0x3e, 0x3a4: 0x80, 0x3a5: 0x80, 0x3a6: 0x80, 0x3a7: 0x80, + 0x3a8: 0xa8, 0x3a9: 0xa9, 0x3aa: 0x80, 0x3ab: 0xaa, 0x3ac: 0xab, 0x3ad: 0xac, 0x3ae: 0x71, 0x3af: 0xad, + 0x3b0: 0x71, 0x3b1: 0x71, 0x3b2: 0x71, 0x3b3: 0x71, 0x3b4: 0x71, 0x3b5: 0x71, 0x3b6: 0xae, 0x3b7: 0xaf, + 0x3b8: 0xb0, 0x3b9: 0xb1, 0x3ba: 0x71, 0x3bb: 0xb2, 0x3bc: 0xb3, 0x3bd: 0xb4, 0x3be: 0xb5, 0x3bf: 0xb6, + // Block 0xf, offset 0x3c0 + 0x3c0: 0xb7, 0x3c1: 0xb8, 0x3c2: 0x05, 0x3c3: 0xb9, 0x3c4: 0xba, 0x3c5: 0xbb, 0x3c6: 0xbc, 0x3c7: 0xbd, + 0x3ca: 0xbe, 0x3cb: 0xbf, 0x3cc: 0xc0, 0x3cd: 0xc1, 0x3ce: 0xc2, 0x3cf: 0xc3, + 0x3d0: 0x05, 0x3d1: 0x05, 0x3d2: 0xc4, 0x3d3: 0xc5, 0x3d4: 0xc6, 0x3d5: 0xc7, 0x3d6: 0xc8, + 0x3d8: 0x05, 0x3d9: 0x05, 0x3da: 0x05, 0x3db: 0x05, 0x3dc: 0xc9, 0x3dd: 0xca, 0x3de: 0xcb, + 0x3e0: 0xcc, 0x3e1: 0xcd, 0x3e2: 0xce, 0x3e3: 0xcf, 0x3e4: 0xd0, 0x3e6: 0xd1, 0x3e7: 0xae, + 0x3e8: 0xd2, 0x3e9: 0xd3, 0x3ea: 0xd4, 0x3eb: 0xd5, 0x3ec: 0xd6, 0x3ed: 0xd7, 0x3ee: 0xd8, + 0x3f0: 0x05, 0x3f1: 0xd9, 0x3f2: 0xda, 0x3f3: 0xdb, 0x3f4: 0xdc, + 0x3f9: 0xdd, 0x3fa: 0xde, 0x3fb: 0xdf, 0x3fc: 0xe0, 0x3fd: 0xe1, 0x3fe: 0xe2, 0x3ff: 0xe3, + // Block 0x10, offset 0x400 + 0x400: 0xe4, 0x401: 0xe5, 0x402: 0xe6, 0x403: 0xe7, 0x404: 0xe8, 0x405: 0xe9, 0x406: 0xea, 0x407: 0xeb, + 0x408: 0xec, 0x409: 0xed, 0x40a: 0xee, 0x40b: 0xef, 0x40c: 0xf0, 0x40d: 0xf1, + 0x410: 0xf2, 0x411: 0xf3, 0x412: 0xf4, 0x413: 0xf5, 0x416: 0xf6, 0x417: 0xf7, + 0x418: 0xf8, 0x419: 0xf9, 0x41a: 0xfa, 0x41b: 0xfb, 0x41c: 0xfc, 0x41d: 0xfd, + 0x420: 0xfe, 0x422: 0xff, 0x423: 0x100, 0x424: 0x101, 0x425: 0x102, 0x426: 0x103, 0x427: 0x104, + 0x428: 0x105, 0x429: 0x106, 0x42a: 0x107, 0x42b: 0x108, 0x42c: 0x109, + 0x430: 0x10a, 0x431: 0x10b, 0x432: 0x10c, 0x434: 0x10d, 0x435: 0x10e, 0x436: 0x10f, + 0x43b: 0x110, 0x43c: 0x111, 0x43d: 0x112, 0x43e: 0x113, 0x43f: 0x114, + // Block 0x11, offset 0x440 + 0x440: 0x05, 0x441: 0x05, 0x442: 0x05, 0x443: 0x05, 0x444: 0x05, 0x445: 0x05, 0x446: 0x05, 0x447: 0x05, + 0x448: 0x05, 0x449: 0x05, 0x44a: 0x05, 0x44b: 0x05, 0x44c: 0x05, 0x44d: 0x05, 0x44e: 0x115, + 0x450: 0x71, 0x451: 0x116, 0x452: 0x05, 0x453: 0x05, 0x454: 0x05, 0x455: 0x117, + 0x47e: 0x118, 0x47f: 0x119, + // Block 0x12, offset 0x480 + 0x480: 0x05, 0x481: 0x05, 0x482: 0x05, 0x483: 0x05, 0x484: 0x05, 0x485: 0x05, 0x486: 0x05, 0x487: 0x05, + 0x488: 0x05, 0x489: 0x05, 0x48a: 0x05, 0x48b: 0x05, 0x48c: 0x05, 0x48d: 0x05, 0x48e: 0x05, 0x48f: 0x05, + 0x490: 0x11a, 0x491: 0x11b, + // Block 0x13, offset 0x4c0 + 0x4d0: 0x05, 0x4d1: 0x05, 0x4d2: 0x05, 0x4d3: 0x05, 0x4d4: 0x05, 0x4d5: 0x05, 0x4d6: 0x05, 0x4d7: 0x05, + 0x4d8: 0x05, 0x4d9: 0xfd, + // Block 0x14, offset 0x500 + 0x520: 0x05, 0x521: 0x05, 0x522: 0x05, 0x523: 0x05, 0x524: 0x05, 0x525: 0x05, 0x526: 0x05, 0x527: 0x05, + 0x528: 0x108, 0x529: 0x11c, 0x52a: 0x11d, 0x52b: 0x11e, 0x52c: 0x11f, 0x52d: 0x120, 0x52e: 0x121, + 0x539: 0x05, 0x53a: 0x122, 0x53c: 0x05, 0x53d: 0x123, 0x53e: 0x124, 0x53f: 0x125, + // Block 0x15, offset 0x540 + 0x540: 0x05, 0x541: 0x05, 0x542: 0x05, 0x543: 0x05, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0x05, + 0x548: 0x05, 0x549: 0x05, 0x54a: 0x05, 0x54b: 0x05, 0x54c: 0x05, 0x54d: 0x05, 0x54e: 0x05, 0x54f: 0x05, + 0x550: 0x05, 0x551: 0x05, 0x552: 0x05, 0x553: 0x05, 0x554: 0x05, 0x555: 0x05, 0x556: 0x05, 0x557: 0x05, + 0x558: 0x05, 0x559: 0x05, 0x55a: 0x05, 0x55b: 0x05, 0x55c: 0x05, 0x55d: 0x05, 0x55e: 0x05, 0x55f: 0x126, + 0x560: 0x05, 0x561: 0x05, 0x562: 0x05, 0x563: 0x05, 0x564: 0x05, 0x565: 0x05, 0x566: 0x05, 0x567: 0x05, + 0x568: 0x05, 0x569: 0x05, 0x56a: 0x05, 0x56b: 0x05, 0x56c: 0x05, 0x56d: 0x05, 0x56e: 0x05, 0x56f: 0x05, + 0x570: 0x05, 0x571: 0x05, 0x572: 0x05, 0x573: 0x127, 0x574: 0xd9, + // Block 0x16, offset 0x580 + 0x5bf: 0x128, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x8d, 0x5c1: 0x8d, 0x5c2: 0x8d, 0x5c3: 0x8d, 0x5c4: 0x129, 0x5c5: 0x12a, 0x5c6: 0x05, 0x5c7: 0x05, + 0x5c8: 0x05, 0x5c9: 0x05, 0x5ca: 0x05, 0x5cb: 0x12b, + 0x5f0: 0x05, 0x5f1: 0x12c, 0x5f2: 0x12d, + // Block 0x18, offset 0x600 + 0x63c: 0x12e, 0x63d: 0x12f, 0x63e: 0x71, 0x63f: 0x130, + // Block 0x19, offset 0x640 + 0x640: 0x71, 0x641: 0x71, 0x642: 0x71, 0x643: 0x131, 0x644: 0x132, 0x645: 0x133, 0x646: 0x134, 0x647: 0x135, + 0x648: 0xbb, 0x649: 0x136, 0x64b: 0x137, 0x64c: 0x71, 0x64d: 0x138, + 0x650: 0x71, 0x651: 0x139, 0x652: 0x13a, 0x653: 0x13b, 0x654: 0x13c, 0x655: 0x13d, 0x656: 0x71, 0x657: 0x71, + 0x658: 0x71, 0x659: 0x71, 0x65a: 0x13e, 0x65b: 0x71, 0x65c: 0x71, 0x65d: 0x71, 0x65e: 0x71, 0x65f: 0x13f, + 0x660: 0x71, 0x661: 0x71, 0x662: 0x71, 0x663: 0x71, 0x664: 0x71, 0x665: 0x71, 0x666: 0x71, 0x667: 0x71, + 0x668: 0x140, 0x669: 0x141, 0x66a: 0x142, + 0x67c: 0x143, + // Block 0x1a, offset 0x680 + 0x680: 0x144, 0x681: 0x145, 0x682: 0x146, 0x684: 0x147, 0x685: 0x148, + 0x68a: 0x149, 0x68b: 0x14a, + 0x693: 0x14b, + 0x69f: 0x14c, + 0x6a0: 0x05, 0x6a1: 0x05, 0x6a2: 0x05, 0x6a3: 0x14d, 0x6a4: 0x14e, 0x6a5: 0x14f, + 0x6b1: 0x150, 0x6b2: 0x151, 0x6b4: 0x152, + 0x6b8: 0x153, 0x6b9: 0x154, 0x6ba: 0x155, 0x6bb: 0x156, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x157, 0x6c1: 0x71, 0x6c2: 0x158, 0x6c3: 0x159, 0x6c4: 0x71, 0x6c5: 0x71, 0x6c6: 0x145, 0x6c7: 0x15a, + 0x6c8: 0x15b, 0x6c9: 0x15c, 0x6cc: 0x71, 0x6cd: 0x71, 0x6ce: 0x71, 0x6cf: 0x71, + 0x6d0: 0x71, 0x6d1: 0x71, 0x6d2: 0x71, 0x6d3: 0x71, 0x6d4: 0x71, 0x6d5: 0x71, 0x6d6: 0x71, 0x6d7: 0x71, + 0x6d8: 0x71, 0x6d9: 0x71, 0x6da: 0x71, 0x6db: 0x15d, 0x6dc: 0x71, 0x6dd: 0x15e, 0x6de: 0x71, 0x6df: 0x15f, + 0x6e0: 0x160, 0x6e1: 0x161, 0x6e2: 0x162, 0x6e4: 0x71, 0x6e5: 0x71, 0x6e6: 0x71, 0x6e7: 0x71, + 0x6e8: 0x71, 0x6e9: 0x163, 0x6ea: 0x164, 0x6eb: 0x165, 0x6ec: 0x71, 0x6ed: 0x71, 0x6ee: 0x166, 0x6ef: 0x167, + // Block 0x1c, offset 0x700 + 0x700: 0x8d, 0x701: 0x8d, 0x702: 0x8d, 0x703: 0x8d, 0x704: 0x8d, 0x705: 0x8d, 0x706: 0x8d, 0x707: 0x8d, + 0x708: 0x8d, 0x709: 0x8d, 0x70a: 0x8d, 0x70b: 0x8d, 0x70c: 0x8d, 0x70d: 0x8d, 0x70e: 0x8d, 0x70f: 0x8d, + 0x710: 0x8d, 0x711: 0x8d, 0x712: 0x8d, 0x713: 0x8d, 0x714: 0x8d, 0x715: 0x8d, 0x716: 0x8d, 0x717: 0x8d, + 0x718: 0x8d, 0x719: 0x8d, 0x71a: 0x8d, 0x71b: 0x168, 0x71c: 0x8d, 0x71d: 0x8d, 0x71e: 0x8d, 0x71f: 0x8d, + 0x720: 0x8d, 0x721: 0x8d, 0x722: 0x8d, 0x723: 0x8d, 0x724: 0x8d, 0x725: 0x8d, 0x726: 0x8d, 0x727: 0x8d, + 0x728: 0x8d, 0x729: 0x8d, 0x72a: 0x8d, 0x72b: 0x8d, 0x72c: 0x8d, 0x72d: 0x8d, 0x72e: 0x8d, 0x72f: 0x8d, + 0x730: 0x8d, 0x731: 0x8d, 0x732: 0x8d, 0x733: 0x8d, 0x734: 0x8d, 0x735: 0x8d, 0x736: 0x8d, 0x737: 0x8d, + 0x738: 0x8d, 0x739: 0x8d, 0x73a: 0x8d, 0x73b: 0x8d, 0x73c: 0x8d, 0x73d: 0x8d, 0x73e: 0x8d, 0x73f: 0x8d, + // Block 0x1d, offset 0x740 + 0x740: 0x8d, 0x741: 0x8d, 0x742: 0x8d, 0x743: 0x8d, 0x744: 0x8d, 0x745: 0x8d, 0x746: 0x8d, 0x747: 0x8d, + 0x748: 0x8d, 0x749: 0x8d, 0x74a: 0x8d, 0x74b: 0x8d, 0x74c: 0x8d, 0x74d: 0x8d, 0x74e: 0x8d, 0x74f: 0x8d, + 0x750: 0x8d, 0x751: 0x8d, 0x752: 0x8d, 0x753: 0x8d, 0x754: 0x8d, 0x755: 0x8d, 0x756: 0x8d, 0x757: 0x8d, + 0x758: 0x8d, 0x759: 0x8d, 0x75a: 0x8d, 0x75b: 0x8d, 0x75c: 0x169, 0x75d: 0x8d, 0x75e: 0x8d, 0x75f: 0x8d, + 0x760: 0x16a, 0x761: 0x8d, 0x762: 0x8d, 0x763: 0x8d, 0x764: 0x8d, 0x765: 0x8d, 0x766: 0x8d, 0x767: 0x8d, + 0x768: 0x8d, 0x769: 0x8d, 0x76a: 0x8d, 0x76b: 0x8d, 0x76c: 0x8d, 0x76d: 0x8d, 0x76e: 0x8d, 0x76f: 0x8d, + 0x770: 0x8d, 0x771: 0x8d, 0x772: 0x8d, 0x773: 0x8d, 0x774: 0x8d, 0x775: 0x8d, 0x776: 0x8d, 0x777: 0x8d, + 0x778: 0x8d, 0x779: 0x8d, 0x77a: 0x8d, 0x77b: 0x8d, 0x77c: 0x8d, 0x77d: 0x8d, 0x77e: 0x8d, 0x77f: 0x8d, + // Block 0x1e, offset 0x780 + 0x780: 0x8d, 0x781: 0x8d, 0x782: 0x8d, 0x783: 0x8d, 0x784: 0x8d, 0x785: 0x8d, 0x786: 0x8d, 0x787: 0x8d, + 0x788: 0x8d, 0x789: 0x8d, 0x78a: 0x8d, 0x78b: 0x8d, 0x78c: 0x8d, 0x78d: 0x8d, 0x78e: 0x8d, 0x78f: 0x8d, + 0x790: 0x8d, 0x791: 0x8d, 0x792: 0x8d, 0x793: 0x8d, 0x794: 0x8d, 0x795: 0x8d, 0x796: 0x8d, 0x797: 0x8d, + 0x798: 0x8d, 0x799: 0x8d, 0x79a: 0x8d, 0x79b: 0x8d, 0x79c: 0x8d, 0x79d: 0x8d, 0x79e: 0x8d, 0x79f: 0x8d, + 0x7a0: 0x8d, 0x7a1: 0x8d, 0x7a2: 0x8d, 0x7a3: 0x8d, 0x7a4: 0x8d, 0x7a5: 0x8d, 0x7a6: 0x8d, 0x7a7: 0x8d, + 0x7a8: 0x8d, 0x7a9: 0x8d, 0x7aa: 0x8d, 0x7ab: 0x8d, 0x7ac: 0x8d, 0x7ad: 0x8d, 0x7ae: 0x8d, 0x7af: 0x8d, + 0x7b0: 0x8d, 0x7b1: 0x8d, 0x7b2: 0x8d, 0x7b3: 0x8d, 0x7b4: 0x8d, 0x7b5: 0x8d, 0x7b6: 0x8d, 0x7b7: 0x8d, + 0x7b8: 0x8d, 0x7b9: 0x8d, 0x7ba: 0x16b, 0x7bb: 0x8d, 0x7bc: 0x8d, 0x7bd: 0x8d, 0x7be: 0x8d, 0x7bf: 0x8d, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x8d, 0x7c1: 0x8d, 0x7c2: 0x8d, 0x7c3: 0x8d, 0x7c4: 0x8d, 0x7c5: 0x8d, 0x7c6: 0x8d, 0x7c7: 0x8d, + 0x7c8: 0x8d, 0x7c9: 0x8d, 0x7ca: 0x8d, 0x7cb: 0x8d, 0x7cc: 0x8d, 0x7cd: 0x8d, 0x7ce: 0x8d, 0x7cf: 0x8d, + 0x7d0: 0x8d, 0x7d1: 0x8d, 0x7d2: 0x8d, 0x7d3: 0x8d, 0x7d4: 0x8d, 0x7d5: 0x8d, 0x7d6: 0x8d, 0x7d7: 0x8d, + 0x7d8: 0x8d, 0x7d9: 0x8d, 0x7da: 0x8d, 0x7db: 0x8d, 0x7dc: 0x8d, 0x7dd: 0x8d, 0x7de: 0x8d, 0x7df: 0x8d, + 0x7e0: 0x8d, 0x7e1: 0x8d, 0x7e2: 0x8d, 0x7e3: 0x8d, 0x7e4: 0x8d, 0x7e5: 0x8d, 0x7e6: 0x8d, 0x7e7: 0x8d, + 0x7e8: 0x8d, 0x7e9: 0x8d, 0x7ea: 0x8d, 0x7eb: 0x8d, 0x7ec: 0x8d, 0x7ed: 0x8d, 0x7ee: 0x8d, 0x7ef: 0x16c, + // Block 0x20, offset 0x800 + 0x820: 0x80, 0x821: 0x80, 0x822: 0x80, 0x823: 0x80, 0x824: 0x80, 0x825: 0x80, 0x826: 0x80, 0x827: 0x80, + 0x828: 0x16d, + // Block 0x21, offset 0x840 + 0x840: 0x8d, 0x841: 0x8d, 0x842: 0x8d, 0x843: 0x8d, 0x844: 0x8d, 0x845: 0x8d, 0x846: 0x8d, 0x847: 0x8d, + 0x848: 0x8d, 0x849: 0x8d, 0x84a: 0x8d, 0x84b: 0x8d, 0x84c: 0x8d, 0x84d: 0x16e, 0x84e: 0x8d, 0x84f: 0x8d, + 0x850: 0x8d, 0x851: 0x8d, 0x852: 0x8d, 0x853: 0x8d, 0x854: 0x8d, 0x855: 0x8d, 0x856: 0x8d, 0x857: 0x8d, + 0x858: 0x8d, 0x859: 0x8d, 0x85a: 0x8d, 0x85b: 0x8d, 0x85c: 0x8d, 0x85d: 0x8d, 0x85e: 0x8d, 0x85f: 0x8d, + 0x860: 0x8d, 0x861: 0x8d, 0x862: 0x8d, 0x863: 0x8d, 0x864: 0x8d, 0x865: 0x8d, 0x866: 0x8d, 0x867: 0x8d, + 0x868: 0x8d, 0x869: 0x8d, 0x86a: 0x8d, 0x86b: 0x8d, 0x86c: 0x8d, 0x86d: 0x8d, 0x86e: 0x8d, 0x86f: 0x8d, + 0x870: 0x8d, 0x871: 0x8d, 0x872: 0x8d, 0x873: 0x8d, 0x874: 0x8d, 0x875: 0x8d, 0x876: 0x8d, 0x877: 0x8d, + 0x878: 0x8d, 0x879: 0x8d, 0x87a: 0x8d, 0x87b: 0x8d, 0x87c: 0x8d, 0x87d: 0x8d, 0x87e: 0x8d, 0x87f: 0x8d, + // Block 0x22, offset 0x880 + 0x880: 0x8d, 0x881: 0x8d, 0x882: 0x8d, 0x883: 0x8d, 0x884: 0x8d, 0x885: 0x8d, 0x886: 0x8d, 0x887: 0x8d, + 0x888: 0x8d, 0x889: 0x8d, 0x88a: 0x8d, 0x88b: 0x8d, 0x88c: 0x8d, 0x88d: 0x8d, 0x88e: 0x16f, + // Block 0x23, offset 0x8c0 + 0x8d0: 0x0d, 0x8d1: 0x0e, 0x8d2: 0x0f, 0x8d3: 0x10, 0x8d4: 0x11, 0x8d6: 0x12, 0x8d7: 0x09, + 0x8d8: 0x13, 0x8da: 0x14, 0x8db: 0x15, 0x8dc: 0x16, 0x8dd: 0x17, 0x8de: 0x18, 0x8df: 0x19, + 0x8e0: 0x07, 0x8e1: 0x07, 0x8e2: 0x07, 0x8e3: 0x07, 0x8e4: 0x07, 0x8e5: 0x07, 0x8e6: 0x07, 0x8e7: 0x07, + 0x8e8: 0x07, 0x8e9: 0x07, 0x8ea: 0x1a, 0x8eb: 0x1b, 0x8ec: 0x1c, 0x8ed: 0x07, 0x8ee: 0x1d, 0x8ef: 0x1e, + 0x8f0: 0x07, 0x8f1: 0x1f, 0x8f2: 0x20, + // Block 0x24, offset 0x900 + 0x900: 0x170, 0x901: 0x3e, 0x904: 0x3e, 0x905: 0x3e, 0x906: 0x3e, 0x907: 0x171, + // Block 0x25, offset 0x940 + 0x940: 0x3e, 0x941: 0x3e, 0x942: 0x3e, 0x943: 0x3e, 0x944: 0x3e, 0x945: 0x3e, 0x946: 0x3e, 0x947: 0x3e, + 0x948: 0x3e, 0x949: 0x3e, 0x94a: 0x3e, 0x94b: 0x3e, 0x94c: 0x3e, 0x94d: 0x3e, 0x94e: 0x3e, 0x94f: 0x3e, + 0x950: 0x3e, 0x951: 0x3e, 0x952: 0x3e, 0x953: 0x3e, 0x954: 0x3e, 0x955: 0x3e, 0x956: 0x3e, 0x957: 0x3e, + 0x958: 0x3e, 0x959: 0x3e, 0x95a: 0x3e, 0x95b: 0x3e, 0x95c: 0x3e, 0x95d: 0x3e, 0x95e: 0x3e, 0x95f: 0x3e, + 0x960: 0x3e, 0x961: 0x3e, 0x962: 0x3e, 0x963: 0x3e, 0x964: 0x3e, 0x965: 0x3e, 0x966: 0x3e, 0x967: 0x3e, + 0x968: 0x3e, 0x969: 0x3e, 0x96a: 0x3e, 0x96b: 0x3e, 0x96c: 0x3e, 0x96d: 0x3e, 0x96e: 0x3e, 0x96f: 0x3e, + 0x970: 0x3e, 0x971: 0x3e, 0x972: 0x3e, 0x973: 0x3e, 0x974: 0x3e, 0x975: 0x3e, 0x976: 0x3e, 0x977: 0x3e, + 0x978: 0x3e, 0x979: 0x3e, 0x97a: 0x3e, 0x97b: 0x3e, 0x97c: 0x3e, 0x97d: 0x3e, 0x97e: 0x3e, 0x97f: 0x172, + // Block 0x26, offset 0x980 + 0x9a0: 0x22, + 0x9b0: 0x0b, 0x9b1: 0x0b, 0x9b2: 0x0b, 0x9b3: 0x0b, 0x9b4: 0x0b, 0x9b5: 0x0b, 0x9b6: 0x0b, 0x9b7: 0x0b, + 0x9b8: 0x0b, 0x9b9: 0x0b, 0x9ba: 0x0b, 0x9bb: 0x0b, 0x9bc: 0x0b, 0x9bd: 0x0b, 0x9be: 0x0b, 0x9bf: 0x23, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x0b, 0x9c1: 0x0b, 0x9c2: 0x0b, 0x9c3: 0x0b, 0x9c4: 0x0b, 0x9c5: 0x0b, 0x9c6: 0x0b, 0x9c7: 0x0b, + 0x9c8: 0x0b, 0x9c9: 0x0b, 0x9ca: 0x0b, 0x9cb: 0x0b, 0x9cc: 0x0b, 0x9cd: 0x0b, 0x9ce: 0x0b, 0x9cf: 0x23, +} + +// Total table size 28992 bytes (28KiB); checksum: 811C9DC5 diff --git a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go index f248effae..ffadb7beb 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go new file mode 100644 index 000000000..92cce5802 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go @@ -0,0 +1,2043 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 19904 bytes (19.44 KiB). Checksum: b1f201ed2debb6c8. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 259 blocks, 16576 entries, 16576 bytes +// The third block is the zero block. +var bidiValues = [16576]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x000d, 0x5f1: 0x000d, 0x5f2: 0x000d, 0x5f3: 0x000d, 0x5f4: 0x000d, 0x5f5: 0x000d, + 0x5f6: 0x000d, 0x5f7: 0x000d, 0x5f8: 0x000d, 0x5f9: 0x000d, 0x5fa: 0x000d, 0x5fb: 0x000d, + 0x5fc: 0x000d, 0x5fd: 0x000d, 0x5fe: 0x000d, 0x5ff: 0x000d, + // Block 0x18, offset 0x600 + 0x600: 0x000d, 0x601: 0x000d, 0x602: 0x000d, 0x603: 0x000d, 0x604: 0x000d, 0x605: 0x000d, + 0x606: 0x000d, 0x607: 0x000d, 0x608: 0x000d, 0x609: 0x000d, 0x60a: 0x000d, 0x60b: 0x000d, + 0x60c: 0x000d, 0x60d: 0x000d, 0x60e: 0x000d, 0x60f: 0x0001, 0x610: 0x0005, 0x611: 0x0005, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x000c, 0x619: 0x000c, 0x61a: 0x000c, 0x61b: 0x000c, 0x61c: 0x000c, 0x61d: 0x000c, + 0x61e: 0x000c, 0x61f: 0x000c, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000c, 0x64b: 0x000c, + 0x64c: 0x000c, 0x64d: 0x000c, 0x64e: 0x000c, 0x64f: 0x000c, 0x650: 0x000c, 0x651: 0x000c, + 0x652: 0x000c, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + 0x77e: 0x000c, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x895: 0x000c, 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, 0x944: 0x000c, + 0x97c: 0x000c, 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa81: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaca: 0x000c, + 0xad2: 0x000c, 0xad3: 0x000c, 0xad4: 0x000c, 0xad6: 0x000c, + // Block 0x2c, offset 0xb00 + 0xb31: 0x000c, 0xb34: 0x000c, 0xb35: 0x000c, + 0xb36: 0x000c, 0xb37: 0x000c, 0xb38: 0x000c, 0xb39: 0x000c, 0xb3a: 0x000c, + 0xb3f: 0x0004, + // Block 0x2d, offset 0xb40 + 0xb47: 0x000c, 0xb48: 0x000c, 0xb49: 0x000c, 0xb4a: 0x000c, 0xb4b: 0x000c, + 0xb4c: 0x000c, 0xb4d: 0x000c, 0xb4e: 0x000c, + // Block 0x2e, offset 0xb80 + 0xbb1: 0x000c, 0xbb4: 0x000c, 0xbb5: 0x000c, + 0xbb6: 0x000c, 0xbb7: 0x000c, 0xbb8: 0x000c, 0xbb9: 0x000c, 0xbba: 0x000c, 0xbbb: 0x000c, + 0xbbc: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbc8: 0x000c, 0xbc9: 0x000c, 0xbca: 0x000c, 0xbcb: 0x000c, + 0xbcc: 0x000c, 0xbcd: 0x000c, 0xbce: 0x000c, + // Block 0x30, offset 0xc00 + 0xc18: 0x000c, 0xc19: 0x000c, + 0xc35: 0x000c, + 0xc37: 0x000c, 0xc39: 0x000c, 0xc3a: 0x003a, 0xc3b: 0x002a, + 0xc3c: 0x003a, 0xc3d: 0x002a, + // Block 0x31, offset 0xc40 + 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, 0xc7d: 0x000c, 0xc7e: 0x000c, + // Block 0x32, offset 0xc80 + 0xc80: 0x000c, 0xc81: 0x000c, 0xc82: 0x000c, 0xc83: 0x000c, 0xc84: 0x000c, + 0xc86: 0x000c, 0xc87: 0x000c, + 0xc8d: 0x000c, 0xc8e: 0x000c, 0xc8f: 0x000c, 0xc90: 0x000c, 0xc91: 0x000c, + 0xc92: 0x000c, 0xc93: 0x000c, 0xc94: 0x000c, 0xc95: 0x000c, 0xc96: 0x000c, 0xc97: 0x000c, + 0xc99: 0x000c, 0xc9a: 0x000c, 0xc9b: 0x000c, 0xc9c: 0x000c, 0xc9d: 0x000c, + 0xc9e: 0x000c, 0xc9f: 0x000c, 0xca0: 0x000c, 0xca1: 0x000c, 0xca2: 0x000c, 0xca3: 0x000c, + 0xca4: 0x000c, 0xca5: 0x000c, 0xca6: 0x000c, 0xca7: 0x000c, 0xca8: 0x000c, 0xca9: 0x000c, + 0xcaa: 0x000c, 0xcab: 0x000c, 0xcac: 0x000c, 0xcad: 0x000c, 0xcae: 0x000c, 0xcaf: 0x000c, + 0xcb0: 0x000c, 0xcb1: 0x000c, 0xcb2: 0x000c, 0xcb3: 0x000c, 0xcb4: 0x000c, 0xcb5: 0x000c, + 0xcb6: 0x000c, 0xcb7: 0x000c, 0xcb8: 0x000c, 0xcb9: 0x000c, 0xcba: 0x000c, 0xcbb: 0x000c, + 0xcbc: 0x000c, + // Block 0x33, offset 0xcc0 + 0xcc6: 0x000c, + // Block 0x34, offset 0xd00 + 0xd2d: 0x000c, 0xd2e: 0x000c, 0xd2f: 0x000c, + 0xd30: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, 0xd35: 0x000c, + 0xd36: 0x000c, 0xd37: 0x000c, 0xd39: 0x000c, 0xd3a: 0x000c, + 0xd3d: 0x000c, 0xd3e: 0x000c, + // Block 0x35, offset 0xd40 + 0xd58: 0x000c, 0xd59: 0x000c, + 0xd5e: 0x000c, 0xd5f: 0x000c, 0xd60: 0x000c, + 0xd71: 0x000c, 0xd72: 0x000c, 0xd73: 0x000c, 0xd74: 0x000c, + // Block 0x36, offset 0xd80 + 0xd82: 0x000c, 0xd85: 0x000c, + 0xd86: 0x000c, + 0xd8d: 0x000c, + 0xd9d: 0x000c, + // Block 0x37, offset 0xdc0 + 0xddd: 0x000c, + 0xdde: 0x000c, 0xddf: 0x000c, + // Block 0x38, offset 0xe00 + 0xe10: 0x000a, 0xe11: 0x000a, + 0xe12: 0x000a, 0xe13: 0x000a, 0xe14: 0x000a, 0xe15: 0x000a, 0xe16: 0x000a, 0xe17: 0x000a, + 0xe18: 0x000a, 0xe19: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x000a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x0009, + 0xe9b: 0x007a, 0xe9c: 0x006a, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, 0xed4: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf12: 0x000c, 0xf13: 0x000c, + 0xf32: 0x000c, 0xf33: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf74: 0x000c, 0xf75: 0x000c, + 0xf77: 0x000c, 0xf78: 0x000c, 0xf79: 0x000c, 0xf7a: 0x000c, 0xf7b: 0x000c, + 0xf7c: 0x000c, 0xf7d: 0x000c, + // Block 0x3e, offset 0xf80 + 0xf86: 0x000c, 0xf89: 0x000c, 0xf8a: 0x000c, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000c, 0xf8f: 0x000c, 0xf90: 0x000c, 0xf91: 0x000c, + 0xf92: 0x000c, 0xf93: 0x000c, + 0xf9b: 0x0004, 0xf9d: 0x000c, + 0xfb0: 0x000a, 0xfb1: 0x000a, 0xfb2: 0x000a, 0xfb3: 0x000a, 0xfb4: 0x000a, 0xfb5: 0x000a, + 0xfb6: 0x000a, 0xfb7: 0x000a, 0xfb8: 0x000a, 0xfb9: 0x000a, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x000a, 0xfc1: 0x000a, 0xfc2: 0x000a, 0xfc3: 0x000a, 0xfc4: 0x000a, 0xfc5: 0x000a, + 0xfc6: 0x000a, 0xfc7: 0x000a, 0xfc8: 0x000a, 0xfc9: 0x000a, 0xfca: 0x000a, 0xfcb: 0x000c, + 0xfcc: 0x000c, 0xfcd: 0x000c, 0xfce: 0x000b, 0xfcf: 0x000c, + // Block 0x40, offset 0x1000 + 0x1005: 0x000c, + 0x1006: 0x000c, + 0x1029: 0x000c, + // Block 0x41, offset 0x1040 + 0x1060: 0x000c, 0x1061: 0x000c, 0x1062: 0x000c, + 0x1067: 0x000c, 0x1068: 0x000c, + 0x1072: 0x000c, + 0x1079: 0x000c, 0x107a: 0x000c, 0x107b: 0x000c, + // Block 0x42, offset 0x1080 + 0x1080: 0x000a, 0x1084: 0x000a, 0x1085: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10de: 0x000a, 0x10df: 0x000a, 0x10e0: 0x000a, 0x10e1: 0x000a, 0x10e2: 0x000a, 0x10e3: 0x000a, + 0x10e4: 0x000a, 0x10e5: 0x000a, 0x10e6: 0x000a, 0x10e7: 0x000a, 0x10e8: 0x000a, 0x10e9: 0x000a, + 0x10ea: 0x000a, 0x10eb: 0x000a, 0x10ec: 0x000a, 0x10ed: 0x000a, 0x10ee: 0x000a, 0x10ef: 0x000a, + 0x10f0: 0x000a, 0x10f1: 0x000a, 0x10f2: 0x000a, 0x10f3: 0x000a, 0x10f4: 0x000a, 0x10f5: 0x000a, + 0x10f6: 0x000a, 0x10f7: 0x000a, 0x10f8: 0x000a, 0x10f9: 0x000a, 0x10fa: 0x000a, 0x10fb: 0x000a, + 0x10fc: 0x000a, 0x10fd: 0x000a, 0x10fe: 0x000a, 0x10ff: 0x000a, + // Block 0x44, offset 0x1100 + 0x1117: 0x000c, + 0x1118: 0x000c, 0x111b: 0x000c, + // Block 0x45, offset 0x1140 + 0x1156: 0x000c, + 0x1158: 0x000c, 0x1159: 0x000c, 0x115a: 0x000c, 0x115b: 0x000c, 0x115c: 0x000c, 0x115d: 0x000c, + 0x115e: 0x000c, 0x1160: 0x000c, 0x1162: 0x000c, + 0x1165: 0x000c, 0x1166: 0x000c, 0x1167: 0x000c, 0x1168: 0x000c, 0x1169: 0x000c, + 0x116a: 0x000c, 0x116b: 0x000c, 0x116c: 0x000c, + 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117f: 0x000c, + // Block 0x46, offset 0x1180 + 0x11b0: 0x000c, 0x11b1: 0x000c, 0x11b2: 0x000c, 0x11b3: 0x000c, 0x11b4: 0x000c, 0x11b5: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, 0x11bb: 0x000c, + 0x11bc: 0x000c, 0x11bd: 0x000c, 0x11be: 0x000c, 0x11bf: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x000c, 0x11c1: 0x000c, 0x11c2: 0x000c, 0x11c3: 0x000c, 0x11c4: 0x000c, 0x11c5: 0x000c, + 0x11c6: 0x000c, 0x11c7: 0x000c, 0x11c8: 0x000c, 0x11c9: 0x000c, 0x11ca: 0x000c, 0x11cb: 0x000c, + 0x11cc: 0x000c, 0x11cd: 0x000c, 0x11ce: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, 0x1202: 0x000c, 0x1203: 0x000c, + 0x1234: 0x000c, + 0x1236: 0x000c, 0x1237: 0x000c, 0x1238: 0x000c, 0x1239: 0x000c, 0x123a: 0x000c, + 0x123c: 0x000c, + // Block 0x49, offset 0x1240 + 0x1242: 0x000c, + 0x126b: 0x000c, 0x126c: 0x000c, 0x126d: 0x000c, 0x126e: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, 0x1272: 0x000c, 0x1273: 0x000c, + // Block 0x4a, offset 0x1280 + 0x1280: 0x000c, 0x1281: 0x000c, + 0x12a2: 0x000c, 0x12a3: 0x000c, + 0x12a4: 0x000c, 0x12a5: 0x000c, 0x12a8: 0x000c, 0x12a9: 0x000c, + 0x12ab: 0x000c, 0x12ac: 0x000c, 0x12ad: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12e6: 0x000c, 0x12e8: 0x000c, 0x12e9: 0x000c, + 0x12ed: 0x000c, 0x12ef: 0x000c, + 0x12f0: 0x000c, 0x12f1: 0x000c, + // Block 0x4c, offset 0x1300 + 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, + // Block 0x4d, offset 0x1340 + 0x1350: 0x000c, 0x1351: 0x000c, + 0x1352: 0x000c, 0x1354: 0x000c, 0x1355: 0x000c, 0x1356: 0x000c, 0x1357: 0x000c, + 0x1358: 0x000c, 0x1359: 0x000c, 0x135a: 0x000c, 0x135b: 0x000c, 0x135c: 0x000c, 0x135d: 0x000c, + 0x135e: 0x000c, 0x135f: 0x000c, 0x1360: 0x000c, 0x1362: 0x000c, 0x1363: 0x000c, + 0x1364: 0x000c, 0x1365: 0x000c, 0x1366: 0x000c, 0x1367: 0x000c, 0x1368: 0x000c, + 0x136d: 0x000c, + 0x1374: 0x000c, + 0x1378: 0x000c, 0x1379: 0x000c, + // Block 0x4e, offset 0x1380 + 0x13bd: 0x000a, 0x13bf: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x000a, 0x13c1: 0x000a, + 0x13cd: 0x000a, 0x13ce: 0x000a, 0x13cf: 0x000a, + 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, + 0x13ed: 0x000a, 0x13ee: 0x000a, 0x13ef: 0x000a, + 0x13fd: 0x000a, 0x13fe: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x0009, 0x1401: 0x0009, 0x1402: 0x0009, 0x1403: 0x0009, 0x1404: 0x0009, 0x1405: 0x0009, + 0x1406: 0x0009, 0x1407: 0x0009, 0x1408: 0x0009, 0x1409: 0x0009, 0x140a: 0x0009, 0x140b: 0x000b, + 0x140c: 0x000b, 0x140d: 0x000b, 0x140f: 0x0001, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x000a, 0x1420: 0x000a, 0x1421: 0x000a, 0x1422: 0x000a, 0x1423: 0x000a, + 0x1424: 0x000a, 0x1425: 0x000a, 0x1426: 0x000a, 0x1427: 0x000a, 0x1428: 0x0009, 0x1429: 0x0007, + 0x142a: 0x000e, 0x142b: 0x000e, 0x142c: 0x000e, 0x142d: 0x000e, 0x142e: 0x000e, 0x142f: 0x0006, + 0x1430: 0x0004, 0x1431: 0x0004, 0x1432: 0x0004, 0x1433: 0x0004, 0x1434: 0x0004, 0x1435: 0x000a, + 0x1436: 0x000a, 0x1437: 0x000a, 0x1438: 0x000a, 0x1439: 0x000a, 0x143a: 0x000a, 0x143b: 0x000a, + 0x143c: 0x000a, 0x143d: 0x000a, 0x143e: 0x000a, 0x143f: 0x000a, + // Block 0x51, offset 0x1440 + 0x1440: 0x000a, 0x1441: 0x000a, 0x1442: 0x000a, 0x1443: 0x000a, 0x1444: 0x0006, 0x1445: 0x009a, + 0x1446: 0x008a, 0x1447: 0x000a, 0x1448: 0x000a, 0x1449: 0x000a, 0x144a: 0x000a, 0x144b: 0x000a, + 0x144c: 0x000a, 0x144d: 0x000a, 0x144e: 0x000a, 0x144f: 0x000a, 0x1450: 0x000a, 0x1451: 0x000a, + 0x1452: 0x000a, 0x1453: 0x000a, 0x1454: 0x000a, 0x1455: 0x000a, 0x1456: 0x000a, 0x1457: 0x000a, + 0x1458: 0x000a, 0x1459: 0x000a, 0x145a: 0x000a, 0x145b: 0x000a, 0x145c: 0x000a, 0x145d: 0x000a, + 0x145e: 0x000a, 0x145f: 0x0009, 0x1460: 0x000b, 0x1461: 0x000b, 0x1462: 0x000b, 0x1463: 0x000b, + 0x1464: 0x000b, 0x1465: 0x000b, 0x1466: 0x000e, 0x1467: 0x000e, 0x1468: 0x000e, 0x1469: 0x000e, + 0x146a: 0x000b, 0x146b: 0x000b, 0x146c: 0x000b, 0x146d: 0x000b, 0x146e: 0x000b, 0x146f: 0x000b, + 0x1470: 0x0002, 0x1474: 0x0002, 0x1475: 0x0002, + 0x1476: 0x0002, 0x1477: 0x0002, 0x1478: 0x0002, 0x1479: 0x0002, 0x147a: 0x0003, 0x147b: 0x0003, + 0x147c: 0x000a, 0x147d: 0x009a, 0x147e: 0x008a, + // Block 0x52, offset 0x1480 + 0x1480: 0x0002, 0x1481: 0x0002, 0x1482: 0x0002, 0x1483: 0x0002, 0x1484: 0x0002, 0x1485: 0x0002, + 0x1486: 0x0002, 0x1487: 0x0002, 0x1488: 0x0002, 0x1489: 0x0002, 0x148a: 0x0003, 0x148b: 0x0003, + 0x148c: 0x000a, 0x148d: 0x009a, 0x148e: 0x008a, + 0x14a0: 0x0004, 0x14a1: 0x0004, 0x14a2: 0x0004, 0x14a3: 0x0004, + 0x14a4: 0x0004, 0x14a5: 0x0004, 0x14a6: 0x0004, 0x14a7: 0x0004, 0x14a8: 0x0004, 0x14a9: 0x0004, + 0x14aa: 0x0004, 0x14ab: 0x0004, 0x14ac: 0x0004, 0x14ad: 0x0004, 0x14ae: 0x0004, 0x14af: 0x0004, + 0x14b0: 0x0004, 0x14b1: 0x0004, 0x14b2: 0x0004, 0x14b3: 0x0004, 0x14b4: 0x0004, 0x14b5: 0x0004, + 0x14b6: 0x0004, 0x14b7: 0x0004, 0x14b8: 0x0004, 0x14b9: 0x0004, 0x14ba: 0x0004, 0x14bb: 0x0004, + 0x14bc: 0x0004, 0x14bd: 0x0004, 0x14be: 0x0004, 0x14bf: 0x0004, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0004, 0x14c1: 0x0004, 0x14c2: 0x0004, 0x14c3: 0x0004, 0x14c4: 0x0004, 0x14c5: 0x0004, + 0x14c6: 0x0004, 0x14c7: 0x0004, 0x14c8: 0x0004, 0x14c9: 0x0004, 0x14ca: 0x0004, 0x14cb: 0x0004, + 0x14cc: 0x0004, 0x14cd: 0x0004, 0x14ce: 0x0004, 0x14cf: 0x0004, 0x14d0: 0x000c, 0x14d1: 0x000c, + 0x14d2: 0x000c, 0x14d3: 0x000c, 0x14d4: 0x000c, 0x14d5: 0x000c, 0x14d6: 0x000c, 0x14d7: 0x000c, + 0x14d8: 0x000c, 0x14d9: 0x000c, 0x14da: 0x000c, 0x14db: 0x000c, 0x14dc: 0x000c, 0x14dd: 0x000c, + 0x14de: 0x000c, 0x14df: 0x000c, 0x14e0: 0x000c, 0x14e1: 0x000c, 0x14e2: 0x000c, 0x14e3: 0x000c, + 0x14e4: 0x000c, 0x14e5: 0x000c, 0x14e6: 0x000c, 0x14e7: 0x000c, 0x14e8: 0x000c, 0x14e9: 0x000c, + 0x14ea: 0x000c, 0x14eb: 0x000c, 0x14ec: 0x000c, 0x14ed: 0x000c, 0x14ee: 0x000c, 0x14ef: 0x000c, + 0x14f0: 0x000c, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, 0x1505: 0x000a, + 0x1506: 0x000a, 0x1508: 0x000a, 0x1509: 0x000a, + 0x1514: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, 0x1520: 0x000a, 0x1521: 0x000a, 0x1522: 0x000a, 0x1523: 0x000a, + 0x1525: 0x000a, 0x1527: 0x000a, 0x1529: 0x000a, + 0x152e: 0x0004, + 0x153a: 0x000a, 0x153b: 0x000a, + // Block 0x55, offset 0x1540 + 0x1540: 0x000a, 0x1541: 0x000a, 0x1542: 0x000a, 0x1543: 0x000a, 0x1544: 0x000a, + 0x154a: 0x000a, 0x154b: 0x000a, + 0x154c: 0x000a, 0x154d: 0x000a, 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x000a, 0x15d3: 0x000a, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x000a, 0x1609: 0x000a, 0x160a: 0x000a, 0x160b: 0x000a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x0003, 0x1613: 0x0004, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x000a, + 0x162a: 0x000a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + 0x1636: 0x000a, 0x1637: 0x000a, 0x1638: 0x000a, 0x1639: 0x000a, 0x163a: 0x000a, 0x163b: 0x000a, + 0x163c: 0x000a, 0x163d: 0x000a, 0x163e: 0x000a, 0x163f: 0x000a, + // Block 0x59, offset 0x1640 + 0x1640: 0x000a, 0x1641: 0x000a, 0x1642: 0x000a, 0x1643: 0x000a, 0x1644: 0x000a, 0x1645: 0x000a, + 0x1646: 0x000a, 0x1647: 0x000a, 0x1648: 0x003a, 0x1649: 0x002a, 0x164a: 0x003a, 0x164b: 0x002a, + 0x164c: 0x000a, 0x164d: 0x000a, 0x164e: 0x000a, 0x164f: 0x000a, 0x1650: 0x000a, 0x1651: 0x000a, + 0x1652: 0x000a, 0x1653: 0x000a, 0x1654: 0x000a, 0x1655: 0x000a, 0x1656: 0x000a, 0x1657: 0x000a, + 0x1658: 0x000a, 0x1659: 0x000a, 0x165a: 0x000a, 0x165b: 0x000a, 0x165c: 0x000a, 0x165d: 0x000a, + 0x165e: 0x000a, 0x165f: 0x000a, 0x1660: 0x000a, 0x1661: 0x000a, 0x1662: 0x000a, 0x1663: 0x000a, + 0x1664: 0x000a, 0x1665: 0x000a, 0x1666: 0x000a, 0x1667: 0x000a, 0x1668: 0x000a, 0x1669: 0x009a, + 0x166a: 0x008a, 0x166b: 0x000a, 0x166c: 0x000a, 0x166d: 0x000a, 0x166e: 0x000a, 0x166f: 0x000a, + 0x1670: 0x000a, 0x1671: 0x000a, 0x1672: 0x000a, 0x1673: 0x000a, 0x1674: 0x000a, 0x1675: 0x000a, + // Block 0x5a, offset 0x1680 + 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, 0x16ff: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1997: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a, + 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x009a, 0x1ad6: 0x008a, 0x1ad7: 0x00ba, + 0x1ad8: 0x00aa, 0x1ad9: 0x009a, 0x1ada: 0x008a, 0x1adb: 0x007a, 0x1adc: 0x006a, 0x1add: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, 0x206c: 0x000c, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + 0x20ff: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, 0x21bd: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x232a: 0x000a, 0x232b: 0x000a, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000a, 0x2441: 0x000a, 0x2442: 0x000a, 0x2443: 0x000a, 0x2444: 0x000a, 0x2445: 0x000a, + 0x2446: 0x000a, 0x2447: 0x000a, 0x2448: 0x000a, 0x2449: 0x000a, 0x244a: 0x000a, 0x244b: 0x000a, + 0x244c: 0x000a, 0x244d: 0x000a, 0x244e: 0x000a, 0x244f: 0x000a, 0x2450: 0x000d, 0x2451: 0x000d, + 0x2452: 0x000d, 0x2453: 0x000d, 0x2454: 0x000d, 0x2455: 0x000d, 0x2456: 0x000d, 0x2457: 0x000d, + 0x2458: 0x000d, 0x2459: 0x000d, 0x245a: 0x000d, 0x245b: 0x000d, 0x245c: 0x000d, 0x245d: 0x000d, + 0x245e: 0x000d, 0x245f: 0x000d, 0x2460: 0x000d, 0x2461: 0x000d, 0x2462: 0x000d, 0x2463: 0x000d, + 0x2464: 0x000d, 0x2465: 0x000d, 0x2466: 0x000d, 0x2467: 0x000d, 0x2468: 0x000d, 0x2469: 0x000d, + 0x246a: 0x000d, 0x246b: 0x000d, 0x246c: 0x000d, 0x246d: 0x000d, 0x246e: 0x000d, 0x246f: 0x000d, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000d, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000d, 0x2481: 0x000d, 0x2482: 0x000d, 0x2483: 0x000d, 0x2484: 0x000d, 0x2485: 0x000d, + 0x2486: 0x000d, 0x2487: 0x000d, 0x2488: 0x000d, 0x2489: 0x000d, 0x248a: 0x000d, 0x248b: 0x000d, + 0x248c: 0x000d, 0x248d: 0x000d, 0x248e: 0x000d, 0x248f: 0x000a, 0x2490: 0x000b, 0x2491: 0x000b, + 0x2492: 0x000b, 0x2493: 0x000b, 0x2494: 0x000b, 0x2495: 0x000b, 0x2496: 0x000b, 0x2497: 0x000b, + 0x2498: 0x000b, 0x2499: 0x000b, 0x249a: 0x000b, 0x249b: 0x000b, 0x249c: 0x000b, 0x249d: 0x000b, + 0x249e: 0x000b, 0x249f: 0x000b, 0x24a0: 0x000b, 0x24a1: 0x000b, 0x24a2: 0x000b, 0x24a3: 0x000b, + 0x24a4: 0x000b, 0x24a5: 0x000b, 0x24a6: 0x000b, 0x24a7: 0x000b, 0x24a8: 0x000b, 0x24a9: 0x000b, + 0x24aa: 0x000b, 0x24ab: 0x000b, 0x24ac: 0x000b, 0x24ad: 0x000b, 0x24ae: 0x000b, 0x24af: 0x000b, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000c, 0x24c1: 0x000c, 0x24c2: 0x000c, 0x24c3: 0x000c, 0x24c4: 0x000c, 0x24c5: 0x000c, + 0x24c6: 0x000c, 0x24c7: 0x000c, 0x24c8: 0x000c, 0x24c9: 0x000c, 0x24ca: 0x000c, 0x24cb: 0x000c, + 0x24cc: 0x000c, 0x24cd: 0x000c, 0x24ce: 0x000c, 0x24cf: 0x000c, 0x24d0: 0x000a, 0x24d1: 0x000a, + 0x24d2: 0x000a, 0x24d3: 0x000a, 0x24d4: 0x000a, 0x24d5: 0x000a, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x000a, + 0x24e0: 0x000c, 0x24e1: 0x000c, 0x24e2: 0x000c, 0x24e3: 0x000c, + 0x24e4: 0x000c, 0x24e5: 0x000c, 0x24e6: 0x000c, 0x24e7: 0x000c, 0x24e8: 0x000c, 0x24e9: 0x000c, + 0x24ea: 0x000c, 0x24eb: 0x000c, 0x24ec: 0x000c, 0x24ed: 0x000c, 0x24ee: 0x000c, 0x24ef: 0x000c, + 0x24f0: 0x000a, 0x24f1: 0x000a, 0x24f2: 0x000a, 0x24f3: 0x000a, 0x24f4: 0x000a, 0x24f5: 0x000a, + 0x24f6: 0x000a, 0x24f7: 0x000a, 0x24f8: 0x000a, 0x24f9: 0x000a, 0x24fa: 0x000a, 0x24fb: 0x000a, + 0x24fc: 0x000a, 0x24fd: 0x000a, 0x24fe: 0x000a, 0x24ff: 0x000a, + // Block 0x94, offset 0x2500 + 0x2500: 0x000a, 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x000a, 0x2504: 0x000a, 0x2505: 0x000a, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x000a, 0x2509: 0x000a, 0x250a: 0x000a, 0x250b: 0x000a, + 0x250c: 0x000a, 0x250d: 0x000a, 0x250e: 0x000a, 0x250f: 0x000a, 0x2510: 0x0006, 0x2511: 0x000a, + 0x2512: 0x0006, 0x2514: 0x000a, 0x2515: 0x0006, 0x2516: 0x000a, 0x2517: 0x000a, + 0x2518: 0x000a, 0x2519: 0x009a, 0x251a: 0x008a, 0x251b: 0x007a, 0x251c: 0x006a, 0x251d: 0x009a, + 0x251e: 0x008a, 0x251f: 0x0004, 0x2520: 0x000a, 0x2521: 0x000a, 0x2522: 0x0003, 0x2523: 0x0003, + 0x2524: 0x000a, 0x2525: 0x000a, 0x2526: 0x000a, 0x2528: 0x000a, 0x2529: 0x0004, + 0x252a: 0x0004, 0x252b: 0x000a, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000d, + // Block 0x95, offset 0x2540 + 0x2540: 0x000d, 0x2541: 0x000d, 0x2542: 0x000d, 0x2543: 0x000d, 0x2544: 0x000d, 0x2545: 0x000d, + 0x2546: 0x000d, 0x2547: 0x000d, 0x2548: 0x000d, 0x2549: 0x000d, 0x254a: 0x000d, 0x254b: 0x000d, + 0x254c: 0x000d, 0x254d: 0x000d, 0x254e: 0x000d, 0x254f: 0x000d, 0x2550: 0x000d, 0x2551: 0x000d, + 0x2552: 0x000d, 0x2553: 0x000d, 0x2554: 0x000d, 0x2555: 0x000d, 0x2556: 0x000d, 0x2557: 0x000d, + 0x2558: 0x000d, 0x2559: 0x000d, 0x255a: 0x000d, 0x255b: 0x000d, 0x255c: 0x000d, 0x255d: 0x000d, + 0x255e: 0x000d, 0x255f: 0x000d, 0x2560: 0x000d, 0x2561: 0x000d, 0x2562: 0x000d, 0x2563: 0x000d, + 0x2564: 0x000d, 0x2565: 0x000d, 0x2566: 0x000d, 0x2567: 0x000d, 0x2568: 0x000d, 0x2569: 0x000d, + 0x256a: 0x000d, 0x256b: 0x000d, 0x256c: 0x000d, 0x256d: 0x000d, 0x256e: 0x000d, 0x256f: 0x000d, + 0x2570: 0x000d, 0x2571: 0x000d, 0x2572: 0x000d, 0x2573: 0x000d, 0x2574: 0x000d, 0x2575: 0x000d, + 0x2576: 0x000d, 0x2577: 0x000d, 0x2578: 0x000d, 0x2579: 0x000d, 0x257a: 0x000d, 0x257b: 0x000d, + 0x257c: 0x000d, 0x257d: 0x000d, 0x257e: 0x000d, 0x257f: 0x000b, + // Block 0x96, offset 0x2580 + 0x2581: 0x000a, 0x2582: 0x000a, 0x2583: 0x0004, 0x2584: 0x0004, 0x2585: 0x0004, + 0x2586: 0x000a, 0x2587: 0x000a, 0x2588: 0x003a, 0x2589: 0x002a, 0x258a: 0x000a, 0x258b: 0x0003, + 0x258c: 0x0006, 0x258d: 0x0003, 0x258e: 0x0006, 0x258f: 0x0006, 0x2590: 0x0002, 0x2591: 0x0002, + 0x2592: 0x0002, 0x2593: 0x0002, 0x2594: 0x0002, 0x2595: 0x0002, 0x2596: 0x0002, 0x2597: 0x0002, + 0x2598: 0x0002, 0x2599: 0x0002, 0x259a: 0x0006, 0x259b: 0x000a, 0x259c: 0x000a, 0x259d: 0x000a, + 0x259e: 0x000a, 0x259f: 0x000a, 0x25a0: 0x000a, + 0x25bb: 0x005a, + 0x25bc: 0x000a, 0x25bd: 0x004a, 0x25be: 0x000a, 0x25bf: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x000a, + 0x25db: 0x005a, 0x25dc: 0x000a, 0x25dd: 0x004a, + 0x25de: 0x000a, 0x25df: 0x00fa, 0x25e0: 0x00ea, 0x25e1: 0x000a, 0x25e2: 0x003a, 0x25e3: 0x002a, + 0x25e4: 0x000a, 0x25e5: 0x000a, + // Block 0x98, offset 0x2600 + 0x2620: 0x0004, 0x2621: 0x0004, 0x2622: 0x000a, 0x2623: 0x000a, + 0x2624: 0x000a, 0x2625: 0x0004, 0x2626: 0x0004, 0x2628: 0x000a, 0x2629: 0x000a, + 0x262a: 0x000a, 0x262b: 0x000a, 0x262c: 0x000a, 0x262d: 0x000a, 0x262e: 0x000a, + 0x2630: 0x000b, 0x2631: 0x000b, 0x2632: 0x000b, 0x2633: 0x000b, 0x2634: 0x000b, 0x2635: 0x000b, + 0x2636: 0x000b, 0x2637: 0x000b, 0x2638: 0x000b, 0x2639: 0x000a, 0x263a: 0x000a, 0x263b: 0x000a, + 0x263c: 0x000a, 0x263d: 0x000a, 0x263e: 0x000b, 0x263f: 0x000b, + // Block 0x99, offset 0x2640 + 0x2641: 0x000a, + // Block 0x9a, offset 0x2680 + 0x2680: 0x000a, 0x2681: 0x000a, 0x2682: 0x000a, 0x2683: 0x000a, 0x2684: 0x000a, 0x2685: 0x000a, + 0x2686: 0x000a, 0x2687: 0x000a, 0x2688: 0x000a, 0x2689: 0x000a, 0x268a: 0x000a, 0x268b: 0x000a, + 0x268c: 0x000a, 0x2690: 0x000a, 0x2691: 0x000a, + 0x2692: 0x000a, 0x2693: 0x000a, 0x2694: 0x000a, 0x2695: 0x000a, 0x2696: 0x000a, 0x2697: 0x000a, + 0x2698: 0x000a, 0x2699: 0x000a, 0x269a: 0x000a, 0x269b: 0x000a, 0x269c: 0x000a, + 0x26a0: 0x000a, + // Block 0x9b, offset 0x26c0 + 0x26fd: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2720: 0x000c, 0x2721: 0x0002, 0x2722: 0x0002, 0x2723: 0x0002, + 0x2724: 0x0002, 0x2725: 0x0002, 0x2726: 0x0002, 0x2727: 0x0002, 0x2728: 0x0002, 0x2729: 0x0002, + 0x272a: 0x0002, 0x272b: 0x0002, 0x272c: 0x0002, 0x272d: 0x0002, 0x272e: 0x0002, 0x272f: 0x0002, + 0x2730: 0x0002, 0x2731: 0x0002, 0x2732: 0x0002, 0x2733: 0x0002, 0x2734: 0x0002, 0x2735: 0x0002, + 0x2736: 0x0002, 0x2737: 0x0002, 0x2738: 0x0002, 0x2739: 0x0002, 0x273a: 0x0002, 0x273b: 0x0002, + // Block 0x9d, offset 0x2740 + 0x2776: 0x000c, 0x2777: 0x000c, 0x2778: 0x000c, 0x2779: 0x000c, 0x277a: 0x000c, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x000a, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x000c, 0x2802: 0x000c, 0x2803: 0x000c, 0x2804: 0x0001, 0x2805: 0x000c, + 0x2806: 0x000c, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x000c, 0x280d: 0x000c, 0x280e: 0x000c, 0x280f: 0x000c, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x000c, 0x2839: 0x000c, 0x283a: 0x000c, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x000c, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x0001, 0x287a: 0x0001, 0x287b: 0x0001, + 0x287c: 0x0001, 0x287d: 0x0001, 0x287e: 0x0001, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0001, 0x28a1: 0x0001, 0x28a2: 0x0001, 0x28a3: 0x0001, + 0x28a4: 0x0001, 0x28a5: 0x0001, 0x28a6: 0x0001, 0x28a7: 0x0001, 0x28a8: 0x0001, 0x28a9: 0x0001, + 0x28aa: 0x0001, 0x28ab: 0x0001, 0x28ac: 0x0001, 0x28ad: 0x0001, 0x28ae: 0x0001, 0x28af: 0x0001, + 0x28b0: 0x0001, 0x28b1: 0x0001, 0x28b2: 0x0001, 0x28b3: 0x0001, 0x28b4: 0x0001, 0x28b5: 0x0001, + 0x28b6: 0x0001, 0x28b7: 0x0001, 0x28b8: 0x0001, 0x28b9: 0x000a, 0x28ba: 0x000a, 0x28bb: 0x000a, + 0x28bc: 0x000a, 0x28bd: 0x000a, 0x28be: 0x000a, 0x28bf: 0x000a, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000d, 0x28c1: 0x000d, 0x28c2: 0x000d, 0x28c3: 0x000d, 0x28c4: 0x000d, 0x28c5: 0x000d, + 0x28c6: 0x000d, 0x28c7: 0x000d, 0x28c8: 0x000d, 0x28c9: 0x000d, 0x28ca: 0x000d, 0x28cb: 0x000d, + 0x28cc: 0x000d, 0x28cd: 0x000d, 0x28ce: 0x000d, 0x28cf: 0x000d, 0x28d0: 0x000d, 0x28d1: 0x000d, + 0x28d2: 0x000d, 0x28d3: 0x000d, 0x28d4: 0x000d, 0x28d5: 0x000d, 0x28d6: 0x000d, 0x28d7: 0x000d, + 0x28d8: 0x000d, 0x28d9: 0x000d, 0x28da: 0x000d, 0x28db: 0x000d, 0x28dc: 0x000d, 0x28dd: 0x000d, + 0x28de: 0x000d, 0x28df: 0x000d, 0x28e0: 0x000d, 0x28e1: 0x000d, 0x28e2: 0x000d, 0x28e3: 0x000d, + 0x28e4: 0x000c, 0x28e5: 0x000c, 0x28e6: 0x000c, 0x28e7: 0x000c, 0x28e8: 0x0001, 0x28e9: 0x0001, + 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001, + 0x28f0: 0x0005, 0x28f1: 0x0005, 0x28f2: 0x0005, 0x28f3: 0x0005, 0x28f4: 0x0005, 0x28f5: 0x0005, + 0x28f6: 0x0005, 0x28f7: 0x0005, 0x28f8: 0x0005, 0x28f9: 0x0005, 0x28fa: 0x0001, 0x28fb: 0x0001, + 0x28fc: 0x0001, 0x28fd: 0x0001, 0x28fe: 0x0001, 0x28ff: 0x0001, + // Block 0xa4, offset 0x2900 + 0x2900: 0x0001, 0x2901: 0x0001, 0x2902: 0x0001, 0x2903: 0x0001, 0x2904: 0x0001, 0x2905: 0x0001, + 0x2906: 0x0001, 0x2907: 0x0001, 0x2908: 0x0001, 0x2909: 0x0001, 0x290a: 0x0001, 0x290b: 0x0001, + 0x290c: 0x0001, 0x290d: 0x0001, 0x290e: 0x0001, 0x290f: 0x0001, 0x2910: 0x0001, 0x2911: 0x0001, + 0x2912: 0x0001, 0x2913: 0x0001, 0x2914: 0x0001, 0x2915: 0x0001, 0x2916: 0x0001, 0x2917: 0x0001, + 0x2918: 0x0001, 0x2919: 0x0001, 0x291a: 0x0001, 0x291b: 0x0001, 0x291c: 0x0001, 0x291d: 0x0001, + 0x291e: 0x0001, 0x291f: 0x0001, 0x2920: 0x0005, 0x2921: 0x0005, 0x2922: 0x0005, 0x2923: 0x0005, + 0x2924: 0x0005, 0x2925: 0x0005, 0x2926: 0x0005, 0x2927: 0x0005, 0x2928: 0x0005, 0x2929: 0x0005, + 0x292a: 0x0005, 0x292b: 0x0005, 0x292c: 0x0005, 0x292d: 0x0005, 0x292e: 0x0005, 0x292f: 0x0005, + 0x2930: 0x0005, 0x2931: 0x0005, 0x2932: 0x0005, 0x2933: 0x0005, 0x2934: 0x0005, 0x2935: 0x0005, + 0x2936: 0x0005, 0x2937: 0x0005, 0x2938: 0x0005, 0x2939: 0x0005, 0x293a: 0x0005, 0x293b: 0x0005, + 0x293c: 0x0005, 0x293d: 0x0005, 0x293e: 0x0005, 0x293f: 0x0001, + // Block 0xa5, offset 0x2940 + 0x2940: 0x0001, 0x2941: 0x0001, 0x2942: 0x0001, 0x2943: 0x0001, 0x2944: 0x0001, 0x2945: 0x0001, + 0x2946: 0x0001, 0x2947: 0x0001, 0x2948: 0x0001, 0x2949: 0x0001, 0x294a: 0x0001, 0x294b: 0x0001, + 0x294c: 0x0001, 0x294d: 0x0001, 0x294e: 0x0001, 0x294f: 0x0001, 0x2950: 0x0001, 0x2951: 0x0001, + 0x2952: 0x0001, 0x2953: 0x0001, 0x2954: 0x0001, 0x2955: 0x0001, 0x2956: 0x0001, 0x2957: 0x0001, + 0x2958: 0x0001, 0x2959: 0x0001, 0x295a: 0x0001, 0x295b: 0x0001, 0x295c: 0x0001, 0x295d: 0x0001, + 0x295e: 0x0001, 0x295f: 0x0001, 0x2960: 0x0001, 0x2961: 0x0001, 0x2962: 0x0001, 0x2963: 0x0001, + 0x2964: 0x0001, 0x2965: 0x0001, 0x2966: 0x0001, 0x2967: 0x0001, 0x2968: 0x0001, 0x2969: 0x0001, + 0x296a: 0x0001, 0x296b: 0x000c, 0x296c: 0x000c, 0x296d: 0x0001, 0x296e: 0x0001, 0x296f: 0x0001, + 0x2970: 0x0001, 0x2971: 0x0001, 0x2972: 0x0001, 0x2973: 0x0001, 0x2974: 0x0001, 0x2975: 0x0001, + 0x2976: 0x0001, 0x2977: 0x0001, 0x2978: 0x0001, 0x2979: 0x0001, 0x297a: 0x0001, 0x297b: 0x0001, + 0x297c: 0x0001, 0x297d: 0x0001, 0x297e: 0x0001, 0x297f: 0x0001, + // Block 0xa6, offset 0x2980 + 0x2980: 0x0001, 0x2981: 0x0001, 0x2982: 0x0001, 0x2983: 0x0001, 0x2984: 0x0001, 0x2985: 0x0001, + 0x2986: 0x0001, 0x2987: 0x0001, 0x2988: 0x0001, 0x2989: 0x0001, 0x298a: 0x0001, 0x298b: 0x0001, + 0x298c: 0x0001, 0x298d: 0x0001, 0x298e: 0x0001, 0x298f: 0x0001, 0x2990: 0x0001, 0x2991: 0x0001, + 0x2992: 0x0001, 0x2993: 0x0001, 0x2994: 0x0001, 0x2995: 0x0001, 0x2996: 0x0001, 0x2997: 0x0001, + 0x2998: 0x0001, 0x2999: 0x0001, 0x299a: 0x0001, 0x299b: 0x0001, 0x299c: 0x0001, 0x299d: 0x0001, + 0x299e: 0x0001, 0x299f: 0x0001, 0x29a0: 0x0001, 0x29a1: 0x0001, 0x29a2: 0x0001, 0x29a3: 0x0001, + 0x29a4: 0x0001, 0x29a5: 0x0001, 0x29a6: 0x0001, 0x29a7: 0x0001, 0x29a8: 0x0001, 0x29a9: 0x0001, + 0x29aa: 0x0001, 0x29ab: 0x0001, 0x29ac: 0x0001, 0x29ad: 0x0001, 0x29ae: 0x0001, 0x29af: 0x0001, + 0x29b0: 0x0001, 0x29b1: 0x0001, 0x29b2: 0x0001, 0x29b3: 0x0001, 0x29b4: 0x0001, 0x29b5: 0x0001, + 0x29b6: 0x0001, 0x29b7: 0x0001, 0x29b8: 0x0001, 0x29b9: 0x0001, 0x29ba: 0x0001, 0x29bb: 0x0001, + 0x29bc: 0x0001, 0x29bd: 0x000c, 0x29be: 0x000c, 0x29bf: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x0001, 0x29c1: 0x0001, 0x29c2: 0x0001, 0x29c3: 0x0001, 0x29c4: 0x0001, 0x29c5: 0x0001, + 0x29c6: 0x0001, 0x29c7: 0x0001, 0x29c8: 0x0001, 0x29c9: 0x0001, 0x29ca: 0x0001, 0x29cb: 0x0001, + 0x29cc: 0x0001, 0x29cd: 0x0001, 0x29ce: 0x0001, 0x29cf: 0x0001, 0x29d0: 0x0001, 0x29d1: 0x0001, + 0x29d2: 0x0001, 0x29d3: 0x0001, 0x29d4: 0x0001, 0x29d5: 0x0001, 0x29d6: 0x0001, 0x29d7: 0x0001, + 0x29d8: 0x0001, 0x29d9: 0x0001, 0x29da: 0x0001, 0x29db: 0x0001, 0x29dc: 0x0001, 0x29dd: 0x0001, + 0x29de: 0x0001, 0x29df: 0x0001, 0x29e0: 0x0001, 0x29e1: 0x0001, 0x29e2: 0x0001, 0x29e3: 0x0001, + 0x29e4: 0x0001, 0x29e5: 0x0001, 0x29e6: 0x0001, 0x29e7: 0x0001, 0x29e8: 0x0001, 0x29e9: 0x0001, + 0x29ea: 0x0001, 0x29eb: 0x0001, 0x29ec: 0x0001, 0x29ed: 0x0001, 0x29ee: 0x0001, 0x29ef: 0x0001, + 0x29f0: 0x000d, 0x29f1: 0x000d, 0x29f2: 0x000d, 0x29f3: 0x000d, 0x29f4: 0x000d, 0x29f5: 0x000d, + 0x29f6: 0x000d, 0x29f7: 0x000d, 0x29f8: 0x000d, 0x29f9: 0x000d, 0x29fa: 0x000d, 0x29fb: 0x000d, + 0x29fc: 0x000d, 0x29fd: 0x000d, 0x29fe: 0x000d, 0x29ff: 0x000d, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000d, 0x2a01: 0x000d, 0x2a02: 0x000d, 0x2a03: 0x000d, 0x2a04: 0x000d, 0x2a05: 0x000d, + 0x2a06: 0x000c, 0x2a07: 0x000c, 0x2a08: 0x000c, 0x2a09: 0x000c, 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, 0x2a0d: 0x000c, 0x2a0e: 0x000c, 0x2a0f: 0x000c, 0x2a10: 0x000c, 0x2a11: 0x000d, + 0x2a12: 0x000d, 0x2a13: 0x000d, 0x2a14: 0x000d, 0x2a15: 0x000d, 0x2a16: 0x000d, 0x2a17: 0x000d, + 0x2a18: 0x000d, 0x2a19: 0x000d, 0x2a1a: 0x0001, 0x2a1b: 0x0001, 0x2a1c: 0x0001, 0x2a1d: 0x0001, + 0x2a1e: 0x0001, 0x2a1f: 0x0001, 0x2a20: 0x0001, 0x2a21: 0x0001, 0x2a22: 0x0001, 0x2a23: 0x0001, + 0x2a24: 0x0001, 0x2a25: 0x0001, 0x2a26: 0x0001, 0x2a27: 0x0001, 0x2a28: 0x0001, 0x2a29: 0x0001, + 0x2a2a: 0x0001, 0x2a2b: 0x0001, 0x2a2c: 0x0001, 0x2a2d: 0x0001, 0x2a2e: 0x0001, 0x2a2f: 0x0001, + 0x2a30: 0x0001, 0x2a31: 0x0001, 0x2a32: 0x0001, 0x2a33: 0x0001, 0x2a34: 0x0001, 0x2a35: 0x0001, + 0x2a36: 0x0001, 0x2a37: 0x0001, 0x2a38: 0x0001, 0x2a39: 0x0001, 0x2a3a: 0x0001, 0x2a3b: 0x0001, + 0x2a3c: 0x0001, 0x2a3d: 0x0001, 0x2a3e: 0x0001, 0x2a3f: 0x0001, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x0001, 0x2a41: 0x0001, 0x2a42: 0x000c, 0x2a43: 0x000c, 0x2a44: 0x000c, 0x2a45: 0x000c, + 0x2a46: 0x0001, 0x2a47: 0x0001, 0x2a48: 0x0001, 0x2a49: 0x0001, 0x2a4a: 0x0001, 0x2a4b: 0x0001, + 0x2a4c: 0x0001, 0x2a4d: 0x0001, 0x2a4e: 0x0001, 0x2a4f: 0x0001, 0x2a50: 0x0001, 0x2a51: 0x0001, + 0x2a52: 0x0001, 0x2a53: 0x0001, 0x2a54: 0x0001, 0x2a55: 0x0001, 0x2a56: 0x0001, 0x2a57: 0x0001, + 0x2a58: 0x0001, 0x2a59: 0x0001, 0x2a5a: 0x0001, 0x2a5b: 0x0001, 0x2a5c: 0x0001, 0x2a5d: 0x0001, + 0x2a5e: 0x0001, 0x2a5f: 0x0001, 0x2a60: 0x0001, 0x2a61: 0x0001, 0x2a62: 0x0001, 0x2a63: 0x0001, + 0x2a64: 0x0001, 0x2a65: 0x0001, 0x2a66: 0x0001, 0x2a67: 0x0001, 0x2a68: 0x0001, 0x2a69: 0x0001, + 0x2a6a: 0x0001, 0x2a6b: 0x0001, 0x2a6c: 0x0001, 0x2a6d: 0x0001, 0x2a6e: 0x0001, 0x2a6f: 0x0001, + 0x2a70: 0x0001, 0x2a71: 0x0001, 0x2a72: 0x0001, 0x2a73: 0x0001, 0x2a74: 0x0001, 0x2a75: 0x0001, + 0x2a76: 0x0001, 0x2a77: 0x0001, 0x2a78: 0x0001, 0x2a79: 0x0001, 0x2a7a: 0x0001, 0x2a7b: 0x0001, + 0x2a7c: 0x0001, 0x2a7d: 0x0001, 0x2a7e: 0x0001, 0x2a7f: 0x0001, + // Block 0xaa, offset 0x2a80 + 0x2a81: 0x000c, + 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c, + 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, 0x2abf: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, 0x2ac2: 0x000c, 0x2ac3: 0x000c, 0x2ac4: 0x000c, 0x2ac5: 0x000c, + 0x2ac6: 0x000c, + 0x2ad2: 0x000a, 0x2ad3: 0x000a, 0x2ad4: 0x000a, 0x2ad5: 0x000a, 0x2ad6: 0x000a, 0x2ad7: 0x000a, + 0x2ad8: 0x000a, 0x2ad9: 0x000a, 0x2ada: 0x000a, 0x2adb: 0x000a, 0x2adc: 0x000a, 0x2add: 0x000a, + 0x2ade: 0x000a, 0x2adf: 0x000a, 0x2ae0: 0x000a, 0x2ae1: 0x000a, 0x2ae2: 0x000a, 0x2ae3: 0x000a, + 0x2ae4: 0x000a, 0x2ae5: 0x000a, + 0x2af0: 0x000c, 0x2af3: 0x000c, 0x2af4: 0x000c, + 0x2aff: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b33: 0x000c, 0x2b34: 0x000c, 0x2b35: 0x000c, + 0x2b36: 0x000c, 0x2b39: 0x000c, 0x2b3a: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, 0x2b41: 0x000c, 0x2b42: 0x000c, + 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6d: 0x000c, 0x2b6e: 0x000c, 0x2b6f: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb3: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x000c, 0x2bc1: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c, + 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c09: 0x000c, 0x2c0a: 0x000c, 0x2c0b: 0x000c, + 0x2c0c: 0x000c, 0x2c0f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c6f: 0x000c, + 0x2c70: 0x000c, 0x2c71: 0x000c, 0x2c74: 0x000c, + 0x2c76: 0x000c, 0x2c77: 0x000c, + 0x2c7e: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c9f: 0x000c, 0x2ca3: 0x000c, + 0x2ca4: 0x000c, 0x2ca5: 0x000c, 0x2ca6: 0x000c, 0x2ca7: 0x000c, 0x2ca8: 0x000c, 0x2ca9: 0x000c, + 0x2caa: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2ce6: 0x000c, 0x2ce7: 0x000c, 0x2ce8: 0x000c, 0x2ce9: 0x000c, + 0x2cea: 0x000c, 0x2ceb: 0x000c, 0x2cec: 0x000c, + 0x2cf0: 0x000c, 0x2cf1: 0x000c, 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, 0x2d3b: 0x000c, + 0x2d3c: 0x000c, 0x2d3d: 0x000c, 0x2d3e: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d42: 0x000c, 0x2d43: 0x000c, 0x2d44: 0x000c, + 0x2d46: 0x000c, + 0x2d5e: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db6: 0x000c, 0x2db7: 0x000c, 0x2db8: 0x000c, 0x2dba: 0x000c, + 0x2dbf: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, 0x2e3f: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x000c, + 0x2e5c: 0x000c, 0x2e5d: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, + 0x2ebd: 0x000c, 0x2ebf: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ec0: 0x000c, + 0x2ee0: 0x000a, 0x2ee1: 0x000a, 0x2ee2: 0x000a, 0x2ee3: 0x000a, + 0x2ee4: 0x000a, 0x2ee5: 0x000a, 0x2ee6: 0x000a, 0x2ee7: 0x000a, 0x2ee8: 0x000a, 0x2ee9: 0x000a, + 0x2eea: 0x000a, 0x2eeb: 0x000a, 0x2eec: 0x000a, + // Block 0xbc, offset 0x2f00 + 0x2f2b: 0x000c, 0x2f2d: 0x000c, + 0x2f30: 0x000c, 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f37: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f5f: 0x000c, 0x2f62: 0x000c, 0x2f63: 0x000c, + 0x2f64: 0x000c, 0x2f65: 0x000c, 0x2f67: 0x000c, 0x2f68: 0x000c, 0x2f69: 0x000c, + 0x2f6a: 0x000c, 0x2f6b: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2faf: 0x000c, + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, 0x2fb5: 0x000c, + 0x2fb6: 0x000c, 0x2fb7: 0x000c, 0x2fb9: 0x000c, 0x2fba: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ffb: 0x000c, + 0x2ffc: 0x000c, 0x2ffe: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3003: 0x000c, + // Block 0xc1, offset 0x3040 + 0x3054: 0x000c, 0x3055: 0x000c, 0x3056: 0x000c, 0x3057: 0x000c, + 0x305a: 0x000c, 0x305b: 0x000c, + 0x3060: 0x000c, + // Block 0xc2, offset 0x3080 + 0x3081: 0x000c, 0x3082: 0x000c, 0x3083: 0x000c, 0x3084: 0x000c, 0x3085: 0x000c, + 0x3086: 0x000c, 0x3089: 0x000c, 0x308a: 0x000c, + 0x30b3: 0x000c, 0x30b4: 0x000c, 0x30b5: 0x000c, + 0x30b6: 0x000c, 0x30b7: 0x000c, 0x30b8: 0x000c, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c7: 0x000c, + 0x30d1: 0x000c, + 0x30d2: 0x000c, 0x30d3: 0x000c, 0x30d4: 0x000c, 0x30d5: 0x000c, 0x30d6: 0x000c, + 0x30d9: 0x000c, 0x30da: 0x000c, 0x30db: 0x000c, + // Block 0xc4, offset 0x3100 + 0x310a: 0x000c, 0x310b: 0x000c, + 0x310c: 0x000c, 0x310d: 0x000c, 0x310e: 0x000c, 0x310f: 0x000c, 0x3110: 0x000c, 0x3111: 0x000c, + 0x3112: 0x000c, 0x3113: 0x000c, 0x3114: 0x000c, 0x3115: 0x000c, 0x3116: 0x000c, + 0x3118: 0x000c, 0x3119: 0x000c, + // Block 0xc5, offset 0x3140 + 0x3170: 0x000c, 0x3171: 0x000c, 0x3172: 0x000c, 0x3173: 0x000c, 0x3174: 0x000c, 0x3175: 0x000c, + 0x3176: 0x000c, 0x3178: 0x000c, 0x3179: 0x000c, 0x317a: 0x000c, 0x317b: 0x000c, + 0x317c: 0x000c, 0x317d: 0x000c, + // Block 0xc6, offset 0x3180 + 0x3192: 0x000c, 0x3193: 0x000c, 0x3194: 0x000c, 0x3195: 0x000c, 0x3196: 0x000c, 0x3197: 0x000c, + 0x3198: 0x000c, 0x3199: 0x000c, 0x319a: 0x000c, 0x319b: 0x000c, 0x319c: 0x000c, 0x319d: 0x000c, + 0x319e: 0x000c, 0x319f: 0x000c, 0x31a0: 0x000c, 0x31a1: 0x000c, 0x31a2: 0x000c, 0x31a3: 0x000c, + 0x31a4: 0x000c, 0x31a5: 0x000c, 0x31a6: 0x000c, 0x31a7: 0x000c, + 0x31aa: 0x000c, 0x31ab: 0x000c, 0x31ac: 0x000c, 0x31ad: 0x000c, 0x31ae: 0x000c, 0x31af: 0x000c, + 0x31b0: 0x000c, 0x31b2: 0x000c, 0x31b3: 0x000c, 0x31b5: 0x000c, + 0x31b6: 0x000c, + // Block 0xc7, offset 0x31c0 + 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fa: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3207: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3250: 0x000c, 0x3251: 0x000c, + 0x3255: 0x000c, 0x3257: 0x000c, + // Block 0xca, offset 0x3280 + 0x32b3: 0x000c, 0x32b4: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, + 0x32f6: 0x000c, 0x32f7: 0x000c, 0x32f8: 0x000c, 0x32f9: 0x000c, 0x32fa: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3302: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3355: 0x000a, 0x3356: 0x000a, 0x3357: 0x000a, + 0x3358: 0x000a, 0x3359: 0x000a, 0x335a: 0x000a, 0x335b: 0x000a, 0x335c: 0x000a, 0x335d: 0x0004, + 0x335e: 0x0004, 0x335f: 0x0004, 0x3360: 0x0004, 0x3361: 0x000a, 0x3362: 0x000a, 0x3363: 0x000a, + 0x3364: 0x000a, 0x3365: 0x000a, 0x3366: 0x000a, 0x3367: 0x000a, 0x3368: 0x000a, 0x3369: 0x000a, + 0x336a: 0x000a, 0x336b: 0x000a, 0x336c: 0x000a, 0x336d: 0x000a, 0x336e: 0x000a, 0x336f: 0x000a, + 0x3370: 0x000a, 0x3371: 0x000a, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, + 0x3387: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33f0: 0x000c, 0x33f1: 0x000c, 0x33f2: 0x000c, 0x33f3: 0x000c, 0x33f4: 0x000c, + // Block 0xd0, offset 0x3400 + 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c, + 0x3436: 0x000c, + // Block 0xd1, offset 0x3440 + 0x344f: 0x000c, + // Block 0xd2, offset 0x3480 + 0x348f: 0x000c, 0x3490: 0x000c, 0x3491: 0x000c, + 0x3492: 0x000c, + // Block 0xd3, offset 0x34c0 + 0x34e2: 0x000a, + 0x34e4: 0x000c, + // Block 0xd4, offset 0x3500 + 0x351d: 0x000c, + 0x351e: 0x000c, 0x3520: 0x000b, 0x3521: 0x000b, 0x3522: 0x000b, 0x3523: 0x000b, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000c, 0x3541: 0x000c, 0x3542: 0x000c, 0x3543: 0x000c, 0x3544: 0x000c, 0x3545: 0x000c, + 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x000c, + 0x354c: 0x000c, 0x354d: 0x000c, 0x354e: 0x000c, 0x354f: 0x000c, 0x3550: 0x000c, 0x3551: 0x000c, + 0x3552: 0x000c, 0x3553: 0x000c, 0x3554: 0x000c, 0x3555: 0x000c, 0x3556: 0x000c, 0x3557: 0x000c, + 0x3558: 0x000c, 0x3559: 0x000c, 0x355a: 0x000c, 0x355b: 0x000c, 0x355c: 0x000c, 0x355d: 0x000c, + 0x355e: 0x000c, 0x355f: 0x000c, 0x3560: 0x000c, 0x3561: 0x000c, 0x3562: 0x000c, 0x3563: 0x000c, + 0x3564: 0x000c, 0x3565: 0x000c, 0x3566: 0x000c, 0x3567: 0x000c, 0x3568: 0x000c, 0x3569: 0x000c, + 0x356a: 0x000c, 0x356b: 0x000c, 0x356c: 0x000c, 0x356d: 0x000c, + 0x3570: 0x000c, 0x3571: 0x000c, 0x3572: 0x000c, 0x3573: 0x000c, 0x3574: 0x000c, 0x3575: 0x000c, + 0x3576: 0x000c, 0x3577: 0x000c, 0x3578: 0x000c, 0x3579: 0x000c, 0x357a: 0x000c, 0x357b: 0x000c, + 0x357c: 0x000c, 0x357d: 0x000c, 0x357e: 0x000c, 0x357f: 0x000c, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000c, 0x3581: 0x000c, 0x3582: 0x000c, 0x3583: 0x000c, 0x3584: 0x000c, 0x3585: 0x000c, + 0x3586: 0x000c, + // Block 0xd7, offset 0x35c0 + 0x35e7: 0x000c, 0x35e8: 0x000c, 0x35e9: 0x000c, + 0x35f3: 0x000b, 0x35f4: 0x000b, 0x35f5: 0x000b, + 0x35f6: 0x000b, 0x35f7: 0x000b, 0x35f8: 0x000b, 0x35f9: 0x000b, 0x35fa: 0x000b, 0x35fb: 0x000c, + 0x35fc: 0x000c, 0x35fd: 0x000c, 0x35fe: 0x000c, 0x35ff: 0x000c, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000c, 0x3601: 0x000c, 0x3602: 0x000c, 0x3605: 0x000c, + 0x3606: 0x000c, 0x3607: 0x000c, 0x3608: 0x000c, 0x3609: 0x000c, 0x360a: 0x000c, 0x360b: 0x000c, + 0x362a: 0x000c, 0x362b: 0x000c, 0x362c: 0x000c, 0x362d: 0x000c, + // Block 0xd9, offset 0x3640 + 0x3669: 0x000a, + 0x366a: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000c, 0x3683: 0x000c, 0x3684: 0x000c, 0x3685: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, 0x36c8: 0x000a, 0x36c9: 0x000a, 0x36ca: 0x000a, 0x36cb: 0x000a, + 0x36cc: 0x000a, 0x36cd: 0x000a, 0x36ce: 0x000a, 0x36cf: 0x000a, 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, + // Block 0xdc, offset 0x3700 + 0x371b: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3755: 0x000a, + // Block 0xde, offset 0x3780 + 0x378f: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c9: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3803: 0x000a, + 0x380e: 0x0002, 0x380f: 0x0002, 0x3810: 0x0002, 0x3811: 0x0002, + 0x3812: 0x0002, 0x3813: 0x0002, 0x3814: 0x0002, 0x3815: 0x0002, 0x3816: 0x0002, 0x3817: 0x0002, + 0x3818: 0x0002, 0x3819: 0x0002, 0x381a: 0x0002, 0x381b: 0x0002, 0x381c: 0x0002, 0x381d: 0x0002, + 0x381e: 0x0002, 0x381f: 0x0002, 0x3820: 0x0002, 0x3821: 0x0002, 0x3822: 0x0002, 0x3823: 0x0002, + 0x3824: 0x0002, 0x3825: 0x0002, 0x3826: 0x0002, 0x3827: 0x0002, 0x3828: 0x0002, 0x3829: 0x0002, + 0x382a: 0x0002, 0x382b: 0x0002, 0x382c: 0x0002, 0x382d: 0x0002, 0x382e: 0x0002, 0x382f: 0x0002, + 0x3830: 0x0002, 0x3831: 0x0002, 0x3832: 0x0002, 0x3833: 0x0002, 0x3834: 0x0002, 0x3835: 0x0002, + 0x3836: 0x0002, 0x3837: 0x0002, 0x3838: 0x0002, 0x3839: 0x0002, 0x383a: 0x0002, 0x383b: 0x0002, + 0x383c: 0x0002, 0x383d: 0x0002, 0x383e: 0x0002, 0x383f: 0x0002, + // Block 0xe1, offset 0x3840 + 0x3840: 0x000c, 0x3841: 0x000c, 0x3842: 0x000c, 0x3843: 0x000c, 0x3844: 0x000c, 0x3845: 0x000c, + 0x3846: 0x000c, 0x3847: 0x000c, 0x3848: 0x000c, 0x3849: 0x000c, 0x384a: 0x000c, 0x384b: 0x000c, + 0x384c: 0x000c, 0x384d: 0x000c, 0x384e: 0x000c, 0x384f: 0x000c, 0x3850: 0x000c, 0x3851: 0x000c, + 0x3852: 0x000c, 0x3853: 0x000c, 0x3854: 0x000c, 0x3855: 0x000c, 0x3856: 0x000c, 0x3857: 0x000c, + 0x3858: 0x000c, 0x3859: 0x000c, 0x385a: 0x000c, 0x385b: 0x000c, 0x385c: 0x000c, 0x385d: 0x000c, + 0x385e: 0x000c, 0x385f: 0x000c, 0x3860: 0x000c, 0x3861: 0x000c, 0x3862: 0x000c, 0x3863: 0x000c, + 0x3864: 0x000c, 0x3865: 0x000c, 0x3866: 0x000c, 0x3867: 0x000c, 0x3868: 0x000c, 0x3869: 0x000c, + 0x386a: 0x000c, 0x386b: 0x000c, 0x386c: 0x000c, 0x386d: 0x000c, 0x386e: 0x000c, 0x386f: 0x000c, + 0x3870: 0x000c, 0x3871: 0x000c, 0x3872: 0x000c, 0x3873: 0x000c, 0x3874: 0x000c, 0x3875: 0x000c, + 0x3876: 0x000c, 0x387b: 0x000c, + 0x387c: 0x000c, 0x387d: 0x000c, 0x387e: 0x000c, 0x387f: 0x000c, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000c, 0x3881: 0x000c, 0x3882: 0x000c, 0x3883: 0x000c, 0x3884: 0x000c, 0x3885: 0x000c, + 0x3886: 0x000c, 0x3887: 0x000c, 0x3888: 0x000c, 0x3889: 0x000c, 0x388a: 0x000c, 0x388b: 0x000c, + 0x388c: 0x000c, 0x388d: 0x000c, 0x388e: 0x000c, 0x388f: 0x000c, 0x3890: 0x000c, 0x3891: 0x000c, + 0x3892: 0x000c, 0x3893: 0x000c, 0x3894: 0x000c, 0x3895: 0x000c, 0x3896: 0x000c, 0x3897: 0x000c, + 0x3898: 0x000c, 0x3899: 0x000c, 0x389a: 0x000c, 0x389b: 0x000c, 0x389c: 0x000c, 0x389d: 0x000c, + 0x389e: 0x000c, 0x389f: 0x000c, 0x38a0: 0x000c, 0x38a1: 0x000c, 0x38a2: 0x000c, 0x38a3: 0x000c, + 0x38a4: 0x000c, 0x38a5: 0x000c, 0x38a6: 0x000c, 0x38a7: 0x000c, 0x38a8: 0x000c, 0x38a9: 0x000c, + 0x38aa: 0x000c, 0x38ab: 0x000c, 0x38ac: 0x000c, + 0x38b5: 0x000c, + // Block 0xe3, offset 0x38c0 + 0x38c4: 0x000c, + 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + // Block 0xe4, offset 0x3900 + 0x3900: 0x000c, 0x3901: 0x000c, 0x3902: 0x000c, 0x3903: 0x000c, 0x3904: 0x000c, 0x3905: 0x000c, + 0x3906: 0x000c, 0x3908: 0x000c, 0x3909: 0x000c, 0x390a: 0x000c, 0x390b: 0x000c, + 0x390c: 0x000c, 0x390d: 0x000c, 0x390e: 0x000c, 0x390f: 0x000c, 0x3910: 0x000c, 0x3911: 0x000c, + 0x3912: 0x000c, 0x3913: 0x000c, 0x3914: 0x000c, 0x3915: 0x000c, 0x3916: 0x000c, 0x3917: 0x000c, + 0x3918: 0x000c, 0x391b: 0x000c, 0x391c: 0x000c, 0x391d: 0x000c, + 0x391e: 0x000c, 0x391f: 0x000c, 0x3920: 0x000c, 0x3921: 0x000c, 0x3923: 0x000c, + 0x3924: 0x000c, 0x3926: 0x000c, 0x3927: 0x000c, 0x3928: 0x000c, 0x3929: 0x000c, + 0x392a: 0x000c, + // Block 0xe5, offset 0x3940 + 0x396e: 0x000c, + // Block 0xe6, offset 0x3980 + 0x39ac: 0x000c, 0x39ad: 0x000c, 0x39ae: 0x000c, 0x39af: 0x000c, + 0x39bf: 0x0004, + // Block 0xe7, offset 0x39c0 + 0x39ec: 0x000c, 0x39ed: 0x000c, 0x39ee: 0x000c, 0x39ef: 0x000c, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x0001, 0x3a01: 0x0001, 0x3a02: 0x0001, 0x3a03: 0x0001, 0x3a04: 0x0001, 0x3a05: 0x0001, + 0x3a06: 0x0001, 0x3a07: 0x0001, 0x3a08: 0x0001, 0x3a09: 0x0001, 0x3a0a: 0x0001, 0x3a0b: 0x0001, + 0x3a0c: 0x0001, 0x3a0d: 0x0001, 0x3a0e: 0x0001, 0x3a0f: 0x0001, 0x3a10: 0x000c, 0x3a11: 0x000c, + 0x3a12: 0x000c, 0x3a13: 0x000c, 0x3a14: 0x000c, 0x3a15: 0x000c, 0x3a16: 0x000c, 0x3a17: 0x0001, + 0x3a18: 0x0001, 0x3a19: 0x0001, 0x3a1a: 0x0001, 0x3a1b: 0x0001, 0x3a1c: 0x0001, 0x3a1d: 0x0001, + 0x3a1e: 0x0001, 0x3a1f: 0x0001, 0x3a20: 0x0001, 0x3a21: 0x0001, 0x3a22: 0x0001, 0x3a23: 0x0001, + 0x3a24: 0x0001, 0x3a25: 0x0001, 0x3a26: 0x0001, 0x3a27: 0x0001, 0x3a28: 0x0001, 0x3a29: 0x0001, + 0x3a2a: 0x0001, 0x3a2b: 0x0001, 0x3a2c: 0x0001, 0x3a2d: 0x0001, 0x3a2e: 0x0001, 0x3a2f: 0x0001, + 0x3a30: 0x0001, 0x3a31: 0x0001, 0x3a32: 0x0001, 0x3a33: 0x0001, 0x3a34: 0x0001, 0x3a35: 0x0001, + 0x3a36: 0x0001, 0x3a37: 0x0001, 0x3a38: 0x0001, 0x3a39: 0x0001, 0x3a3a: 0x0001, 0x3a3b: 0x0001, + 0x3a3c: 0x0001, 0x3a3d: 0x0001, 0x3a3e: 0x0001, 0x3a3f: 0x0001, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x0001, 0x3a41: 0x0001, 0x3a42: 0x0001, 0x3a43: 0x0001, 0x3a44: 0x000c, 0x3a45: 0x000c, + 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x0001, + 0x3a4c: 0x0001, 0x3a4d: 0x0001, 0x3a4e: 0x0001, 0x3a4f: 0x0001, 0x3a50: 0x0001, 0x3a51: 0x0001, + 0x3a52: 0x0001, 0x3a53: 0x0001, 0x3a54: 0x0001, 0x3a55: 0x0001, 0x3a56: 0x0001, 0x3a57: 0x0001, + 0x3a58: 0x0001, 0x3a59: 0x0001, 0x3a5a: 0x0001, 0x3a5b: 0x0001, 0x3a5c: 0x0001, 0x3a5d: 0x0001, + 0x3a5e: 0x0001, 0x3a5f: 0x0001, 0x3a60: 0x0001, 0x3a61: 0x0001, 0x3a62: 0x0001, 0x3a63: 0x0001, + 0x3a64: 0x0001, 0x3a65: 0x0001, 0x3a66: 0x0001, 0x3a67: 0x0001, 0x3a68: 0x0001, 0x3a69: 0x0001, + 0x3a6a: 0x0001, 0x3a6b: 0x0001, 0x3a6c: 0x0001, 0x3a6d: 0x0001, 0x3a6e: 0x0001, 0x3a6f: 0x0001, + 0x3a70: 0x0001, 0x3a71: 0x0001, 0x3a72: 0x0001, 0x3a73: 0x0001, 0x3a74: 0x0001, 0x3a75: 0x0001, + 0x3a76: 0x0001, 0x3a77: 0x0001, 0x3a78: 0x0001, 0x3a79: 0x0001, 0x3a7a: 0x0001, 0x3a7b: 0x0001, + 0x3a7c: 0x0001, 0x3a7d: 0x0001, 0x3a7e: 0x0001, 0x3a7f: 0x0001, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x0001, 0x3a81: 0x0001, 0x3a82: 0x0001, 0x3a83: 0x0001, 0x3a84: 0x0001, 0x3a85: 0x0001, + 0x3a86: 0x0001, 0x3a87: 0x0001, 0x3a88: 0x0001, 0x3a89: 0x0001, 0x3a8a: 0x0001, 0x3a8b: 0x0001, + 0x3a8c: 0x0001, 0x3a8d: 0x0001, 0x3a8e: 0x0001, 0x3a8f: 0x0001, 0x3a90: 0x0001, 0x3a91: 0x0001, + 0x3a92: 0x0001, 0x3a93: 0x0001, 0x3a94: 0x0001, 0x3a95: 0x0001, 0x3a96: 0x0001, 0x3a97: 0x0001, + 0x3a98: 0x0001, 0x3a99: 0x0001, 0x3a9a: 0x0001, 0x3a9b: 0x0001, 0x3a9c: 0x0001, 0x3a9d: 0x0001, + 0x3a9e: 0x0001, 0x3a9f: 0x0001, 0x3aa0: 0x0001, 0x3aa1: 0x0001, 0x3aa2: 0x0001, 0x3aa3: 0x0001, + 0x3aa4: 0x0001, 0x3aa5: 0x0001, 0x3aa6: 0x0001, 0x3aa7: 0x0001, 0x3aa8: 0x0001, 0x3aa9: 0x0001, + 0x3aaa: 0x0001, 0x3aab: 0x0001, 0x3aac: 0x0001, 0x3aad: 0x0001, 0x3aae: 0x0001, 0x3aaf: 0x0001, + 0x3ab0: 0x0001, 0x3ab1: 0x000d, 0x3ab2: 0x000d, 0x3ab3: 0x000d, 0x3ab4: 0x000d, 0x3ab5: 0x000d, + 0x3ab6: 0x000d, 0x3ab7: 0x000d, 0x3ab8: 0x000d, 0x3ab9: 0x000d, 0x3aba: 0x000d, 0x3abb: 0x000d, + 0x3abc: 0x000d, 0x3abd: 0x000d, 0x3abe: 0x000d, 0x3abf: 0x000d, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x000d, 0x3ac1: 0x000d, 0x3ac2: 0x000d, 0x3ac3: 0x000d, 0x3ac4: 0x000d, 0x3ac5: 0x000d, + 0x3ac6: 0x000d, 0x3ac7: 0x000d, 0x3ac8: 0x000d, 0x3ac9: 0x000d, 0x3aca: 0x000d, 0x3acb: 0x000d, + 0x3acc: 0x000d, 0x3acd: 0x000d, 0x3ace: 0x000d, 0x3acf: 0x000d, 0x3ad0: 0x000d, 0x3ad1: 0x000d, + 0x3ad2: 0x000d, 0x3ad3: 0x000d, 0x3ad4: 0x000d, 0x3ad5: 0x000d, 0x3ad6: 0x000d, 0x3ad7: 0x000d, + 0x3ad8: 0x000d, 0x3ad9: 0x000d, 0x3ada: 0x000d, 0x3adb: 0x000d, 0x3adc: 0x000d, 0x3add: 0x000d, + 0x3ade: 0x000d, 0x3adf: 0x000d, 0x3ae0: 0x000d, 0x3ae1: 0x000d, 0x3ae2: 0x000d, 0x3ae3: 0x000d, + 0x3ae4: 0x000d, 0x3ae5: 0x000d, 0x3ae6: 0x000d, 0x3ae7: 0x000d, 0x3ae8: 0x000d, 0x3ae9: 0x000d, + 0x3aea: 0x000d, 0x3aeb: 0x000d, 0x3aec: 0x000d, 0x3aed: 0x000d, 0x3aee: 0x000d, 0x3aef: 0x000d, + 0x3af0: 0x000d, 0x3af1: 0x000d, 0x3af2: 0x000d, 0x3af3: 0x000d, 0x3af4: 0x000d, 0x3af5: 0x0001, + 0x3af6: 0x0001, 0x3af7: 0x0001, 0x3af8: 0x0001, 0x3af9: 0x0001, 0x3afa: 0x0001, 0x3afb: 0x0001, + 0x3afc: 0x0001, 0x3afd: 0x0001, 0x3afe: 0x0001, 0x3aff: 0x0001, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x0001, 0x3b01: 0x000d, 0x3b02: 0x000d, 0x3b03: 0x000d, 0x3b04: 0x000d, 0x3b05: 0x000d, + 0x3b06: 0x000d, 0x3b07: 0x000d, 0x3b08: 0x000d, 0x3b09: 0x000d, 0x3b0a: 0x000d, 0x3b0b: 0x000d, + 0x3b0c: 0x000d, 0x3b0d: 0x000d, 0x3b0e: 0x000d, 0x3b0f: 0x000d, 0x3b10: 0x000d, 0x3b11: 0x000d, + 0x3b12: 0x000d, 0x3b13: 0x000d, 0x3b14: 0x000d, 0x3b15: 0x000d, 0x3b16: 0x000d, 0x3b17: 0x000d, + 0x3b18: 0x000d, 0x3b19: 0x000d, 0x3b1a: 0x000d, 0x3b1b: 0x000d, 0x3b1c: 0x000d, 0x3b1d: 0x000d, + 0x3b1e: 0x000d, 0x3b1f: 0x000d, 0x3b20: 0x000d, 0x3b21: 0x000d, 0x3b22: 0x000d, 0x3b23: 0x000d, + 0x3b24: 0x000d, 0x3b25: 0x000d, 0x3b26: 0x000d, 0x3b27: 0x000d, 0x3b28: 0x000d, 0x3b29: 0x000d, + 0x3b2a: 0x000d, 0x3b2b: 0x000d, 0x3b2c: 0x000d, 0x3b2d: 0x000d, 0x3b2e: 0x000d, 0x3b2f: 0x000d, + 0x3b30: 0x000d, 0x3b31: 0x000d, 0x3b32: 0x000d, 0x3b33: 0x000d, 0x3b34: 0x000d, 0x3b35: 0x000d, + 0x3b36: 0x000d, 0x3b37: 0x000d, 0x3b38: 0x000d, 0x3b39: 0x000d, 0x3b3a: 0x000d, 0x3b3b: 0x000d, + 0x3b3c: 0x000d, 0x3b3d: 0x000d, 0x3b3e: 0x0001, 0x3b3f: 0x0001, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x000d, 0x3b41: 0x000d, 0x3b42: 0x000d, 0x3b43: 0x000d, 0x3b44: 0x000d, 0x3b45: 0x000d, + 0x3b46: 0x000d, 0x3b47: 0x000d, 0x3b48: 0x000d, 0x3b49: 0x000d, 0x3b4a: 0x000d, 0x3b4b: 0x000d, + 0x3b4c: 0x000d, 0x3b4d: 0x000d, 0x3b4e: 0x000d, 0x3b4f: 0x000d, 0x3b50: 0x000d, 0x3b51: 0x000d, + 0x3b52: 0x000d, 0x3b53: 0x000d, 0x3b54: 0x000d, 0x3b55: 0x000d, 0x3b56: 0x000d, 0x3b57: 0x000d, + 0x3b58: 0x000d, 0x3b59: 0x000d, 0x3b5a: 0x000d, 0x3b5b: 0x000d, 0x3b5c: 0x000d, 0x3b5d: 0x000d, + 0x3b5e: 0x000d, 0x3b5f: 0x000d, 0x3b60: 0x000d, 0x3b61: 0x000d, 0x3b62: 0x000d, 0x3b63: 0x000d, + 0x3b64: 0x000d, 0x3b65: 0x000d, 0x3b66: 0x000d, 0x3b67: 0x000d, 0x3b68: 0x000d, 0x3b69: 0x000d, + 0x3b6a: 0x000d, 0x3b6b: 0x000d, 0x3b6c: 0x000d, 0x3b6d: 0x000d, 0x3b6e: 0x000d, 0x3b6f: 0x000d, + 0x3b70: 0x000a, 0x3b71: 0x000a, 0x3b72: 0x000d, 0x3b73: 0x000d, 0x3b74: 0x000d, 0x3b75: 0x000d, + 0x3b76: 0x000d, 0x3b77: 0x000d, 0x3b78: 0x000d, 0x3b79: 0x000d, 0x3b7a: 0x000d, 0x3b7b: 0x000d, + 0x3b7c: 0x000d, 0x3b7d: 0x000d, 0x3b7e: 0x000d, 0x3b7f: 0x000d, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x000a, 0x3b81: 0x000a, 0x3b82: 0x000a, 0x3b83: 0x000a, 0x3b84: 0x000a, 0x3b85: 0x000a, + 0x3b86: 0x000a, 0x3b87: 0x000a, 0x3b88: 0x000a, 0x3b89: 0x000a, 0x3b8a: 0x000a, 0x3b8b: 0x000a, + 0x3b8c: 0x000a, 0x3b8d: 0x000a, 0x3b8e: 0x000a, 0x3b8f: 0x000a, 0x3b90: 0x000a, 0x3b91: 0x000a, + 0x3b92: 0x000a, 0x3b93: 0x000a, 0x3b94: 0x000a, 0x3b95: 0x000a, 0x3b96: 0x000a, 0x3b97: 0x000a, + 0x3b98: 0x000a, 0x3b99: 0x000a, 0x3b9a: 0x000a, 0x3b9b: 0x000a, 0x3b9c: 0x000a, 0x3b9d: 0x000a, + 0x3b9e: 0x000a, 0x3b9f: 0x000a, 0x3ba0: 0x000a, 0x3ba1: 0x000a, 0x3ba2: 0x000a, 0x3ba3: 0x000a, + 0x3ba4: 0x000a, 0x3ba5: 0x000a, 0x3ba6: 0x000a, 0x3ba7: 0x000a, 0x3ba8: 0x000a, 0x3ba9: 0x000a, + 0x3baa: 0x000a, 0x3bab: 0x000a, + 0x3bb0: 0x000a, 0x3bb1: 0x000a, 0x3bb2: 0x000a, 0x3bb3: 0x000a, 0x3bb4: 0x000a, 0x3bb5: 0x000a, + 0x3bb6: 0x000a, 0x3bb7: 0x000a, 0x3bb8: 0x000a, 0x3bb9: 0x000a, 0x3bba: 0x000a, 0x3bbb: 0x000a, + 0x3bbc: 0x000a, 0x3bbd: 0x000a, 0x3bbe: 0x000a, 0x3bbf: 0x000a, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x000a, 0x3bc1: 0x000a, 0x3bc2: 0x000a, 0x3bc3: 0x000a, 0x3bc4: 0x000a, 0x3bc5: 0x000a, + 0x3bc6: 0x000a, 0x3bc7: 0x000a, 0x3bc8: 0x000a, 0x3bc9: 0x000a, 0x3bca: 0x000a, 0x3bcb: 0x000a, + 0x3bcc: 0x000a, 0x3bcd: 0x000a, 0x3bce: 0x000a, 0x3bcf: 0x000a, 0x3bd0: 0x000a, 0x3bd1: 0x000a, + 0x3bd2: 0x000a, 0x3bd3: 0x000a, + 0x3be0: 0x000a, 0x3be1: 0x000a, 0x3be2: 0x000a, 0x3be3: 0x000a, + 0x3be4: 0x000a, 0x3be5: 0x000a, 0x3be6: 0x000a, 0x3be7: 0x000a, 0x3be8: 0x000a, 0x3be9: 0x000a, + 0x3bea: 0x000a, 0x3beb: 0x000a, 0x3bec: 0x000a, 0x3bed: 0x000a, 0x3bee: 0x000a, + 0x3bf1: 0x000a, 0x3bf2: 0x000a, 0x3bf3: 0x000a, 0x3bf4: 0x000a, 0x3bf5: 0x000a, + 0x3bf6: 0x000a, 0x3bf7: 0x000a, 0x3bf8: 0x000a, 0x3bf9: 0x000a, 0x3bfa: 0x000a, 0x3bfb: 0x000a, + 0x3bfc: 0x000a, 0x3bfd: 0x000a, 0x3bfe: 0x000a, 0x3bff: 0x000a, + // Block 0xf0, offset 0x3c00 + 0x3c01: 0x000a, 0x3c02: 0x000a, 0x3c03: 0x000a, 0x3c04: 0x000a, 0x3c05: 0x000a, + 0x3c06: 0x000a, 0x3c07: 0x000a, 0x3c08: 0x000a, 0x3c09: 0x000a, 0x3c0a: 0x000a, 0x3c0b: 0x000a, + 0x3c0c: 0x000a, 0x3c0d: 0x000a, 0x3c0e: 0x000a, 0x3c0f: 0x000a, 0x3c11: 0x000a, + 0x3c12: 0x000a, 0x3c13: 0x000a, 0x3c14: 0x000a, 0x3c15: 0x000a, 0x3c16: 0x000a, 0x3c17: 0x000a, + 0x3c18: 0x000a, 0x3c19: 0x000a, 0x3c1a: 0x000a, 0x3c1b: 0x000a, 0x3c1c: 0x000a, 0x3c1d: 0x000a, + 0x3c1e: 0x000a, 0x3c1f: 0x000a, 0x3c20: 0x000a, 0x3c21: 0x000a, 0x3c22: 0x000a, 0x3c23: 0x000a, + 0x3c24: 0x000a, 0x3c25: 0x000a, 0x3c26: 0x000a, 0x3c27: 0x000a, 0x3c28: 0x000a, 0x3c29: 0x000a, + 0x3c2a: 0x000a, 0x3c2b: 0x000a, 0x3c2c: 0x000a, 0x3c2d: 0x000a, 0x3c2e: 0x000a, 0x3c2f: 0x000a, + 0x3c30: 0x000a, 0x3c31: 0x000a, 0x3c32: 0x000a, 0x3c33: 0x000a, 0x3c34: 0x000a, 0x3c35: 0x000a, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x0002, 0x3c41: 0x0002, 0x3c42: 0x0002, 0x3c43: 0x0002, 0x3c44: 0x0002, 0x3c45: 0x0002, + 0x3c46: 0x0002, 0x3c47: 0x0002, 0x3c48: 0x0002, 0x3c49: 0x0002, 0x3c4a: 0x0002, 0x3c4b: 0x000a, + 0x3c4c: 0x000a, 0x3c4d: 0x000a, 0x3c4e: 0x000a, 0x3c4f: 0x000a, + 0x3c6f: 0x000a, + // Block 0xf2, offset 0x3c80 + 0x3caa: 0x000a, 0x3cab: 0x000a, 0x3cac: 0x000a, 0x3cad: 0x000a, 0x3cae: 0x000a, 0x3caf: 0x000a, + // Block 0xf3, offset 0x3cc0 + 0x3ced: 0x000a, + // Block 0xf4, offset 0x3d00 + 0x3d20: 0x000a, 0x3d21: 0x000a, 0x3d22: 0x000a, 0x3d23: 0x000a, + 0x3d24: 0x000a, 0x3d25: 0x000a, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x000a, 0x3d41: 0x000a, 0x3d42: 0x000a, 0x3d43: 0x000a, 0x3d44: 0x000a, 0x3d45: 0x000a, + 0x3d46: 0x000a, 0x3d47: 0x000a, 0x3d48: 0x000a, 0x3d49: 0x000a, 0x3d4a: 0x000a, 0x3d4b: 0x000a, + 0x3d4c: 0x000a, 0x3d4d: 0x000a, 0x3d4e: 0x000a, 0x3d4f: 0x000a, 0x3d50: 0x000a, 0x3d51: 0x000a, + 0x3d52: 0x000a, 0x3d53: 0x000a, 0x3d54: 0x000a, 0x3d55: 0x000a, 0x3d56: 0x000a, 0x3d57: 0x000a, + 0x3d5c: 0x000a, 0x3d5d: 0x000a, + 0x3d5e: 0x000a, 0x3d5f: 0x000a, 0x3d60: 0x000a, 0x3d61: 0x000a, 0x3d62: 0x000a, 0x3d63: 0x000a, + 0x3d64: 0x000a, 0x3d65: 0x000a, 0x3d66: 0x000a, 0x3d67: 0x000a, 0x3d68: 0x000a, 0x3d69: 0x000a, + 0x3d6a: 0x000a, 0x3d6b: 0x000a, 0x3d6c: 0x000a, + 0x3d70: 0x000a, 0x3d71: 0x000a, 0x3d72: 0x000a, 0x3d73: 0x000a, 0x3d74: 0x000a, 0x3d75: 0x000a, + 0x3d76: 0x000a, 0x3d77: 0x000a, 0x3d78: 0x000a, 0x3d79: 0x000a, 0x3d7a: 0x000a, 0x3d7b: 0x000a, + 0x3d7c: 0x000a, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x000a, 0x3d81: 0x000a, 0x3d82: 0x000a, 0x3d83: 0x000a, 0x3d84: 0x000a, 0x3d85: 0x000a, + 0x3d86: 0x000a, 0x3d87: 0x000a, 0x3d88: 0x000a, 0x3d89: 0x000a, 0x3d8a: 0x000a, 0x3d8b: 0x000a, + 0x3d8c: 0x000a, 0x3d8d: 0x000a, 0x3d8e: 0x000a, 0x3d8f: 0x000a, 0x3d90: 0x000a, 0x3d91: 0x000a, + 0x3d92: 0x000a, 0x3d93: 0x000a, 0x3d94: 0x000a, 0x3d95: 0x000a, 0x3d96: 0x000a, 0x3d97: 0x000a, + 0x3d98: 0x000a, 0x3d99: 0x000a, 0x3d9a: 0x000a, 0x3d9b: 0x000a, 0x3d9c: 0x000a, 0x3d9d: 0x000a, + 0x3d9e: 0x000a, 0x3d9f: 0x000a, 0x3da0: 0x000a, 0x3da1: 0x000a, 0x3da2: 0x000a, 0x3da3: 0x000a, + 0x3da4: 0x000a, 0x3da5: 0x000a, 0x3da6: 0x000a, 0x3da7: 0x000a, 0x3da8: 0x000a, 0x3da9: 0x000a, + 0x3daa: 0x000a, 0x3dab: 0x000a, 0x3dac: 0x000a, 0x3dad: 0x000a, 0x3dae: 0x000a, 0x3daf: 0x000a, + 0x3db0: 0x000a, 0x3db1: 0x000a, 0x3db2: 0x000a, 0x3db3: 0x000a, 0x3db4: 0x000a, 0x3db5: 0x000a, + 0x3db6: 0x000a, 0x3dbb: 0x000a, + 0x3dbc: 0x000a, 0x3dbd: 0x000a, 0x3dbe: 0x000a, 0x3dbf: 0x000a, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x000a, 0x3dc1: 0x000a, 0x3dc2: 0x000a, 0x3dc3: 0x000a, 0x3dc4: 0x000a, 0x3dc5: 0x000a, + 0x3dc6: 0x000a, 0x3dc7: 0x000a, 0x3dc8: 0x000a, 0x3dc9: 0x000a, 0x3dca: 0x000a, 0x3dcb: 0x000a, + 0x3dcc: 0x000a, 0x3dcd: 0x000a, 0x3dce: 0x000a, 0x3dcf: 0x000a, 0x3dd0: 0x000a, 0x3dd1: 0x000a, + 0x3dd2: 0x000a, 0x3dd3: 0x000a, 0x3dd4: 0x000a, 0x3dd5: 0x000a, 0x3dd6: 0x000a, 0x3dd7: 0x000a, + 0x3dd8: 0x000a, 0x3dd9: 0x000a, + 0x3de0: 0x000a, 0x3de1: 0x000a, 0x3de2: 0x000a, 0x3de3: 0x000a, + 0x3de4: 0x000a, 0x3de5: 0x000a, 0x3de6: 0x000a, 0x3de7: 0x000a, 0x3de8: 0x000a, 0x3de9: 0x000a, + 0x3dea: 0x000a, 0x3deb: 0x000a, + 0x3df0: 0x000a, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x000a, 0x3e01: 0x000a, 0x3e02: 0x000a, 0x3e03: 0x000a, 0x3e04: 0x000a, 0x3e05: 0x000a, + 0x3e06: 0x000a, 0x3e07: 0x000a, 0x3e08: 0x000a, 0x3e09: 0x000a, 0x3e0a: 0x000a, 0x3e0b: 0x000a, + 0x3e10: 0x000a, 0x3e11: 0x000a, + 0x3e12: 0x000a, 0x3e13: 0x000a, 0x3e14: 0x000a, 0x3e15: 0x000a, 0x3e16: 0x000a, 0x3e17: 0x000a, + 0x3e18: 0x000a, 0x3e19: 0x000a, 0x3e1a: 0x000a, 0x3e1b: 0x000a, 0x3e1c: 0x000a, 0x3e1d: 0x000a, + 0x3e1e: 0x000a, 0x3e1f: 0x000a, 0x3e20: 0x000a, 0x3e21: 0x000a, 0x3e22: 0x000a, 0x3e23: 0x000a, + 0x3e24: 0x000a, 0x3e25: 0x000a, 0x3e26: 0x000a, 0x3e27: 0x000a, 0x3e28: 0x000a, 0x3e29: 0x000a, + 0x3e2a: 0x000a, 0x3e2b: 0x000a, 0x3e2c: 0x000a, 0x3e2d: 0x000a, 0x3e2e: 0x000a, 0x3e2f: 0x000a, + 0x3e30: 0x000a, 0x3e31: 0x000a, 0x3e32: 0x000a, 0x3e33: 0x000a, 0x3e34: 0x000a, 0x3e35: 0x000a, + 0x3e36: 0x000a, 0x3e37: 0x000a, 0x3e38: 0x000a, 0x3e39: 0x000a, 0x3e3a: 0x000a, 0x3e3b: 0x000a, + 0x3e3c: 0x000a, 0x3e3d: 0x000a, 0x3e3e: 0x000a, 0x3e3f: 0x000a, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x000a, 0x3e41: 0x000a, 0x3e42: 0x000a, 0x3e43: 0x000a, 0x3e44: 0x000a, 0x3e45: 0x000a, + 0x3e46: 0x000a, 0x3e47: 0x000a, + 0x3e50: 0x000a, 0x3e51: 0x000a, + 0x3e52: 0x000a, 0x3e53: 0x000a, 0x3e54: 0x000a, 0x3e55: 0x000a, 0x3e56: 0x000a, 0x3e57: 0x000a, + 0x3e58: 0x000a, 0x3e59: 0x000a, + 0x3e60: 0x000a, 0x3e61: 0x000a, 0x3e62: 0x000a, 0x3e63: 0x000a, + 0x3e64: 0x000a, 0x3e65: 0x000a, 0x3e66: 0x000a, 0x3e67: 0x000a, 0x3e68: 0x000a, 0x3e69: 0x000a, + 0x3e6a: 0x000a, 0x3e6b: 0x000a, 0x3e6c: 0x000a, 0x3e6d: 0x000a, 0x3e6e: 0x000a, 0x3e6f: 0x000a, + 0x3e70: 0x000a, 0x3e71: 0x000a, 0x3e72: 0x000a, 0x3e73: 0x000a, 0x3e74: 0x000a, 0x3e75: 0x000a, + 0x3e76: 0x000a, 0x3e77: 0x000a, 0x3e78: 0x000a, 0x3e79: 0x000a, 0x3e7a: 0x000a, 0x3e7b: 0x000a, + 0x3e7c: 0x000a, 0x3e7d: 0x000a, 0x3e7e: 0x000a, 0x3e7f: 0x000a, + // Block 0xfa, offset 0x3e80 + 0x3e80: 0x000a, 0x3e81: 0x000a, 0x3e82: 0x000a, 0x3e83: 0x000a, 0x3e84: 0x000a, 0x3e85: 0x000a, + 0x3e86: 0x000a, 0x3e87: 0x000a, + 0x3e90: 0x000a, 0x3e91: 0x000a, + 0x3e92: 0x000a, 0x3e93: 0x000a, 0x3e94: 0x000a, 0x3e95: 0x000a, 0x3e96: 0x000a, 0x3e97: 0x000a, + 0x3e98: 0x000a, 0x3e99: 0x000a, 0x3e9a: 0x000a, 0x3e9b: 0x000a, 0x3e9c: 0x000a, 0x3e9d: 0x000a, + 0x3e9e: 0x000a, 0x3e9f: 0x000a, 0x3ea0: 0x000a, 0x3ea1: 0x000a, 0x3ea2: 0x000a, 0x3ea3: 0x000a, + 0x3ea4: 0x000a, 0x3ea5: 0x000a, 0x3ea6: 0x000a, 0x3ea7: 0x000a, 0x3ea8: 0x000a, 0x3ea9: 0x000a, + 0x3eaa: 0x000a, 0x3eab: 0x000a, 0x3eac: 0x000a, 0x3ead: 0x000a, + 0x3eb0: 0x000a, 0x3eb1: 0x000a, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x000a, 0x3ec1: 0x000a, 0x3ec2: 0x000a, 0x3ec3: 0x000a, 0x3ec4: 0x000a, 0x3ec5: 0x000a, + 0x3ec6: 0x000a, 0x3ec7: 0x000a, 0x3ec8: 0x000a, 0x3ec9: 0x000a, 0x3eca: 0x000a, 0x3ecb: 0x000a, + 0x3ecc: 0x000a, 0x3ecd: 0x000a, 0x3ece: 0x000a, 0x3ecf: 0x000a, 0x3ed0: 0x000a, 0x3ed1: 0x000a, + 0x3ed2: 0x000a, 0x3ed3: 0x000a, + 0x3ee0: 0x000a, 0x3ee1: 0x000a, 0x3ee2: 0x000a, 0x3ee3: 0x000a, + 0x3ee4: 0x000a, 0x3ee5: 0x000a, 0x3ee6: 0x000a, 0x3ee7: 0x000a, 0x3ee8: 0x000a, 0x3ee9: 0x000a, + 0x3eea: 0x000a, 0x3eeb: 0x000a, 0x3eec: 0x000a, 0x3eed: 0x000a, + 0x3ef0: 0x000a, 0x3ef1: 0x000a, 0x3ef2: 0x000a, 0x3ef3: 0x000a, 0x3ef4: 0x000a, 0x3ef5: 0x000a, + 0x3ef6: 0x000a, 0x3ef7: 0x000a, 0x3ef8: 0x000a, 0x3ef9: 0x000a, 0x3efa: 0x000a, 0x3efb: 0x000a, + 0x3efc: 0x000a, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x000a, 0x3f01: 0x000a, 0x3f02: 0x000a, 0x3f03: 0x000a, 0x3f04: 0x000a, 0x3f05: 0x000a, + 0x3f06: 0x000a, 0x3f07: 0x000a, 0x3f08: 0x000a, + 0x3f10: 0x000a, 0x3f11: 0x000a, + 0x3f12: 0x000a, 0x3f13: 0x000a, 0x3f14: 0x000a, 0x3f15: 0x000a, 0x3f16: 0x000a, 0x3f17: 0x000a, + 0x3f18: 0x000a, 0x3f19: 0x000a, 0x3f1a: 0x000a, 0x3f1b: 0x000a, 0x3f1c: 0x000a, 0x3f1d: 0x000a, + 0x3f1e: 0x000a, 0x3f1f: 0x000a, 0x3f20: 0x000a, 0x3f21: 0x000a, 0x3f22: 0x000a, 0x3f23: 0x000a, + 0x3f24: 0x000a, 0x3f25: 0x000a, 0x3f26: 0x000a, 0x3f27: 0x000a, 0x3f28: 0x000a, 0x3f29: 0x000a, + 0x3f2a: 0x000a, 0x3f2b: 0x000a, 0x3f2c: 0x000a, 0x3f2d: 0x000a, 0x3f2e: 0x000a, 0x3f2f: 0x000a, + 0x3f30: 0x000a, 0x3f31: 0x000a, 0x3f32: 0x000a, 0x3f33: 0x000a, 0x3f34: 0x000a, 0x3f35: 0x000a, + 0x3f36: 0x000a, 0x3f37: 0x000a, 0x3f38: 0x000a, 0x3f39: 0x000a, 0x3f3a: 0x000a, 0x3f3b: 0x000a, + 0x3f3c: 0x000a, 0x3f3d: 0x000a, 0x3f3f: 0x000a, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x000a, 0x3f41: 0x000a, 0x3f42: 0x000a, 0x3f43: 0x000a, 0x3f44: 0x000a, 0x3f45: 0x000a, + 0x3f4e: 0x000a, 0x3f4f: 0x000a, 0x3f50: 0x000a, 0x3f51: 0x000a, + 0x3f52: 0x000a, 0x3f53: 0x000a, 0x3f54: 0x000a, 0x3f55: 0x000a, 0x3f56: 0x000a, 0x3f57: 0x000a, + 0x3f58: 0x000a, 0x3f59: 0x000a, 0x3f5a: 0x000a, 0x3f5b: 0x000a, + 0x3f60: 0x000a, 0x3f61: 0x000a, 0x3f62: 0x000a, 0x3f63: 0x000a, + 0x3f64: 0x000a, 0x3f65: 0x000a, 0x3f66: 0x000a, 0x3f67: 0x000a, 0x3f68: 0x000a, + 0x3f70: 0x000a, 0x3f71: 0x000a, 0x3f72: 0x000a, 0x3f73: 0x000a, 0x3f74: 0x000a, 0x3f75: 0x000a, + 0x3f76: 0x000a, 0x3f77: 0x000a, 0x3f78: 0x000a, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x000a, 0x3f81: 0x000a, 0x3f82: 0x000a, 0x3f83: 0x000a, 0x3f84: 0x000a, 0x3f85: 0x000a, + 0x3f86: 0x000a, 0x3f87: 0x000a, 0x3f88: 0x000a, 0x3f89: 0x000a, 0x3f8a: 0x000a, 0x3f8b: 0x000a, + 0x3f8c: 0x000a, 0x3f8d: 0x000a, 0x3f8e: 0x000a, 0x3f8f: 0x000a, 0x3f90: 0x000a, 0x3f91: 0x000a, + 0x3f92: 0x000a, 0x3f94: 0x000a, 0x3f95: 0x000a, 0x3f96: 0x000a, 0x3f97: 0x000a, + 0x3f98: 0x000a, 0x3f99: 0x000a, 0x3f9a: 0x000a, 0x3f9b: 0x000a, 0x3f9c: 0x000a, 0x3f9d: 0x000a, + 0x3f9e: 0x000a, 0x3f9f: 0x000a, 0x3fa0: 0x000a, 0x3fa1: 0x000a, 0x3fa2: 0x000a, 0x3fa3: 0x000a, + 0x3fa4: 0x000a, 0x3fa5: 0x000a, 0x3fa6: 0x000a, 0x3fa7: 0x000a, 0x3fa8: 0x000a, 0x3fa9: 0x000a, + 0x3faa: 0x000a, 0x3fab: 0x000a, 0x3fac: 0x000a, 0x3fad: 0x000a, 0x3fae: 0x000a, 0x3faf: 0x000a, + 0x3fb0: 0x000a, 0x3fb1: 0x000a, 0x3fb2: 0x000a, 0x3fb3: 0x000a, 0x3fb4: 0x000a, 0x3fb5: 0x000a, + 0x3fb6: 0x000a, 0x3fb7: 0x000a, 0x3fb8: 0x000a, 0x3fb9: 0x000a, 0x3fba: 0x000a, 0x3fbb: 0x000a, + 0x3fbc: 0x000a, 0x3fbd: 0x000a, 0x3fbe: 0x000a, 0x3fbf: 0x000a, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x000a, 0x3fc1: 0x000a, 0x3fc2: 0x000a, 0x3fc3: 0x000a, 0x3fc4: 0x000a, 0x3fc5: 0x000a, + 0x3fc6: 0x000a, 0x3fc7: 0x000a, 0x3fc8: 0x000a, 0x3fc9: 0x000a, 0x3fca: 0x000a, + 0x3ff0: 0x0002, 0x3ff1: 0x0002, 0x3ff2: 0x0002, 0x3ff3: 0x0002, 0x3ff4: 0x0002, 0x3ff5: 0x0002, + 0x3ff6: 0x0002, 0x3ff7: 0x0002, 0x3ff8: 0x0002, 0x3ff9: 0x0002, + // Block 0x100, offset 0x4000 + 0x403e: 0x000b, 0x403f: 0x000b, + // Block 0x101, offset 0x4040 + 0x4040: 0x000b, 0x4041: 0x000b, 0x4042: 0x000b, 0x4043: 0x000b, 0x4044: 0x000b, 0x4045: 0x000b, + 0x4046: 0x000b, 0x4047: 0x000b, 0x4048: 0x000b, 0x4049: 0x000b, 0x404a: 0x000b, 0x404b: 0x000b, + 0x404c: 0x000b, 0x404d: 0x000b, 0x404e: 0x000b, 0x404f: 0x000b, 0x4050: 0x000b, 0x4051: 0x000b, + 0x4052: 0x000b, 0x4053: 0x000b, 0x4054: 0x000b, 0x4055: 0x000b, 0x4056: 0x000b, 0x4057: 0x000b, + 0x4058: 0x000b, 0x4059: 0x000b, 0x405a: 0x000b, 0x405b: 0x000b, 0x405c: 0x000b, 0x405d: 0x000b, + 0x405e: 0x000b, 0x405f: 0x000b, 0x4060: 0x000b, 0x4061: 0x000b, 0x4062: 0x000b, 0x4063: 0x000b, + 0x4064: 0x000b, 0x4065: 0x000b, 0x4066: 0x000b, 0x4067: 0x000b, 0x4068: 0x000b, 0x4069: 0x000b, + 0x406a: 0x000b, 0x406b: 0x000b, 0x406c: 0x000b, 0x406d: 0x000b, 0x406e: 0x000b, 0x406f: 0x000b, + 0x4070: 0x000b, 0x4071: 0x000b, 0x4072: 0x000b, 0x4073: 0x000b, 0x4074: 0x000b, 0x4075: 0x000b, + 0x4076: 0x000b, 0x4077: 0x000b, 0x4078: 0x000b, 0x4079: 0x000b, 0x407a: 0x000b, 0x407b: 0x000b, + 0x407c: 0x000b, 0x407d: 0x000b, 0x407e: 0x000b, 0x407f: 0x000b, + // Block 0x102, offset 0x4080 + 0x4080: 0x000c, 0x4081: 0x000c, 0x4082: 0x000c, 0x4083: 0x000c, 0x4084: 0x000c, 0x4085: 0x000c, + 0x4086: 0x000c, 0x4087: 0x000c, 0x4088: 0x000c, 0x4089: 0x000c, 0x408a: 0x000c, 0x408b: 0x000c, + 0x408c: 0x000c, 0x408d: 0x000c, 0x408e: 0x000c, 0x408f: 0x000c, 0x4090: 0x000c, 0x4091: 0x000c, + 0x4092: 0x000c, 0x4093: 0x000c, 0x4094: 0x000c, 0x4095: 0x000c, 0x4096: 0x000c, 0x4097: 0x000c, + 0x4098: 0x000c, 0x4099: 0x000c, 0x409a: 0x000c, 0x409b: 0x000c, 0x409c: 0x000c, 0x409d: 0x000c, + 0x409e: 0x000c, 0x409f: 0x000c, 0x40a0: 0x000c, 0x40a1: 0x000c, 0x40a2: 0x000c, 0x40a3: 0x000c, + 0x40a4: 0x000c, 0x40a5: 0x000c, 0x40a6: 0x000c, 0x40a7: 0x000c, 0x40a8: 0x000c, 0x40a9: 0x000c, + 0x40aa: 0x000c, 0x40ab: 0x000c, 0x40ac: 0x000c, 0x40ad: 0x000c, 0x40ae: 0x000c, 0x40af: 0x000c, + 0x40b0: 0x000b, 0x40b1: 0x000b, 0x40b2: 0x000b, 0x40b3: 0x000b, 0x40b4: 0x000b, 0x40b5: 0x000b, + 0x40b6: 0x000b, 0x40b7: 0x000b, 0x40b8: 0x000b, 0x40b9: 0x000b, 0x40ba: 0x000b, 0x40bb: 0x000b, + 0x40bc: 0x000b, 0x40bd: 0x000b, 0x40be: 0x000b, 0x40bf: 0x000b, +} + +// bidiIndex: 26 blocks, 1664 entries, 3328 bytes +// Block 0 is the zero block. +var bidiIndex = [1664]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x13, 0xf1: 0x14, 0xf2: 0x14, 0xf3: 0x16, 0xf4: 0x17, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x136: 0x28, 0x137: 0x29, + 0x138: 0x2a, 0x139: 0x2b, 0x13a: 0x2c, 0x13b: 0x2d, 0x13c: 0x2e, 0x13d: 0x2f, 0x13e: 0x30, 0x13f: 0x31, + // Block 0x5, offset 0x140 + 0x140: 0x32, 0x141: 0x33, 0x142: 0x34, + 0x14d: 0x35, 0x14e: 0x36, + 0x150: 0x37, + 0x15a: 0x38, 0x15c: 0x39, 0x15d: 0x3a, 0x15e: 0x3b, 0x15f: 0x3c, + 0x160: 0x3d, 0x162: 0x3e, 0x164: 0x3f, 0x165: 0x40, 0x167: 0x41, + 0x168: 0x42, 0x169: 0x43, 0x16a: 0x44, 0x16b: 0x45, 0x16c: 0x46, 0x16d: 0x47, 0x16e: 0x48, 0x16f: 0x49, + 0x170: 0x4a, 0x173: 0x4b, 0x177: 0x05, + 0x17e: 0x4c, 0x17f: 0x4d, + // Block 0x6, offset 0x180 + 0x180: 0x4e, 0x181: 0x4f, 0x182: 0x50, 0x183: 0x51, 0x184: 0x52, 0x185: 0x53, 0x186: 0x54, 0x187: 0x55, + 0x188: 0x56, 0x189: 0x55, 0x18a: 0x55, 0x18b: 0x55, 0x18c: 0x57, 0x18d: 0x58, 0x18e: 0x59, 0x18f: 0x55, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x55, 0x195: 0x55, 0x196: 0x55, 0x197: 0x55, + 0x198: 0x55, 0x199: 0x55, 0x19a: 0x5e, 0x19b: 0x55, 0x19c: 0x55, 0x19d: 0x5f, 0x19e: 0x55, 0x19f: 0x60, + 0x1a4: 0x55, 0x1a5: 0x55, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x55, 0x1a9: 0x55, 0x1aa: 0x55, 0x1ab: 0x55, 0x1ac: 0x55, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x55, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x55, 0x1bd: 0x55, 0x1be: 0x55, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x55, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26d: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x8f, 0x2b6: 0x0e, 0x2b7: 0x90, + 0x2b8: 0x91, 0x2b9: 0x92, 0x2ba: 0x0e, 0x2bb: 0x93, 0x2bc: 0x94, 0x2bd: 0x95, 0x2bf: 0x96, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x97, 0x2c5: 0x55, 0x2c6: 0x98, 0x2c7: 0x99, + 0x2cb: 0x9a, 0x2cd: 0x9b, + 0x2e0: 0x9c, 0x2e1: 0x9c, 0x2e2: 0x9c, 0x2e3: 0x9c, 0x2e4: 0x9d, 0x2e5: 0x9c, 0x2e6: 0x9c, 0x2e7: 0x9c, + 0x2e8: 0x9e, 0x2e9: 0x9c, 0x2ea: 0x9c, 0x2eb: 0x9f, 0x2ec: 0xa0, 0x2ed: 0x9c, 0x2ee: 0x9c, 0x2ef: 0x9c, + 0x2f0: 0x9c, 0x2f1: 0x9c, 0x2f2: 0x9c, 0x2f3: 0x9c, 0x2f4: 0xa1, 0x2f5: 0x9c, 0x2f6: 0x9c, 0x2f7: 0x9c, + 0x2f8: 0x9c, 0x2f9: 0xa2, 0x2fa: 0xa3, 0x2fb: 0xa4, 0x2fc: 0xa5, 0x2fd: 0xa6, 0x2fe: 0xa7, 0x2ff: 0x9c, + // Block 0xc, offset 0x300 + 0x300: 0xa8, 0x301: 0xa9, 0x302: 0xaa, 0x303: 0x21, 0x304: 0xab, 0x305: 0xac, 0x306: 0xad, 0x307: 0xae, + 0x308: 0xaf, 0x309: 0x28, 0x30b: 0xb0, 0x30c: 0x26, 0x30d: 0xb1, + 0x310: 0xb2, 0x311: 0xb3, 0x312: 0xb4, 0x313: 0xb5, 0x316: 0xb6, 0x317: 0xb7, + 0x318: 0xb8, 0x319: 0xb9, 0x31a: 0xba, 0x31c: 0xbb, + 0x320: 0xbc, 0x324: 0xbd, 0x325: 0xbe, 0x327: 0xbf, + 0x328: 0xc0, 0x329: 0xc1, 0x32a: 0xc2, + 0x330: 0xc3, 0x332: 0xc4, 0x334: 0xc5, 0x335: 0xc6, 0x336: 0xc7, + 0x33b: 0xc8, 0x33c: 0xc9, 0x33d: 0xca, 0x33f: 0xcb, + // Block 0xd, offset 0x340 + 0x351: 0xcc, + // Block 0xe, offset 0x380 + 0x3ab: 0xcd, 0x3ac: 0xce, + 0x3bd: 0xcf, 0x3be: 0xd0, 0x3bf: 0xd1, + // Block 0xf, offset 0x3c0 + 0x3f2: 0xd2, + // Block 0x10, offset 0x400 + 0x43c: 0xd3, 0x43d: 0xd4, + // Block 0x11, offset 0x440 + 0x445: 0xd5, 0x446: 0xd6, 0x447: 0xd7, + 0x448: 0x55, 0x449: 0xd8, 0x44c: 0x55, 0x44d: 0xd9, + 0x45b: 0xda, 0x45c: 0xdb, 0x45d: 0xdc, 0x45e: 0xdd, 0x45f: 0xde, + 0x468: 0xdf, 0x469: 0xe0, 0x46a: 0xe1, + // Block 0x12, offset 0x480 + 0x480: 0xe2, 0x482: 0xcf, 0x484: 0xce, + 0x48a: 0xe3, 0x48b: 0xe4, + 0x493: 0xe5, + 0x4a0: 0x9c, 0x4a1: 0x9c, 0x4a2: 0x9c, 0x4a3: 0xe6, 0x4a4: 0x9c, 0x4a5: 0xe7, 0x4a6: 0x9c, 0x4a7: 0x9c, + 0x4a8: 0x9c, 0x4a9: 0x9c, 0x4aa: 0x9c, 0x4ab: 0x9c, 0x4ac: 0x9c, 0x4ad: 0x9c, 0x4ae: 0x9c, 0x4af: 0x9c, + 0x4b0: 0x9c, 0x4b1: 0xe8, 0x4b2: 0xe9, 0x4b3: 0x9c, 0x4b4: 0xea, 0x4b5: 0x9c, 0x4b6: 0x9c, 0x4b7: 0x9c, + 0x4b8: 0x0e, 0x4b9: 0x0e, 0x4ba: 0x0e, 0x4bb: 0xeb, 0x4bc: 0x9c, 0x4bd: 0x9c, 0x4be: 0x9c, 0x4bf: 0x9c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xec, 0x4c1: 0x55, 0x4c2: 0xed, 0x4c3: 0xee, 0x4c4: 0xef, 0x4c5: 0xf0, 0x4c6: 0xf1, + 0x4c9: 0xf2, 0x4cc: 0x55, 0x4cd: 0x55, 0x4ce: 0x55, 0x4cf: 0x55, + 0x4d0: 0x55, 0x4d1: 0x55, 0x4d2: 0x55, 0x4d3: 0x55, 0x4d4: 0x55, 0x4d5: 0x55, 0x4d6: 0x55, 0x4d7: 0x55, + 0x4d8: 0x55, 0x4d9: 0x55, 0x4da: 0x55, 0x4db: 0xf3, 0x4dc: 0x55, 0x4dd: 0xf4, 0x4de: 0x55, 0x4df: 0xf5, + 0x4e0: 0xf6, 0x4e1: 0xf7, 0x4e2: 0xf8, 0x4e4: 0x55, 0x4e5: 0x55, 0x4e6: 0x55, 0x4e7: 0x55, + 0x4e8: 0x55, 0x4e9: 0xf9, 0x4ea: 0xfa, 0x4eb: 0xfb, 0x4ec: 0x55, 0x4ed: 0x55, 0x4ee: 0xfc, 0x4ef: 0xfd, + 0x4ff: 0xfe, + // Block 0x14, offset 0x500 + 0x53f: 0xfe, + // Block 0x15, offset 0x540 + 0x550: 0x09, 0x551: 0x0a, 0x553: 0x0b, 0x556: 0x0c, + 0x55b: 0x0d, 0x55c: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, + 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x58f: 0x12, + 0x59f: 0x12, + 0x5af: 0x12, + 0x5bf: 0x12, + // Block 0x17, offset 0x5c0 + 0x5c0: 0xff, 0x5c1: 0xff, 0x5c2: 0xff, 0x5c3: 0xff, 0x5c4: 0x05, 0x5c5: 0x05, 0x5c6: 0x05, 0x5c7: 0x100, + 0x5c8: 0xff, 0x5c9: 0xff, 0x5ca: 0xff, 0x5cb: 0xff, 0x5cc: 0xff, 0x5cd: 0xff, 0x5ce: 0xff, 0x5cf: 0xff, + 0x5d0: 0xff, 0x5d1: 0xff, 0x5d2: 0xff, 0x5d3: 0xff, 0x5d4: 0xff, 0x5d5: 0xff, 0x5d6: 0xff, 0x5d7: 0xff, + 0x5d8: 0xff, 0x5d9: 0xff, 0x5da: 0xff, 0x5db: 0xff, 0x5dc: 0xff, 0x5dd: 0xff, 0x5de: 0xff, 0x5df: 0xff, + 0x5e0: 0xff, 0x5e1: 0xff, 0x5e2: 0xff, 0x5e3: 0xff, 0x5e4: 0xff, 0x5e5: 0xff, 0x5e6: 0xff, 0x5e7: 0xff, + 0x5e8: 0xff, 0x5e9: 0xff, 0x5ea: 0xff, 0x5eb: 0xff, 0x5ec: 0xff, 0x5ed: 0xff, 0x5ee: 0xff, 0x5ef: 0xff, + 0x5f0: 0xff, 0x5f1: 0xff, 0x5f2: 0xff, 0x5f3: 0xff, 0x5f4: 0xff, 0x5f5: 0xff, 0x5f6: 0xff, 0x5f7: 0xff, + 0x5f8: 0xff, 0x5f9: 0xff, 0x5fa: 0xff, 0x5fb: 0xff, 0x5fc: 0xff, 0x5fd: 0xff, 0x5fe: 0xff, 0x5ff: 0xff, + // Block 0x18, offset 0x600 + 0x60f: 0x12, + 0x61f: 0x12, + 0x620: 0x15, + 0x62f: 0x12, + 0x63f: 0x12, + // Block 0x19, offset 0x640 + 0x64f: 0x12, +} + +// Total table size 19960 bytes (19KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index d69ccb4f9..487335d14 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -13,7 +13,7 @@ import "encoding/binary" // a rune to a uint16. The values take two forms. For v >= 0x8000: // bits // 15: 1 (inverse of NFD_QC bit of qcInfo) -// 13..7: qcInfo (see below). isYesD is always true (no decompostion). +// 13..7: qcInfo (see below). isYesD is always true (no decomposition). // 6..0: ccc (compressed CCC value). // For v < 0x8000, the respective rune has a decomposition and v is an index // into a byte array of UTF-8 decomposition sequences and additional info and diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 9115ef257..f65785e8a 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 000000000..e1858b879 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7908 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/trie.go b/vendor/golang.org/x/text/unicode/norm/trie.go index 423386bf4..e4250ae22 100644 --- a/vendor/golang.org/x/text/unicode/norm/trie.go +++ b/vendor/golang.org/x/text/unicode/norm/trie.go @@ -29,7 +29,7 @@ var ( nfkcData = newNfkcTrie(0) ) -// lookupValue determines the type of block n and looks up the value for b. +// lookup determines the type of block n and looks up the value for b. // For n < t.cutoff, the block is a simple lookup table. Otherwise, the block // is a list of ranges with an accompanying value. Given a matching range r, // the value for b is by r.value + (b - r.lo) * stride. diff --git a/vendor/golang.org/x/text/width/tables13.0.0.go b/vendor/golang.org/x/text/width/tables13.0.0.go index ab258e384..b1fcb522c 100644 --- a/vendor/golang.org/x/text/width/tables13.0.0.go +++ b/vendor/golang.org/x/text/width/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package width diff --git a/vendor/golang.org/x/text/width/tables15.0.0.go b/vendor/golang.org/x/text/width/tables15.0.0.go new file mode 100644 index 000000000..4b91e3384 --- /dev/null +++ b/vendor/golang.org/x/text/width/tables15.0.0.go @@ -0,0 +1,1368 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package width + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// widthTrie. Total size: 14912 bytes (14.56 KiB). Checksum: 4468b6cd178303d2. +type widthTrie struct{} + +func newWidthTrie(i int) *widthTrie { + return &widthTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *widthTrie) lookupValue(n uint32, b byte) uint16 { + switch { + default: + return uint16(widthValues[n<<6+uint32(b)]) + } +} + +// widthValues: 105 blocks, 6720 entries, 13440 bytes +// The third block is the zero block. +var widthValues = [6720]uint16{ + // Block 0x0, offset 0x0 + 0x20: 0x6001, 0x21: 0x6002, 0x22: 0x6002, 0x23: 0x6002, + 0x24: 0x6002, 0x25: 0x6002, 0x26: 0x6002, 0x27: 0x6002, 0x28: 0x6002, 0x29: 0x6002, + 0x2a: 0x6002, 0x2b: 0x6002, 0x2c: 0x6002, 0x2d: 0x6002, 0x2e: 0x6002, 0x2f: 0x6002, + 0x30: 0x6002, 0x31: 0x6002, 0x32: 0x6002, 0x33: 0x6002, 0x34: 0x6002, 0x35: 0x6002, + 0x36: 0x6002, 0x37: 0x6002, 0x38: 0x6002, 0x39: 0x6002, 0x3a: 0x6002, 0x3b: 0x6002, + 0x3c: 0x6002, 0x3d: 0x6002, 0x3e: 0x6002, 0x3f: 0x6002, + // Block 0x1, offset 0x40 + 0x40: 0x6003, 0x41: 0x6003, 0x42: 0x6003, 0x43: 0x6003, 0x44: 0x6003, 0x45: 0x6003, + 0x46: 0x6003, 0x47: 0x6003, 0x48: 0x6003, 0x49: 0x6003, 0x4a: 0x6003, 0x4b: 0x6003, + 0x4c: 0x6003, 0x4d: 0x6003, 0x4e: 0x6003, 0x4f: 0x6003, 0x50: 0x6003, 0x51: 0x6003, + 0x52: 0x6003, 0x53: 0x6003, 0x54: 0x6003, 0x55: 0x6003, 0x56: 0x6003, 0x57: 0x6003, + 0x58: 0x6003, 0x59: 0x6003, 0x5a: 0x6003, 0x5b: 0x6003, 0x5c: 0x6003, 0x5d: 0x6003, + 0x5e: 0x6003, 0x5f: 0x6003, 0x60: 0x6004, 0x61: 0x6004, 0x62: 0x6004, 0x63: 0x6004, + 0x64: 0x6004, 0x65: 0x6004, 0x66: 0x6004, 0x67: 0x6004, 0x68: 0x6004, 0x69: 0x6004, + 0x6a: 0x6004, 0x6b: 0x6004, 0x6c: 0x6004, 0x6d: 0x6004, 0x6e: 0x6004, 0x6f: 0x6004, + 0x70: 0x6004, 0x71: 0x6004, 0x72: 0x6004, 0x73: 0x6004, 0x74: 0x6004, 0x75: 0x6004, + 0x76: 0x6004, 0x77: 0x6004, 0x78: 0x6004, 0x79: 0x6004, 0x7a: 0x6004, 0x7b: 0x6004, + 0x7c: 0x6004, 0x7d: 0x6004, 0x7e: 0x6004, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xe1: 0x2000, 0xe2: 0x6005, 0xe3: 0x6005, + 0xe4: 0x2000, 0xe5: 0x6006, 0xe6: 0x6005, 0xe7: 0x2000, 0xe8: 0x2000, + 0xea: 0x2000, 0xec: 0x6007, 0xed: 0x2000, 0xee: 0x2000, 0xef: 0x6008, + 0xf0: 0x2000, 0xf1: 0x2000, 0xf2: 0x2000, 0xf3: 0x2000, 0xf4: 0x2000, + 0xf6: 0x2000, 0xf7: 0x2000, 0xf8: 0x2000, 0xf9: 0x2000, 0xfa: 0x2000, + 0xfc: 0x2000, 0xfd: 0x2000, 0xfe: 0x2000, 0xff: 0x2000, + // Block 0x4, offset 0x100 + 0x106: 0x2000, + 0x110: 0x2000, + 0x117: 0x2000, + 0x118: 0x2000, + 0x11e: 0x2000, 0x11f: 0x2000, 0x120: 0x2000, 0x121: 0x2000, + 0x126: 0x2000, 0x128: 0x2000, 0x129: 0x2000, + 0x12a: 0x2000, 0x12c: 0x2000, 0x12d: 0x2000, + 0x130: 0x2000, 0x132: 0x2000, 0x133: 0x2000, + 0x137: 0x2000, 0x138: 0x2000, 0x139: 0x2000, 0x13a: 0x2000, + 0x13c: 0x2000, 0x13e: 0x2000, + // Block 0x5, offset 0x140 + 0x141: 0x2000, + 0x151: 0x2000, + 0x153: 0x2000, + 0x15b: 0x2000, + 0x166: 0x2000, 0x167: 0x2000, + 0x16b: 0x2000, + 0x171: 0x2000, 0x172: 0x2000, 0x173: 0x2000, + 0x178: 0x2000, + 0x17f: 0x2000, + // Block 0x6, offset 0x180 + 0x180: 0x2000, 0x181: 0x2000, 0x182: 0x2000, 0x184: 0x2000, + 0x188: 0x2000, 0x189: 0x2000, 0x18a: 0x2000, 0x18b: 0x2000, + 0x18d: 0x2000, + 0x192: 0x2000, 0x193: 0x2000, + 0x1a6: 0x2000, 0x1a7: 0x2000, + 0x1ab: 0x2000, + // Block 0x7, offset 0x1c0 + 0x1ce: 0x2000, 0x1d0: 0x2000, + 0x1d2: 0x2000, 0x1d4: 0x2000, 0x1d6: 0x2000, + 0x1d8: 0x2000, 0x1da: 0x2000, 0x1dc: 0x2000, + // Block 0x8, offset 0x200 + 0x211: 0x2000, + 0x221: 0x2000, + // Block 0x9, offset 0x240 + 0x244: 0x2000, + 0x247: 0x2000, 0x249: 0x2000, 0x24a: 0x2000, 0x24b: 0x2000, + 0x24d: 0x2000, 0x250: 0x2000, + 0x258: 0x2000, 0x259: 0x2000, 0x25a: 0x2000, 0x25b: 0x2000, 0x25d: 0x2000, + 0x25f: 0x2000, + // Block 0xa, offset 0x280 + 0x280: 0x2000, 0x281: 0x2000, 0x282: 0x2000, 0x283: 0x2000, 0x284: 0x2000, 0x285: 0x2000, + 0x286: 0x2000, 0x287: 0x2000, 0x288: 0x2000, 0x289: 0x2000, 0x28a: 0x2000, 0x28b: 0x2000, + 0x28c: 0x2000, 0x28d: 0x2000, 0x28e: 0x2000, 0x28f: 0x2000, 0x290: 0x2000, 0x291: 0x2000, + 0x292: 0x2000, 0x293: 0x2000, 0x294: 0x2000, 0x295: 0x2000, 0x296: 0x2000, 0x297: 0x2000, + 0x298: 0x2000, 0x299: 0x2000, 0x29a: 0x2000, 0x29b: 0x2000, 0x29c: 0x2000, 0x29d: 0x2000, + 0x29e: 0x2000, 0x29f: 0x2000, 0x2a0: 0x2000, 0x2a1: 0x2000, 0x2a2: 0x2000, 0x2a3: 0x2000, + 0x2a4: 0x2000, 0x2a5: 0x2000, 0x2a6: 0x2000, 0x2a7: 0x2000, 0x2a8: 0x2000, 0x2a9: 0x2000, + 0x2aa: 0x2000, 0x2ab: 0x2000, 0x2ac: 0x2000, 0x2ad: 0x2000, 0x2ae: 0x2000, 0x2af: 0x2000, + 0x2b0: 0x2000, 0x2b1: 0x2000, 0x2b2: 0x2000, 0x2b3: 0x2000, 0x2b4: 0x2000, 0x2b5: 0x2000, + 0x2b6: 0x2000, 0x2b7: 0x2000, 0x2b8: 0x2000, 0x2b9: 0x2000, 0x2ba: 0x2000, 0x2bb: 0x2000, + 0x2bc: 0x2000, 0x2bd: 0x2000, 0x2be: 0x2000, 0x2bf: 0x2000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x2000, 0x2c1: 0x2000, 0x2c2: 0x2000, 0x2c3: 0x2000, 0x2c4: 0x2000, 0x2c5: 0x2000, + 0x2c6: 0x2000, 0x2c7: 0x2000, 0x2c8: 0x2000, 0x2c9: 0x2000, 0x2ca: 0x2000, 0x2cb: 0x2000, + 0x2cc: 0x2000, 0x2cd: 0x2000, 0x2ce: 0x2000, 0x2cf: 0x2000, 0x2d0: 0x2000, 0x2d1: 0x2000, + 0x2d2: 0x2000, 0x2d3: 0x2000, 0x2d4: 0x2000, 0x2d5: 0x2000, 0x2d6: 0x2000, 0x2d7: 0x2000, + 0x2d8: 0x2000, 0x2d9: 0x2000, 0x2da: 0x2000, 0x2db: 0x2000, 0x2dc: 0x2000, 0x2dd: 0x2000, + 0x2de: 0x2000, 0x2df: 0x2000, 0x2e0: 0x2000, 0x2e1: 0x2000, 0x2e2: 0x2000, 0x2e3: 0x2000, + 0x2e4: 0x2000, 0x2e5: 0x2000, 0x2e6: 0x2000, 0x2e7: 0x2000, 0x2e8: 0x2000, 0x2e9: 0x2000, + 0x2ea: 0x2000, 0x2eb: 0x2000, 0x2ec: 0x2000, 0x2ed: 0x2000, 0x2ee: 0x2000, 0x2ef: 0x2000, + // Block 0xc, offset 0x300 + 0x311: 0x2000, + 0x312: 0x2000, 0x313: 0x2000, 0x314: 0x2000, 0x315: 0x2000, 0x316: 0x2000, 0x317: 0x2000, + 0x318: 0x2000, 0x319: 0x2000, 0x31a: 0x2000, 0x31b: 0x2000, 0x31c: 0x2000, 0x31d: 0x2000, + 0x31e: 0x2000, 0x31f: 0x2000, 0x320: 0x2000, 0x321: 0x2000, 0x323: 0x2000, + 0x324: 0x2000, 0x325: 0x2000, 0x326: 0x2000, 0x327: 0x2000, 0x328: 0x2000, 0x329: 0x2000, + 0x331: 0x2000, 0x332: 0x2000, 0x333: 0x2000, 0x334: 0x2000, 0x335: 0x2000, + 0x336: 0x2000, 0x337: 0x2000, 0x338: 0x2000, 0x339: 0x2000, 0x33a: 0x2000, 0x33b: 0x2000, + 0x33c: 0x2000, 0x33d: 0x2000, 0x33e: 0x2000, 0x33f: 0x2000, + // Block 0xd, offset 0x340 + 0x340: 0x2000, 0x341: 0x2000, 0x343: 0x2000, 0x344: 0x2000, 0x345: 0x2000, + 0x346: 0x2000, 0x347: 0x2000, 0x348: 0x2000, 0x349: 0x2000, + // Block 0xe, offset 0x380 + 0x381: 0x2000, + 0x390: 0x2000, 0x391: 0x2000, + 0x392: 0x2000, 0x393: 0x2000, 0x394: 0x2000, 0x395: 0x2000, 0x396: 0x2000, 0x397: 0x2000, + 0x398: 0x2000, 0x399: 0x2000, 0x39a: 0x2000, 0x39b: 0x2000, 0x39c: 0x2000, 0x39d: 0x2000, + 0x39e: 0x2000, 0x39f: 0x2000, 0x3a0: 0x2000, 0x3a1: 0x2000, 0x3a2: 0x2000, 0x3a3: 0x2000, + 0x3a4: 0x2000, 0x3a5: 0x2000, 0x3a6: 0x2000, 0x3a7: 0x2000, 0x3a8: 0x2000, 0x3a9: 0x2000, + 0x3aa: 0x2000, 0x3ab: 0x2000, 0x3ac: 0x2000, 0x3ad: 0x2000, 0x3ae: 0x2000, 0x3af: 0x2000, + 0x3b0: 0x2000, 0x3b1: 0x2000, 0x3b2: 0x2000, 0x3b3: 0x2000, 0x3b4: 0x2000, 0x3b5: 0x2000, + 0x3b6: 0x2000, 0x3b7: 0x2000, 0x3b8: 0x2000, 0x3b9: 0x2000, 0x3ba: 0x2000, 0x3bb: 0x2000, + 0x3bc: 0x2000, 0x3bd: 0x2000, 0x3be: 0x2000, 0x3bf: 0x2000, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x2000, 0x3c1: 0x2000, 0x3c2: 0x2000, 0x3c3: 0x2000, 0x3c4: 0x2000, 0x3c5: 0x2000, + 0x3c6: 0x2000, 0x3c7: 0x2000, 0x3c8: 0x2000, 0x3c9: 0x2000, 0x3ca: 0x2000, 0x3cb: 0x2000, + 0x3cc: 0x2000, 0x3cd: 0x2000, 0x3ce: 0x2000, 0x3cf: 0x2000, 0x3d1: 0x2000, + // Block 0x10, offset 0x400 + 0x400: 0x4000, 0x401: 0x4000, 0x402: 0x4000, 0x403: 0x4000, 0x404: 0x4000, 0x405: 0x4000, + 0x406: 0x4000, 0x407: 0x4000, 0x408: 0x4000, 0x409: 0x4000, 0x40a: 0x4000, 0x40b: 0x4000, + 0x40c: 0x4000, 0x40d: 0x4000, 0x40e: 0x4000, 0x40f: 0x4000, 0x410: 0x4000, 0x411: 0x4000, + 0x412: 0x4000, 0x413: 0x4000, 0x414: 0x4000, 0x415: 0x4000, 0x416: 0x4000, 0x417: 0x4000, + 0x418: 0x4000, 0x419: 0x4000, 0x41a: 0x4000, 0x41b: 0x4000, 0x41c: 0x4000, 0x41d: 0x4000, + 0x41e: 0x4000, 0x41f: 0x4000, 0x420: 0x4000, 0x421: 0x4000, 0x422: 0x4000, 0x423: 0x4000, + 0x424: 0x4000, 0x425: 0x4000, 0x426: 0x4000, 0x427: 0x4000, 0x428: 0x4000, 0x429: 0x4000, + 0x42a: 0x4000, 0x42b: 0x4000, 0x42c: 0x4000, 0x42d: 0x4000, 0x42e: 0x4000, 0x42f: 0x4000, + 0x430: 0x4000, 0x431: 0x4000, 0x432: 0x4000, 0x433: 0x4000, 0x434: 0x4000, 0x435: 0x4000, + 0x436: 0x4000, 0x437: 0x4000, 0x438: 0x4000, 0x439: 0x4000, 0x43a: 0x4000, 0x43b: 0x4000, + 0x43c: 0x4000, 0x43d: 0x4000, 0x43e: 0x4000, 0x43f: 0x4000, + // Block 0x11, offset 0x440 + 0x440: 0x4000, 0x441: 0x4000, 0x442: 0x4000, 0x443: 0x4000, 0x444: 0x4000, 0x445: 0x4000, + 0x446: 0x4000, 0x447: 0x4000, 0x448: 0x4000, 0x449: 0x4000, 0x44a: 0x4000, 0x44b: 0x4000, + 0x44c: 0x4000, 0x44d: 0x4000, 0x44e: 0x4000, 0x44f: 0x4000, 0x450: 0x4000, 0x451: 0x4000, + 0x452: 0x4000, 0x453: 0x4000, 0x454: 0x4000, 0x455: 0x4000, 0x456: 0x4000, 0x457: 0x4000, + 0x458: 0x4000, 0x459: 0x4000, 0x45a: 0x4000, 0x45b: 0x4000, 0x45c: 0x4000, 0x45d: 0x4000, + 0x45e: 0x4000, 0x45f: 0x4000, + // Block 0x12, offset 0x480 + 0x490: 0x2000, + 0x493: 0x2000, 0x494: 0x2000, 0x495: 0x2000, 0x496: 0x2000, + 0x498: 0x2000, 0x499: 0x2000, 0x49c: 0x2000, 0x49d: 0x2000, + 0x4a0: 0x2000, 0x4a1: 0x2000, 0x4a2: 0x2000, + 0x4a4: 0x2000, 0x4a5: 0x2000, 0x4a6: 0x2000, 0x4a7: 0x2000, + 0x4b0: 0x2000, 0x4b2: 0x2000, 0x4b3: 0x2000, 0x4b5: 0x2000, + 0x4bb: 0x2000, + 0x4be: 0x2000, + // Block 0x13, offset 0x4c0 + 0x4f4: 0x2000, + 0x4ff: 0x2000, + // Block 0x14, offset 0x500 + 0x501: 0x2000, 0x502: 0x2000, 0x503: 0x2000, 0x504: 0x2000, + 0x529: 0xa009, + 0x52c: 0x2000, + // Block 0x15, offset 0x540 + 0x543: 0x2000, 0x545: 0x2000, + 0x549: 0x2000, + 0x553: 0x2000, 0x556: 0x2000, + 0x561: 0x2000, 0x562: 0x2000, + 0x566: 0x2000, + 0x56b: 0x2000, + // Block 0x16, offset 0x580 + 0x593: 0x2000, 0x594: 0x2000, + 0x59b: 0x2000, 0x59c: 0x2000, 0x59d: 0x2000, + 0x59e: 0x2000, 0x5a0: 0x2000, 0x5a1: 0x2000, 0x5a2: 0x2000, 0x5a3: 0x2000, + 0x5a4: 0x2000, 0x5a5: 0x2000, 0x5a6: 0x2000, 0x5a7: 0x2000, 0x5a8: 0x2000, 0x5a9: 0x2000, + 0x5aa: 0x2000, 0x5ab: 0x2000, + 0x5b0: 0x2000, 0x5b1: 0x2000, 0x5b2: 0x2000, 0x5b3: 0x2000, 0x5b4: 0x2000, 0x5b5: 0x2000, + 0x5b6: 0x2000, 0x5b7: 0x2000, 0x5b8: 0x2000, 0x5b9: 0x2000, + // Block 0x17, offset 0x5c0 + 0x5c9: 0x2000, + 0x5d0: 0x200a, 0x5d1: 0x200b, + 0x5d2: 0x200a, 0x5d3: 0x200c, 0x5d4: 0x2000, 0x5d5: 0x2000, 0x5d6: 0x2000, 0x5d7: 0x2000, + 0x5d8: 0x2000, 0x5d9: 0x2000, + 0x5f8: 0x2000, 0x5f9: 0x2000, + // Block 0x18, offset 0x600 + 0x612: 0x2000, 0x614: 0x2000, + 0x627: 0x2000, + // Block 0x19, offset 0x640 + 0x640: 0x2000, 0x642: 0x2000, 0x643: 0x2000, + 0x647: 0x2000, 0x648: 0x2000, 0x64b: 0x2000, + 0x64f: 0x2000, 0x651: 0x2000, + 0x655: 0x2000, + 0x65a: 0x2000, 0x65d: 0x2000, + 0x65e: 0x2000, 0x65f: 0x2000, 0x660: 0x2000, 0x663: 0x2000, + 0x665: 0x2000, 0x667: 0x2000, 0x668: 0x2000, 0x669: 0x2000, + 0x66a: 0x2000, 0x66b: 0x2000, 0x66c: 0x2000, 0x66e: 0x2000, + 0x674: 0x2000, 0x675: 0x2000, + 0x676: 0x2000, 0x677: 0x2000, + 0x67c: 0x2000, 0x67d: 0x2000, + // Block 0x1a, offset 0x680 + 0x688: 0x2000, + 0x68c: 0x2000, + 0x692: 0x2000, + 0x6a0: 0x2000, 0x6a1: 0x2000, + 0x6a4: 0x2000, 0x6a5: 0x2000, 0x6a6: 0x2000, 0x6a7: 0x2000, + 0x6aa: 0x2000, 0x6ab: 0x2000, 0x6ae: 0x2000, 0x6af: 0x2000, + // Block 0x1b, offset 0x6c0 + 0x6c2: 0x2000, 0x6c3: 0x2000, + 0x6c6: 0x2000, 0x6c7: 0x2000, + 0x6d5: 0x2000, + 0x6d9: 0x2000, + 0x6e5: 0x2000, + 0x6ff: 0x2000, + // Block 0x1c, offset 0x700 + 0x712: 0x2000, + 0x71a: 0x4000, 0x71b: 0x4000, + 0x729: 0x4000, + 0x72a: 0x4000, + // Block 0x1d, offset 0x740 + 0x769: 0x4000, + 0x76a: 0x4000, 0x76b: 0x4000, 0x76c: 0x4000, + 0x770: 0x4000, 0x773: 0x4000, + // Block 0x1e, offset 0x780 + 0x7a0: 0x2000, 0x7a1: 0x2000, 0x7a2: 0x2000, 0x7a3: 0x2000, + 0x7a4: 0x2000, 0x7a5: 0x2000, 0x7a6: 0x2000, 0x7a7: 0x2000, 0x7a8: 0x2000, 0x7a9: 0x2000, + 0x7aa: 0x2000, 0x7ab: 0x2000, 0x7ac: 0x2000, 0x7ad: 0x2000, 0x7ae: 0x2000, 0x7af: 0x2000, + 0x7b0: 0x2000, 0x7b1: 0x2000, 0x7b2: 0x2000, 0x7b3: 0x2000, 0x7b4: 0x2000, 0x7b5: 0x2000, + 0x7b6: 0x2000, 0x7b7: 0x2000, 0x7b8: 0x2000, 0x7b9: 0x2000, 0x7ba: 0x2000, 0x7bb: 0x2000, + 0x7bc: 0x2000, 0x7bd: 0x2000, 0x7be: 0x2000, 0x7bf: 0x2000, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x2000, 0x7c1: 0x2000, 0x7c2: 0x2000, 0x7c3: 0x2000, 0x7c4: 0x2000, 0x7c5: 0x2000, + 0x7c6: 0x2000, 0x7c7: 0x2000, 0x7c8: 0x2000, 0x7c9: 0x2000, 0x7ca: 0x2000, 0x7cb: 0x2000, + 0x7cc: 0x2000, 0x7cd: 0x2000, 0x7ce: 0x2000, 0x7cf: 0x2000, 0x7d0: 0x2000, 0x7d1: 0x2000, + 0x7d2: 0x2000, 0x7d3: 0x2000, 0x7d4: 0x2000, 0x7d5: 0x2000, 0x7d6: 0x2000, 0x7d7: 0x2000, + 0x7d8: 0x2000, 0x7d9: 0x2000, 0x7da: 0x2000, 0x7db: 0x2000, 0x7dc: 0x2000, 0x7dd: 0x2000, + 0x7de: 0x2000, 0x7df: 0x2000, 0x7e0: 0x2000, 0x7e1: 0x2000, 0x7e2: 0x2000, 0x7e3: 0x2000, + 0x7e4: 0x2000, 0x7e5: 0x2000, 0x7e6: 0x2000, 0x7e7: 0x2000, 0x7e8: 0x2000, 0x7e9: 0x2000, + 0x7eb: 0x2000, 0x7ec: 0x2000, 0x7ed: 0x2000, 0x7ee: 0x2000, 0x7ef: 0x2000, + 0x7f0: 0x2000, 0x7f1: 0x2000, 0x7f2: 0x2000, 0x7f3: 0x2000, 0x7f4: 0x2000, 0x7f5: 0x2000, + 0x7f6: 0x2000, 0x7f7: 0x2000, 0x7f8: 0x2000, 0x7f9: 0x2000, 0x7fa: 0x2000, 0x7fb: 0x2000, + 0x7fc: 0x2000, 0x7fd: 0x2000, 0x7fe: 0x2000, 0x7ff: 0x2000, + // Block 0x20, offset 0x800 + 0x800: 0x2000, 0x801: 0x2000, 0x802: 0x200d, 0x803: 0x2000, 0x804: 0x2000, 0x805: 0x2000, + 0x806: 0x2000, 0x807: 0x2000, 0x808: 0x2000, 0x809: 0x2000, 0x80a: 0x2000, 0x80b: 0x2000, + 0x80c: 0x2000, 0x80d: 0x2000, 0x80e: 0x2000, 0x80f: 0x2000, 0x810: 0x2000, 0x811: 0x2000, + 0x812: 0x2000, 0x813: 0x2000, 0x814: 0x2000, 0x815: 0x2000, 0x816: 0x2000, 0x817: 0x2000, + 0x818: 0x2000, 0x819: 0x2000, 0x81a: 0x2000, 0x81b: 0x2000, 0x81c: 0x2000, 0x81d: 0x2000, + 0x81e: 0x2000, 0x81f: 0x2000, 0x820: 0x2000, 0x821: 0x2000, 0x822: 0x2000, 0x823: 0x2000, + 0x824: 0x2000, 0x825: 0x2000, 0x826: 0x2000, 0x827: 0x2000, 0x828: 0x2000, 0x829: 0x2000, + 0x82a: 0x2000, 0x82b: 0x2000, 0x82c: 0x2000, 0x82d: 0x2000, 0x82e: 0x2000, 0x82f: 0x2000, + 0x830: 0x2000, 0x831: 0x2000, 0x832: 0x2000, 0x833: 0x2000, 0x834: 0x2000, 0x835: 0x2000, + 0x836: 0x2000, 0x837: 0x2000, 0x838: 0x2000, 0x839: 0x2000, 0x83a: 0x2000, 0x83b: 0x2000, + 0x83c: 0x2000, 0x83d: 0x2000, 0x83e: 0x2000, 0x83f: 0x2000, + // Block 0x21, offset 0x840 + 0x840: 0x2000, 0x841: 0x2000, 0x842: 0x2000, 0x843: 0x2000, 0x844: 0x2000, 0x845: 0x2000, + 0x846: 0x2000, 0x847: 0x2000, 0x848: 0x2000, 0x849: 0x2000, 0x84a: 0x2000, 0x84b: 0x2000, + 0x850: 0x2000, 0x851: 0x2000, + 0x852: 0x2000, 0x853: 0x2000, 0x854: 0x2000, 0x855: 0x2000, 0x856: 0x2000, 0x857: 0x2000, + 0x858: 0x2000, 0x859: 0x2000, 0x85a: 0x2000, 0x85b: 0x2000, 0x85c: 0x2000, 0x85d: 0x2000, + 0x85e: 0x2000, 0x85f: 0x2000, 0x860: 0x2000, 0x861: 0x2000, 0x862: 0x2000, 0x863: 0x2000, + 0x864: 0x2000, 0x865: 0x2000, 0x866: 0x2000, 0x867: 0x2000, 0x868: 0x2000, 0x869: 0x2000, + 0x86a: 0x2000, 0x86b: 0x2000, 0x86c: 0x2000, 0x86d: 0x2000, 0x86e: 0x2000, 0x86f: 0x2000, + 0x870: 0x2000, 0x871: 0x2000, 0x872: 0x2000, 0x873: 0x2000, + // Block 0x22, offset 0x880 + 0x880: 0x2000, 0x881: 0x2000, 0x882: 0x2000, 0x883: 0x2000, 0x884: 0x2000, 0x885: 0x2000, + 0x886: 0x2000, 0x887: 0x2000, 0x888: 0x2000, 0x889: 0x2000, 0x88a: 0x2000, 0x88b: 0x2000, + 0x88c: 0x2000, 0x88d: 0x2000, 0x88e: 0x2000, 0x88f: 0x2000, + 0x892: 0x2000, 0x893: 0x2000, 0x894: 0x2000, 0x895: 0x2000, + 0x8a0: 0x200e, 0x8a1: 0x2000, 0x8a3: 0x2000, + 0x8a4: 0x2000, 0x8a5: 0x2000, 0x8a6: 0x2000, 0x8a7: 0x2000, 0x8a8: 0x2000, 0x8a9: 0x2000, + 0x8b2: 0x2000, 0x8b3: 0x2000, + 0x8b6: 0x2000, 0x8b7: 0x2000, + 0x8bc: 0x2000, 0x8bd: 0x2000, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x2000, 0x8c1: 0x2000, + 0x8c6: 0x2000, 0x8c7: 0x2000, 0x8c8: 0x2000, 0x8cb: 0x200f, + 0x8ce: 0x2000, 0x8cf: 0x2000, 0x8d0: 0x2000, 0x8d1: 0x2000, + 0x8e2: 0x2000, 0x8e3: 0x2000, + 0x8e4: 0x2000, 0x8e5: 0x2000, + 0x8ef: 0x2000, + 0x8fd: 0x4000, 0x8fe: 0x4000, + // Block 0x24, offset 0x900 + 0x905: 0x2000, + 0x906: 0x2000, 0x909: 0x2000, + 0x90e: 0x2000, 0x90f: 0x2000, + 0x914: 0x4000, 0x915: 0x4000, + 0x91c: 0x2000, + 0x91e: 0x2000, + // Block 0x25, offset 0x940 + 0x940: 0x2000, 0x942: 0x2000, + 0x948: 0x4000, 0x949: 0x4000, 0x94a: 0x4000, 0x94b: 0x4000, + 0x94c: 0x4000, 0x94d: 0x4000, 0x94e: 0x4000, 0x94f: 0x4000, 0x950: 0x4000, 0x951: 0x4000, + 0x952: 0x4000, 0x953: 0x4000, + 0x960: 0x2000, 0x961: 0x2000, 0x963: 0x2000, + 0x964: 0x2000, 0x965: 0x2000, 0x967: 0x2000, 0x968: 0x2000, 0x969: 0x2000, + 0x96a: 0x2000, 0x96c: 0x2000, 0x96d: 0x2000, 0x96f: 0x2000, + 0x97f: 0x4000, + // Block 0x26, offset 0x980 + 0x993: 0x4000, + 0x99e: 0x2000, 0x99f: 0x2000, 0x9a1: 0x4000, + 0x9aa: 0x4000, 0x9ab: 0x4000, + 0x9bd: 0x4000, 0x9be: 0x4000, 0x9bf: 0x2000, + // Block 0x27, offset 0x9c0 + 0x9c4: 0x4000, 0x9c5: 0x4000, + 0x9c6: 0x2000, 0x9c7: 0x2000, 0x9c8: 0x2000, 0x9c9: 0x2000, 0x9ca: 0x2000, 0x9cb: 0x2000, + 0x9cc: 0x2000, 0x9cd: 0x2000, 0x9ce: 0x4000, 0x9cf: 0x2000, 0x9d0: 0x2000, 0x9d1: 0x2000, + 0x9d2: 0x2000, 0x9d3: 0x2000, 0x9d4: 0x4000, 0x9d5: 0x2000, 0x9d6: 0x2000, 0x9d7: 0x2000, + 0x9d8: 0x2000, 0x9d9: 0x2000, 0x9da: 0x2000, 0x9db: 0x2000, 0x9dc: 0x2000, 0x9dd: 0x2000, + 0x9de: 0x2000, 0x9df: 0x2000, 0x9e0: 0x2000, 0x9e1: 0x2000, 0x9e3: 0x2000, + 0x9e8: 0x2000, 0x9e9: 0x2000, + 0x9ea: 0x4000, 0x9eb: 0x2000, 0x9ec: 0x2000, 0x9ed: 0x2000, 0x9ee: 0x2000, 0x9ef: 0x2000, + 0x9f0: 0x2000, 0x9f1: 0x2000, 0x9f2: 0x4000, 0x9f3: 0x4000, 0x9f4: 0x2000, 0x9f5: 0x4000, + 0x9f6: 0x2000, 0x9f7: 0x2000, 0x9f8: 0x2000, 0x9f9: 0x2000, 0x9fa: 0x4000, 0x9fb: 0x2000, + 0x9fc: 0x2000, 0x9fd: 0x4000, 0x9fe: 0x2000, 0x9ff: 0x2000, + // Block 0x28, offset 0xa00 + 0xa05: 0x4000, + 0xa0a: 0x4000, 0xa0b: 0x4000, + 0xa28: 0x4000, + 0xa3d: 0x2000, + // Block 0x29, offset 0xa40 + 0xa4c: 0x4000, 0xa4e: 0x4000, + 0xa53: 0x4000, 0xa54: 0x4000, 0xa55: 0x4000, 0xa57: 0x4000, + 0xa76: 0x2000, 0xa77: 0x2000, 0xa78: 0x2000, 0xa79: 0x2000, 0xa7a: 0x2000, 0xa7b: 0x2000, + 0xa7c: 0x2000, 0xa7d: 0x2000, 0xa7e: 0x2000, 0xa7f: 0x2000, + // Block 0x2a, offset 0xa80 + 0xa95: 0x4000, 0xa96: 0x4000, 0xa97: 0x4000, + 0xab0: 0x4000, + 0xabf: 0x4000, + // Block 0x2b, offset 0xac0 + 0xae6: 0x6000, 0xae7: 0x6000, 0xae8: 0x6000, 0xae9: 0x6000, + 0xaea: 0x6000, 0xaeb: 0x6000, 0xaec: 0x6000, 0xaed: 0x6000, + // Block 0x2c, offset 0xb00 + 0xb05: 0x6010, + 0xb06: 0x6011, + // Block 0x2d, offset 0xb40 + 0xb5b: 0x4000, 0xb5c: 0x4000, + // Block 0x2e, offset 0xb80 + 0xb90: 0x4000, + 0xb95: 0x4000, 0xb96: 0x2000, 0xb97: 0x2000, + 0xb98: 0x2000, 0xb99: 0x2000, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x4000, 0xbc1: 0x4000, 0xbc2: 0x4000, 0xbc3: 0x4000, 0xbc4: 0x4000, 0xbc5: 0x4000, + 0xbc6: 0x4000, 0xbc7: 0x4000, 0xbc8: 0x4000, 0xbc9: 0x4000, 0xbca: 0x4000, 0xbcb: 0x4000, + 0xbcc: 0x4000, 0xbcd: 0x4000, 0xbce: 0x4000, 0xbcf: 0x4000, 0xbd0: 0x4000, 0xbd1: 0x4000, + 0xbd2: 0x4000, 0xbd3: 0x4000, 0xbd4: 0x4000, 0xbd5: 0x4000, 0xbd6: 0x4000, 0xbd7: 0x4000, + 0xbd8: 0x4000, 0xbd9: 0x4000, 0xbdb: 0x4000, 0xbdc: 0x4000, 0xbdd: 0x4000, + 0xbde: 0x4000, 0xbdf: 0x4000, 0xbe0: 0x4000, 0xbe1: 0x4000, 0xbe2: 0x4000, 0xbe3: 0x4000, + 0xbe4: 0x4000, 0xbe5: 0x4000, 0xbe6: 0x4000, 0xbe7: 0x4000, 0xbe8: 0x4000, 0xbe9: 0x4000, + 0xbea: 0x4000, 0xbeb: 0x4000, 0xbec: 0x4000, 0xbed: 0x4000, 0xbee: 0x4000, 0xbef: 0x4000, + 0xbf0: 0x4000, 0xbf1: 0x4000, 0xbf2: 0x4000, 0xbf3: 0x4000, 0xbf4: 0x4000, 0xbf5: 0x4000, + 0xbf6: 0x4000, 0xbf7: 0x4000, 0xbf8: 0x4000, 0xbf9: 0x4000, 0xbfa: 0x4000, 0xbfb: 0x4000, + 0xbfc: 0x4000, 0xbfd: 0x4000, 0xbfe: 0x4000, 0xbff: 0x4000, + // Block 0x30, offset 0xc00 + 0xc00: 0x4000, 0xc01: 0x4000, 0xc02: 0x4000, 0xc03: 0x4000, 0xc04: 0x4000, 0xc05: 0x4000, + 0xc06: 0x4000, 0xc07: 0x4000, 0xc08: 0x4000, 0xc09: 0x4000, 0xc0a: 0x4000, 0xc0b: 0x4000, + 0xc0c: 0x4000, 0xc0d: 0x4000, 0xc0e: 0x4000, 0xc0f: 0x4000, 0xc10: 0x4000, 0xc11: 0x4000, + 0xc12: 0x4000, 0xc13: 0x4000, 0xc14: 0x4000, 0xc15: 0x4000, 0xc16: 0x4000, 0xc17: 0x4000, + 0xc18: 0x4000, 0xc19: 0x4000, 0xc1a: 0x4000, 0xc1b: 0x4000, 0xc1c: 0x4000, 0xc1d: 0x4000, + 0xc1e: 0x4000, 0xc1f: 0x4000, 0xc20: 0x4000, 0xc21: 0x4000, 0xc22: 0x4000, 0xc23: 0x4000, + 0xc24: 0x4000, 0xc25: 0x4000, 0xc26: 0x4000, 0xc27: 0x4000, 0xc28: 0x4000, 0xc29: 0x4000, + 0xc2a: 0x4000, 0xc2b: 0x4000, 0xc2c: 0x4000, 0xc2d: 0x4000, 0xc2e: 0x4000, 0xc2f: 0x4000, + 0xc30: 0x4000, 0xc31: 0x4000, 0xc32: 0x4000, 0xc33: 0x4000, + // Block 0x31, offset 0xc40 + 0xc40: 0x4000, 0xc41: 0x4000, 0xc42: 0x4000, 0xc43: 0x4000, 0xc44: 0x4000, 0xc45: 0x4000, + 0xc46: 0x4000, 0xc47: 0x4000, 0xc48: 0x4000, 0xc49: 0x4000, 0xc4a: 0x4000, 0xc4b: 0x4000, + 0xc4c: 0x4000, 0xc4d: 0x4000, 0xc4e: 0x4000, 0xc4f: 0x4000, 0xc50: 0x4000, 0xc51: 0x4000, + 0xc52: 0x4000, 0xc53: 0x4000, 0xc54: 0x4000, 0xc55: 0x4000, + 0xc70: 0x4000, 0xc71: 0x4000, 0xc72: 0x4000, 0xc73: 0x4000, 0xc74: 0x4000, 0xc75: 0x4000, + 0xc76: 0x4000, 0xc77: 0x4000, 0xc78: 0x4000, 0xc79: 0x4000, 0xc7a: 0x4000, 0xc7b: 0x4000, + // Block 0x32, offset 0xc80 + 0xc80: 0x9012, 0xc81: 0x4013, 0xc82: 0x4014, 0xc83: 0x4000, 0xc84: 0x4000, 0xc85: 0x4000, + 0xc86: 0x4000, 0xc87: 0x4000, 0xc88: 0x4000, 0xc89: 0x4000, 0xc8a: 0x4000, 0xc8b: 0x4000, + 0xc8c: 0x4015, 0xc8d: 0x4015, 0xc8e: 0x4000, 0xc8f: 0x4000, 0xc90: 0x4000, 0xc91: 0x4000, + 0xc92: 0x4000, 0xc93: 0x4000, 0xc94: 0x4000, 0xc95: 0x4000, 0xc96: 0x4000, 0xc97: 0x4000, + 0xc98: 0x4000, 0xc99: 0x4000, 0xc9a: 0x4000, 0xc9b: 0x4000, 0xc9c: 0x4000, 0xc9d: 0x4000, + 0xc9e: 0x4000, 0xc9f: 0x4000, 0xca0: 0x4000, 0xca1: 0x4000, 0xca2: 0x4000, 0xca3: 0x4000, + 0xca4: 0x4000, 0xca5: 0x4000, 0xca6: 0x4000, 0xca7: 0x4000, 0xca8: 0x4000, 0xca9: 0x4000, + 0xcaa: 0x4000, 0xcab: 0x4000, 0xcac: 0x4000, 0xcad: 0x4000, 0xcae: 0x4000, 0xcaf: 0x4000, + 0xcb0: 0x4000, 0xcb1: 0x4000, 0xcb2: 0x4000, 0xcb3: 0x4000, 0xcb4: 0x4000, 0xcb5: 0x4000, + 0xcb6: 0x4000, 0xcb7: 0x4000, 0xcb8: 0x4000, 0xcb9: 0x4000, 0xcba: 0x4000, 0xcbb: 0x4000, + 0xcbc: 0x4000, 0xcbd: 0x4000, 0xcbe: 0x4000, + // Block 0x33, offset 0xcc0 + 0xcc1: 0x4000, 0xcc2: 0x4000, 0xcc3: 0x4000, 0xcc4: 0x4000, 0xcc5: 0x4000, + 0xcc6: 0x4000, 0xcc7: 0x4000, 0xcc8: 0x4000, 0xcc9: 0x4000, 0xcca: 0x4000, 0xccb: 0x4000, + 0xccc: 0x4000, 0xccd: 0x4000, 0xcce: 0x4000, 0xccf: 0x4000, 0xcd0: 0x4000, 0xcd1: 0x4000, + 0xcd2: 0x4000, 0xcd3: 0x4000, 0xcd4: 0x4000, 0xcd5: 0x4000, 0xcd6: 0x4000, 0xcd7: 0x4000, + 0xcd8: 0x4000, 0xcd9: 0x4000, 0xcda: 0x4000, 0xcdb: 0x4000, 0xcdc: 0x4000, 0xcdd: 0x4000, + 0xcde: 0x4000, 0xcdf: 0x4000, 0xce0: 0x4000, 0xce1: 0x4000, 0xce2: 0x4000, 0xce3: 0x4000, + 0xce4: 0x4000, 0xce5: 0x4000, 0xce6: 0x4000, 0xce7: 0x4000, 0xce8: 0x4000, 0xce9: 0x4000, + 0xcea: 0x4000, 0xceb: 0x4000, 0xcec: 0x4000, 0xced: 0x4000, 0xcee: 0x4000, 0xcef: 0x4000, + 0xcf0: 0x4000, 0xcf1: 0x4000, 0xcf2: 0x4000, 0xcf3: 0x4000, 0xcf4: 0x4000, 0xcf5: 0x4000, + 0xcf6: 0x4000, 0xcf7: 0x4000, 0xcf8: 0x4000, 0xcf9: 0x4000, 0xcfa: 0x4000, 0xcfb: 0x4000, + 0xcfc: 0x4000, 0xcfd: 0x4000, 0xcfe: 0x4000, 0xcff: 0x4000, + // Block 0x34, offset 0xd00 + 0xd00: 0x4000, 0xd01: 0x4000, 0xd02: 0x4000, 0xd03: 0x4000, 0xd04: 0x4000, 0xd05: 0x4000, + 0xd06: 0x4000, 0xd07: 0x4000, 0xd08: 0x4000, 0xd09: 0x4000, 0xd0a: 0x4000, 0xd0b: 0x4000, + 0xd0c: 0x4000, 0xd0d: 0x4000, 0xd0e: 0x4000, 0xd0f: 0x4000, 0xd10: 0x4000, 0xd11: 0x4000, + 0xd12: 0x4000, 0xd13: 0x4000, 0xd14: 0x4000, 0xd15: 0x4000, 0xd16: 0x4000, + 0xd19: 0x4016, 0xd1a: 0x4017, 0xd1b: 0x4000, 0xd1c: 0x4000, 0xd1d: 0x4000, + 0xd1e: 0x4000, 0xd1f: 0x4000, 0xd20: 0x4000, 0xd21: 0x4018, 0xd22: 0x4019, 0xd23: 0x401a, + 0xd24: 0x401b, 0xd25: 0x401c, 0xd26: 0x401d, 0xd27: 0x401e, 0xd28: 0x401f, 0xd29: 0x4020, + 0xd2a: 0x4021, 0xd2b: 0x4022, 0xd2c: 0x4000, 0xd2d: 0x4010, 0xd2e: 0x4000, 0xd2f: 0x4023, + 0xd30: 0x4000, 0xd31: 0x4024, 0xd32: 0x4000, 0xd33: 0x4025, 0xd34: 0x4000, 0xd35: 0x4026, + 0xd36: 0x4000, 0xd37: 0x401a, 0xd38: 0x4000, 0xd39: 0x4027, 0xd3a: 0x4000, 0xd3b: 0x4028, + 0xd3c: 0x4000, 0xd3d: 0x4020, 0xd3e: 0x4000, 0xd3f: 0x4029, + // Block 0x35, offset 0xd40 + 0xd40: 0x4000, 0xd41: 0x402a, 0xd42: 0x4000, 0xd43: 0x402b, 0xd44: 0x402c, 0xd45: 0x4000, + 0xd46: 0x4017, 0xd47: 0x4000, 0xd48: 0x402d, 0xd49: 0x4000, 0xd4a: 0x402e, 0xd4b: 0x402f, + 0xd4c: 0x4030, 0xd4d: 0x4017, 0xd4e: 0x4016, 0xd4f: 0x4017, 0xd50: 0x4000, 0xd51: 0x4000, + 0xd52: 0x4031, 0xd53: 0x4000, 0xd54: 0x4000, 0xd55: 0x4031, 0xd56: 0x4000, 0xd57: 0x4000, + 0xd58: 0x4032, 0xd59: 0x4000, 0xd5a: 0x4000, 0xd5b: 0x4032, 0xd5c: 0x4000, 0xd5d: 0x4000, + 0xd5e: 0x4033, 0xd5f: 0x402e, 0xd60: 0x4034, 0xd61: 0x4035, 0xd62: 0x4034, 0xd63: 0x4036, + 0xd64: 0x4037, 0xd65: 0x4024, 0xd66: 0x4035, 0xd67: 0x4025, 0xd68: 0x4038, 0xd69: 0x4038, + 0xd6a: 0x4039, 0xd6b: 0x4039, 0xd6c: 0x403a, 0xd6d: 0x403a, 0xd6e: 0x4000, 0xd6f: 0x4035, + 0xd70: 0x4000, 0xd71: 0x4000, 0xd72: 0x403b, 0xd73: 0x403c, 0xd74: 0x4000, 0xd75: 0x4000, + 0xd76: 0x4000, 0xd77: 0x4000, 0xd78: 0x4000, 0xd79: 0x4000, 0xd7a: 0x4000, 0xd7b: 0x403d, + 0xd7c: 0x401c, 0xd7d: 0x4000, 0xd7e: 0x4000, 0xd7f: 0x4000, + // Block 0x36, offset 0xd80 + 0xd85: 0x4000, + 0xd86: 0x4000, 0xd87: 0x4000, 0xd88: 0x4000, 0xd89: 0x4000, 0xd8a: 0x4000, 0xd8b: 0x4000, + 0xd8c: 0x4000, 0xd8d: 0x4000, 0xd8e: 0x4000, 0xd8f: 0x4000, 0xd90: 0x4000, 0xd91: 0x4000, + 0xd92: 0x4000, 0xd93: 0x4000, 0xd94: 0x4000, 0xd95: 0x4000, 0xd96: 0x4000, 0xd97: 0x4000, + 0xd98: 0x4000, 0xd99: 0x4000, 0xd9a: 0x4000, 0xd9b: 0x4000, 0xd9c: 0x4000, 0xd9d: 0x4000, + 0xd9e: 0x4000, 0xd9f: 0x4000, 0xda0: 0x4000, 0xda1: 0x4000, 0xda2: 0x4000, 0xda3: 0x4000, + 0xda4: 0x4000, 0xda5: 0x4000, 0xda6: 0x4000, 0xda7: 0x4000, 0xda8: 0x4000, 0xda9: 0x4000, + 0xdaa: 0x4000, 0xdab: 0x4000, 0xdac: 0x4000, 0xdad: 0x4000, 0xdae: 0x4000, 0xdaf: 0x4000, + 0xdb1: 0x403e, 0xdb2: 0x403e, 0xdb3: 0x403e, 0xdb4: 0x403e, 0xdb5: 0x403e, + 0xdb6: 0x403e, 0xdb7: 0x403e, 0xdb8: 0x403e, 0xdb9: 0x403e, 0xdba: 0x403e, 0xdbb: 0x403e, + 0xdbc: 0x403e, 0xdbd: 0x403e, 0xdbe: 0x403e, 0xdbf: 0x403e, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x4037, 0xdc1: 0x4037, 0xdc2: 0x4037, 0xdc3: 0x4037, 0xdc4: 0x4037, 0xdc5: 0x4037, + 0xdc6: 0x4037, 0xdc7: 0x4037, 0xdc8: 0x4037, 0xdc9: 0x4037, 0xdca: 0x4037, 0xdcb: 0x4037, + 0xdcc: 0x4037, 0xdcd: 0x4037, 0xdce: 0x4037, 0xdcf: 0x400e, 0xdd0: 0x403f, 0xdd1: 0x4040, + 0xdd2: 0x4041, 0xdd3: 0x4040, 0xdd4: 0x403f, 0xdd5: 0x4042, 0xdd6: 0x4043, 0xdd7: 0x4044, + 0xdd8: 0x4040, 0xdd9: 0x4041, 0xdda: 0x4040, 0xddb: 0x4045, 0xddc: 0x4009, 0xddd: 0x4045, + 0xdde: 0x4046, 0xddf: 0x4045, 0xde0: 0x4047, 0xde1: 0x400b, 0xde2: 0x400a, 0xde3: 0x400c, + 0xde4: 0x4048, 0xde5: 0x4000, 0xde6: 0x4000, 0xde7: 0x4000, 0xde8: 0x4000, 0xde9: 0x4000, + 0xdea: 0x4000, 0xdeb: 0x4000, 0xdec: 0x4000, 0xded: 0x4000, 0xdee: 0x4000, 0xdef: 0x4000, + 0xdf0: 0x4000, 0xdf1: 0x4000, 0xdf2: 0x4000, 0xdf3: 0x4000, 0xdf4: 0x4000, 0xdf5: 0x4000, + 0xdf6: 0x4000, 0xdf7: 0x4000, 0xdf8: 0x4000, 0xdf9: 0x4000, 0xdfa: 0x4000, 0xdfb: 0x4000, + 0xdfc: 0x4000, 0xdfd: 0x4000, 0xdfe: 0x4000, 0xdff: 0x4000, + // Block 0x38, offset 0xe00 + 0xe00: 0x4000, 0xe01: 0x4000, 0xe02: 0x4000, 0xe03: 0x4000, 0xe04: 0x4000, 0xe05: 0x4000, + 0xe06: 0x4000, 0xe07: 0x4000, 0xe08: 0x4000, 0xe09: 0x4000, 0xe0a: 0x4000, 0xe0b: 0x4000, + 0xe0c: 0x4000, 0xe0d: 0x4000, 0xe0e: 0x4000, 0xe10: 0x4000, 0xe11: 0x4000, + 0xe12: 0x4000, 0xe13: 0x4000, 0xe14: 0x4000, 0xe15: 0x4000, 0xe16: 0x4000, 0xe17: 0x4000, + 0xe18: 0x4000, 0xe19: 0x4000, 0xe1a: 0x4000, 0xe1b: 0x4000, 0xe1c: 0x4000, 0xe1d: 0x4000, + 0xe1e: 0x4000, 0xe1f: 0x4000, 0xe20: 0x4000, 0xe21: 0x4000, 0xe22: 0x4000, 0xe23: 0x4000, + 0xe24: 0x4000, 0xe25: 0x4000, 0xe26: 0x4000, 0xe27: 0x4000, 0xe28: 0x4000, 0xe29: 0x4000, + 0xe2a: 0x4000, 0xe2b: 0x4000, 0xe2c: 0x4000, 0xe2d: 0x4000, 0xe2e: 0x4000, 0xe2f: 0x4000, + 0xe30: 0x4000, 0xe31: 0x4000, 0xe32: 0x4000, 0xe33: 0x4000, 0xe34: 0x4000, 0xe35: 0x4000, + 0xe36: 0x4000, 0xe37: 0x4000, 0xe38: 0x4000, 0xe39: 0x4000, 0xe3a: 0x4000, 0xe3b: 0x4000, + 0xe3c: 0x4000, 0xe3d: 0x4000, 0xe3e: 0x4000, 0xe3f: 0x4000, + // Block 0x39, offset 0xe40 + 0xe40: 0x4000, 0xe41: 0x4000, 0xe42: 0x4000, 0xe43: 0x4000, 0xe44: 0x4000, 0xe45: 0x4000, + 0xe46: 0x4000, 0xe47: 0x4000, 0xe48: 0x4000, 0xe49: 0x4000, 0xe4a: 0x4000, 0xe4b: 0x4000, + 0xe4c: 0x4000, 0xe4d: 0x4000, 0xe4e: 0x4000, 0xe4f: 0x4000, 0xe50: 0x4000, 0xe51: 0x4000, + 0xe52: 0x4000, 0xe53: 0x4000, 0xe54: 0x4000, 0xe55: 0x4000, 0xe56: 0x4000, 0xe57: 0x4000, + 0xe58: 0x4000, 0xe59: 0x4000, 0xe5a: 0x4000, 0xe5b: 0x4000, 0xe5c: 0x4000, 0xe5d: 0x4000, + 0xe5e: 0x4000, 0xe5f: 0x4000, 0xe60: 0x4000, 0xe61: 0x4000, 0xe62: 0x4000, 0xe63: 0x4000, + 0xe70: 0x4000, 0xe71: 0x4000, 0xe72: 0x4000, 0xe73: 0x4000, 0xe74: 0x4000, 0xe75: 0x4000, + 0xe76: 0x4000, 0xe77: 0x4000, 0xe78: 0x4000, 0xe79: 0x4000, 0xe7a: 0x4000, 0xe7b: 0x4000, + 0xe7c: 0x4000, 0xe7d: 0x4000, 0xe7e: 0x4000, 0xe7f: 0x4000, + // Block 0x3a, offset 0xe80 + 0xe80: 0x4000, 0xe81: 0x4000, 0xe82: 0x4000, 0xe83: 0x4000, 0xe84: 0x4000, 0xe85: 0x4000, + 0xe86: 0x4000, 0xe87: 0x4000, 0xe88: 0x4000, 0xe89: 0x4000, 0xe8a: 0x4000, 0xe8b: 0x4000, + 0xe8c: 0x4000, 0xe8d: 0x4000, 0xe8e: 0x4000, 0xe8f: 0x4000, 0xe90: 0x4000, 0xe91: 0x4000, + 0xe92: 0x4000, 0xe93: 0x4000, 0xe94: 0x4000, 0xe95: 0x4000, 0xe96: 0x4000, 0xe97: 0x4000, + 0xe98: 0x4000, 0xe99: 0x4000, 0xe9a: 0x4000, 0xe9b: 0x4000, 0xe9c: 0x4000, 0xe9d: 0x4000, + 0xe9e: 0x4000, 0xea0: 0x4000, 0xea1: 0x4000, 0xea2: 0x4000, 0xea3: 0x4000, + 0xea4: 0x4000, 0xea5: 0x4000, 0xea6: 0x4000, 0xea7: 0x4000, 0xea8: 0x4000, 0xea9: 0x4000, + 0xeaa: 0x4000, 0xeab: 0x4000, 0xeac: 0x4000, 0xead: 0x4000, 0xeae: 0x4000, 0xeaf: 0x4000, + 0xeb0: 0x4000, 0xeb1: 0x4000, 0xeb2: 0x4000, 0xeb3: 0x4000, 0xeb4: 0x4000, 0xeb5: 0x4000, + 0xeb6: 0x4000, 0xeb7: 0x4000, 0xeb8: 0x4000, 0xeb9: 0x4000, 0xeba: 0x4000, 0xebb: 0x4000, + 0xebc: 0x4000, 0xebd: 0x4000, 0xebe: 0x4000, 0xebf: 0x4000, + // Block 0x3b, offset 0xec0 + 0xec0: 0x4000, 0xec1: 0x4000, 0xec2: 0x4000, 0xec3: 0x4000, 0xec4: 0x4000, 0xec5: 0x4000, + 0xec6: 0x4000, 0xec7: 0x4000, 0xec8: 0x2000, 0xec9: 0x2000, 0xeca: 0x2000, 0xecb: 0x2000, + 0xecc: 0x2000, 0xecd: 0x2000, 0xece: 0x2000, 0xecf: 0x2000, 0xed0: 0x4000, 0xed1: 0x4000, + 0xed2: 0x4000, 0xed3: 0x4000, 0xed4: 0x4000, 0xed5: 0x4000, 0xed6: 0x4000, 0xed7: 0x4000, + 0xed8: 0x4000, 0xed9: 0x4000, 0xeda: 0x4000, 0xedb: 0x4000, 0xedc: 0x4000, 0xedd: 0x4000, + 0xede: 0x4000, 0xedf: 0x4000, 0xee0: 0x4000, 0xee1: 0x4000, 0xee2: 0x4000, 0xee3: 0x4000, + 0xee4: 0x4000, 0xee5: 0x4000, 0xee6: 0x4000, 0xee7: 0x4000, 0xee8: 0x4000, 0xee9: 0x4000, + 0xeea: 0x4000, 0xeeb: 0x4000, 0xeec: 0x4000, 0xeed: 0x4000, 0xeee: 0x4000, 0xeef: 0x4000, + 0xef0: 0x4000, 0xef1: 0x4000, 0xef2: 0x4000, 0xef3: 0x4000, 0xef4: 0x4000, 0xef5: 0x4000, + 0xef6: 0x4000, 0xef7: 0x4000, 0xef8: 0x4000, 0xef9: 0x4000, 0xefa: 0x4000, 0xefb: 0x4000, + 0xefc: 0x4000, 0xefd: 0x4000, 0xefe: 0x4000, 0xeff: 0x4000, + // Block 0x3c, offset 0xf00 + 0xf00: 0x4000, 0xf01: 0x4000, 0xf02: 0x4000, 0xf03: 0x4000, 0xf04: 0x4000, 0xf05: 0x4000, + 0xf06: 0x4000, 0xf07: 0x4000, 0xf08: 0x4000, 0xf09: 0x4000, 0xf0a: 0x4000, 0xf0b: 0x4000, + 0xf0c: 0x4000, 0xf10: 0x4000, 0xf11: 0x4000, + 0xf12: 0x4000, 0xf13: 0x4000, 0xf14: 0x4000, 0xf15: 0x4000, 0xf16: 0x4000, 0xf17: 0x4000, + 0xf18: 0x4000, 0xf19: 0x4000, 0xf1a: 0x4000, 0xf1b: 0x4000, 0xf1c: 0x4000, 0xf1d: 0x4000, + 0xf1e: 0x4000, 0xf1f: 0x4000, 0xf20: 0x4000, 0xf21: 0x4000, 0xf22: 0x4000, 0xf23: 0x4000, + 0xf24: 0x4000, 0xf25: 0x4000, 0xf26: 0x4000, 0xf27: 0x4000, 0xf28: 0x4000, 0xf29: 0x4000, + 0xf2a: 0x4000, 0xf2b: 0x4000, 0xf2c: 0x4000, 0xf2d: 0x4000, 0xf2e: 0x4000, 0xf2f: 0x4000, + 0xf30: 0x4000, 0xf31: 0x4000, 0xf32: 0x4000, 0xf33: 0x4000, 0xf34: 0x4000, 0xf35: 0x4000, + 0xf36: 0x4000, 0xf37: 0x4000, 0xf38: 0x4000, 0xf39: 0x4000, 0xf3a: 0x4000, 0xf3b: 0x4000, + 0xf3c: 0x4000, 0xf3d: 0x4000, 0xf3e: 0x4000, 0xf3f: 0x4000, + // Block 0x3d, offset 0xf40 + 0xf40: 0x4000, 0xf41: 0x4000, 0xf42: 0x4000, 0xf43: 0x4000, 0xf44: 0x4000, 0xf45: 0x4000, + 0xf46: 0x4000, + // Block 0x3e, offset 0xf80 + 0xfa0: 0x4000, 0xfa1: 0x4000, 0xfa2: 0x4000, 0xfa3: 0x4000, + 0xfa4: 0x4000, 0xfa5: 0x4000, 0xfa6: 0x4000, 0xfa7: 0x4000, 0xfa8: 0x4000, 0xfa9: 0x4000, + 0xfaa: 0x4000, 0xfab: 0x4000, 0xfac: 0x4000, 0xfad: 0x4000, 0xfae: 0x4000, 0xfaf: 0x4000, + 0xfb0: 0x4000, 0xfb1: 0x4000, 0xfb2: 0x4000, 0xfb3: 0x4000, 0xfb4: 0x4000, 0xfb5: 0x4000, + 0xfb6: 0x4000, 0xfb7: 0x4000, 0xfb8: 0x4000, 0xfb9: 0x4000, 0xfba: 0x4000, 0xfbb: 0x4000, + 0xfbc: 0x4000, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x4000, 0xfc1: 0x4000, 0xfc2: 0x4000, 0xfc3: 0x4000, 0xfc4: 0x4000, 0xfc5: 0x4000, + 0xfc6: 0x4000, 0xfc7: 0x4000, 0xfc8: 0x4000, 0xfc9: 0x4000, 0xfca: 0x4000, 0xfcb: 0x4000, + 0xfcc: 0x4000, 0xfcd: 0x4000, 0xfce: 0x4000, 0xfcf: 0x4000, 0xfd0: 0x4000, 0xfd1: 0x4000, + 0xfd2: 0x4000, 0xfd3: 0x4000, 0xfd4: 0x4000, 0xfd5: 0x4000, 0xfd6: 0x4000, 0xfd7: 0x4000, + 0xfd8: 0x4000, 0xfd9: 0x4000, 0xfda: 0x4000, 0xfdb: 0x4000, 0xfdc: 0x4000, 0xfdd: 0x4000, + 0xfde: 0x4000, 0xfdf: 0x4000, 0xfe0: 0x4000, 0xfe1: 0x4000, 0xfe2: 0x4000, 0xfe3: 0x4000, + // Block 0x40, offset 0x1000 + 0x1000: 0x2000, 0x1001: 0x2000, 0x1002: 0x2000, 0x1003: 0x2000, 0x1004: 0x2000, 0x1005: 0x2000, + 0x1006: 0x2000, 0x1007: 0x2000, 0x1008: 0x2000, 0x1009: 0x2000, 0x100a: 0x2000, 0x100b: 0x2000, + 0x100c: 0x2000, 0x100d: 0x2000, 0x100e: 0x2000, 0x100f: 0x2000, 0x1010: 0x4000, 0x1011: 0x4000, + 0x1012: 0x4000, 0x1013: 0x4000, 0x1014: 0x4000, 0x1015: 0x4000, 0x1016: 0x4000, 0x1017: 0x4000, + 0x1018: 0x4000, 0x1019: 0x4000, + 0x1030: 0x4000, 0x1031: 0x4000, 0x1032: 0x4000, 0x1033: 0x4000, 0x1034: 0x4000, 0x1035: 0x4000, + 0x1036: 0x4000, 0x1037: 0x4000, 0x1038: 0x4000, 0x1039: 0x4000, 0x103a: 0x4000, 0x103b: 0x4000, + 0x103c: 0x4000, 0x103d: 0x4000, 0x103e: 0x4000, 0x103f: 0x4000, + // Block 0x41, offset 0x1040 + 0x1040: 0x4000, 0x1041: 0x4000, 0x1042: 0x4000, 0x1043: 0x4000, 0x1044: 0x4000, 0x1045: 0x4000, + 0x1046: 0x4000, 0x1047: 0x4000, 0x1048: 0x4000, 0x1049: 0x4000, 0x104a: 0x4000, 0x104b: 0x4000, + 0x104c: 0x4000, 0x104d: 0x4000, 0x104e: 0x4000, 0x104f: 0x4000, 0x1050: 0x4000, 0x1051: 0x4000, + 0x1052: 0x4000, 0x1054: 0x4000, 0x1055: 0x4000, 0x1056: 0x4000, 0x1057: 0x4000, + 0x1058: 0x4000, 0x1059: 0x4000, 0x105a: 0x4000, 0x105b: 0x4000, 0x105c: 0x4000, 0x105d: 0x4000, + 0x105e: 0x4000, 0x105f: 0x4000, 0x1060: 0x4000, 0x1061: 0x4000, 0x1062: 0x4000, 0x1063: 0x4000, + 0x1064: 0x4000, 0x1065: 0x4000, 0x1066: 0x4000, 0x1068: 0x4000, 0x1069: 0x4000, + 0x106a: 0x4000, 0x106b: 0x4000, + // Block 0x42, offset 0x1080 + 0x1081: 0x9012, 0x1082: 0x9012, 0x1083: 0x9012, 0x1084: 0x9012, 0x1085: 0x9012, + 0x1086: 0x9012, 0x1087: 0x9012, 0x1088: 0x9012, 0x1089: 0x9012, 0x108a: 0x9012, 0x108b: 0x9012, + 0x108c: 0x9012, 0x108d: 0x9012, 0x108e: 0x9012, 0x108f: 0x9012, 0x1090: 0x9012, 0x1091: 0x9012, + 0x1092: 0x9012, 0x1093: 0x9012, 0x1094: 0x9012, 0x1095: 0x9012, 0x1096: 0x9012, 0x1097: 0x9012, + 0x1098: 0x9012, 0x1099: 0x9012, 0x109a: 0x9012, 0x109b: 0x9012, 0x109c: 0x9012, 0x109d: 0x9012, + 0x109e: 0x9012, 0x109f: 0x9012, 0x10a0: 0x9049, 0x10a1: 0x9049, 0x10a2: 0x9049, 0x10a3: 0x9049, + 0x10a4: 0x9049, 0x10a5: 0x9049, 0x10a6: 0x9049, 0x10a7: 0x9049, 0x10a8: 0x9049, 0x10a9: 0x9049, + 0x10aa: 0x9049, 0x10ab: 0x9049, 0x10ac: 0x9049, 0x10ad: 0x9049, 0x10ae: 0x9049, 0x10af: 0x9049, + 0x10b0: 0x9049, 0x10b1: 0x9049, 0x10b2: 0x9049, 0x10b3: 0x9049, 0x10b4: 0x9049, 0x10b5: 0x9049, + 0x10b6: 0x9049, 0x10b7: 0x9049, 0x10b8: 0x9049, 0x10b9: 0x9049, 0x10ba: 0x9049, 0x10bb: 0x9049, + 0x10bc: 0x9049, 0x10bd: 0x9049, 0x10be: 0x9049, 0x10bf: 0x9049, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x9049, 0x10c1: 0x9049, 0x10c2: 0x9049, 0x10c3: 0x9049, 0x10c4: 0x9049, 0x10c5: 0x9049, + 0x10c6: 0x9049, 0x10c7: 0x9049, 0x10c8: 0x9049, 0x10c9: 0x9049, 0x10ca: 0x9049, 0x10cb: 0x9049, + 0x10cc: 0x9049, 0x10cd: 0x9049, 0x10ce: 0x9049, 0x10cf: 0x9049, 0x10d0: 0x9049, 0x10d1: 0x9049, + 0x10d2: 0x9049, 0x10d3: 0x9049, 0x10d4: 0x9049, 0x10d5: 0x9049, 0x10d6: 0x9049, 0x10d7: 0x9049, + 0x10d8: 0x9049, 0x10d9: 0x9049, 0x10da: 0x9049, 0x10db: 0x9049, 0x10dc: 0x9049, 0x10dd: 0x9049, + 0x10de: 0x9049, 0x10df: 0x904a, 0x10e0: 0x904b, 0x10e1: 0xb04c, 0x10e2: 0xb04d, 0x10e3: 0xb04d, + 0x10e4: 0xb04e, 0x10e5: 0xb04f, 0x10e6: 0xb050, 0x10e7: 0xb051, 0x10e8: 0xb052, 0x10e9: 0xb053, + 0x10ea: 0xb054, 0x10eb: 0xb055, 0x10ec: 0xb056, 0x10ed: 0xb057, 0x10ee: 0xb058, 0x10ef: 0xb059, + 0x10f0: 0xb05a, 0x10f1: 0xb05b, 0x10f2: 0xb05c, 0x10f3: 0xb05d, 0x10f4: 0xb05e, 0x10f5: 0xb05f, + 0x10f6: 0xb060, 0x10f7: 0xb061, 0x10f8: 0xb062, 0x10f9: 0xb063, 0x10fa: 0xb064, 0x10fb: 0xb065, + 0x10fc: 0xb052, 0x10fd: 0xb066, 0x10fe: 0xb067, 0x10ff: 0xb055, + // Block 0x44, offset 0x1100 + 0x1100: 0xb068, 0x1101: 0xb069, 0x1102: 0xb06a, 0x1103: 0xb06b, 0x1104: 0xb05a, 0x1105: 0xb056, + 0x1106: 0xb06c, 0x1107: 0xb06d, 0x1108: 0xb06b, 0x1109: 0xb06e, 0x110a: 0xb06b, 0x110b: 0xb06f, + 0x110c: 0xb06f, 0x110d: 0xb070, 0x110e: 0xb070, 0x110f: 0xb071, 0x1110: 0xb056, 0x1111: 0xb072, + 0x1112: 0xb073, 0x1113: 0xb072, 0x1114: 0xb074, 0x1115: 0xb073, 0x1116: 0xb075, 0x1117: 0xb075, + 0x1118: 0xb076, 0x1119: 0xb076, 0x111a: 0xb077, 0x111b: 0xb077, 0x111c: 0xb073, 0x111d: 0xb078, + 0x111e: 0xb079, 0x111f: 0xb067, 0x1120: 0xb07a, 0x1121: 0xb07b, 0x1122: 0xb07b, 0x1123: 0xb07b, + 0x1124: 0xb07b, 0x1125: 0xb07b, 0x1126: 0xb07b, 0x1127: 0xb07b, 0x1128: 0xb07b, 0x1129: 0xb07b, + 0x112a: 0xb07b, 0x112b: 0xb07b, 0x112c: 0xb07b, 0x112d: 0xb07b, 0x112e: 0xb07b, 0x112f: 0xb07b, + 0x1130: 0xb07c, 0x1131: 0xb07c, 0x1132: 0xb07c, 0x1133: 0xb07c, 0x1134: 0xb07c, 0x1135: 0xb07c, + 0x1136: 0xb07c, 0x1137: 0xb07c, 0x1138: 0xb07c, 0x1139: 0xb07c, 0x113a: 0xb07c, 0x113b: 0xb07c, + 0x113c: 0xb07c, 0x113d: 0xb07c, 0x113e: 0xb07c, + // Block 0x45, offset 0x1140 + 0x1142: 0xb07d, 0x1143: 0xb07e, 0x1144: 0xb07f, 0x1145: 0xb080, + 0x1146: 0xb07f, 0x1147: 0xb07e, 0x114a: 0xb081, 0x114b: 0xb082, + 0x114c: 0xb083, 0x114d: 0xb07f, 0x114e: 0xb080, 0x114f: 0xb07f, + 0x1152: 0xb084, 0x1153: 0xb085, 0x1154: 0xb084, 0x1155: 0xb086, 0x1156: 0xb084, 0x1157: 0xb087, + 0x115a: 0xb088, 0x115b: 0xb089, 0x115c: 0xb08a, + 0x1160: 0x908b, 0x1161: 0x908b, 0x1162: 0x908c, 0x1163: 0x908d, + 0x1164: 0x908b, 0x1165: 0x908e, 0x1166: 0x908f, 0x1168: 0xb090, 0x1169: 0xb091, + 0x116a: 0xb092, 0x116b: 0xb091, 0x116c: 0xb093, 0x116d: 0xb094, 0x116e: 0xb095, + 0x117d: 0x2000, + // Block 0x46, offset 0x1180 + 0x11a0: 0x4000, 0x11a1: 0x4000, 0x11a2: 0x4000, 0x11a3: 0x4000, + 0x11a4: 0x4000, + 0x11b0: 0x4000, 0x11b1: 0x4000, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x4000, 0x11c1: 0x4000, 0x11c2: 0x4000, 0x11c3: 0x4000, 0x11c4: 0x4000, 0x11c5: 0x4000, + 0x11c6: 0x4000, 0x11c7: 0x4000, 0x11c8: 0x4000, 0x11c9: 0x4000, 0x11ca: 0x4000, 0x11cb: 0x4000, + 0x11cc: 0x4000, 0x11cd: 0x4000, 0x11ce: 0x4000, 0x11cf: 0x4000, 0x11d0: 0x4000, 0x11d1: 0x4000, + 0x11d2: 0x4000, 0x11d3: 0x4000, 0x11d4: 0x4000, 0x11d5: 0x4000, 0x11d6: 0x4000, 0x11d7: 0x4000, + 0x11d8: 0x4000, 0x11d9: 0x4000, 0x11da: 0x4000, 0x11db: 0x4000, 0x11dc: 0x4000, 0x11dd: 0x4000, + 0x11de: 0x4000, 0x11df: 0x4000, 0x11e0: 0x4000, 0x11e1: 0x4000, 0x11e2: 0x4000, 0x11e3: 0x4000, + 0x11e4: 0x4000, 0x11e5: 0x4000, 0x11e6: 0x4000, 0x11e7: 0x4000, 0x11e8: 0x4000, 0x11e9: 0x4000, + 0x11ea: 0x4000, 0x11eb: 0x4000, 0x11ec: 0x4000, 0x11ed: 0x4000, 0x11ee: 0x4000, 0x11ef: 0x4000, + 0x11f0: 0x4000, 0x11f1: 0x4000, 0x11f2: 0x4000, 0x11f3: 0x4000, 0x11f4: 0x4000, 0x11f5: 0x4000, + 0x11f6: 0x4000, 0x11f7: 0x4000, + // Block 0x48, offset 0x1200 + 0x1200: 0x4000, 0x1201: 0x4000, 0x1202: 0x4000, 0x1203: 0x4000, 0x1204: 0x4000, 0x1205: 0x4000, + 0x1206: 0x4000, 0x1207: 0x4000, 0x1208: 0x4000, 0x1209: 0x4000, 0x120a: 0x4000, 0x120b: 0x4000, + 0x120c: 0x4000, 0x120d: 0x4000, 0x120e: 0x4000, 0x120f: 0x4000, 0x1210: 0x4000, 0x1211: 0x4000, + 0x1212: 0x4000, 0x1213: 0x4000, 0x1214: 0x4000, 0x1215: 0x4000, + // Block 0x49, offset 0x1240 + 0x1240: 0x4000, 0x1241: 0x4000, 0x1242: 0x4000, 0x1243: 0x4000, 0x1244: 0x4000, 0x1245: 0x4000, + 0x1246: 0x4000, 0x1247: 0x4000, 0x1248: 0x4000, + // Block 0x4a, offset 0x1280 + 0x12b0: 0x4000, 0x12b1: 0x4000, 0x12b2: 0x4000, 0x12b3: 0x4000, 0x12b5: 0x4000, + 0x12b6: 0x4000, 0x12b7: 0x4000, 0x12b8: 0x4000, 0x12b9: 0x4000, 0x12ba: 0x4000, 0x12bb: 0x4000, + 0x12bd: 0x4000, 0x12be: 0x4000, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x4000, 0x12c1: 0x4000, 0x12c2: 0x4000, 0x12c3: 0x4000, 0x12c4: 0x4000, 0x12c5: 0x4000, + 0x12c6: 0x4000, 0x12c7: 0x4000, 0x12c8: 0x4000, 0x12c9: 0x4000, 0x12ca: 0x4000, 0x12cb: 0x4000, + 0x12cc: 0x4000, 0x12cd: 0x4000, 0x12ce: 0x4000, 0x12cf: 0x4000, 0x12d0: 0x4000, 0x12d1: 0x4000, + 0x12d2: 0x4000, 0x12d3: 0x4000, 0x12d4: 0x4000, 0x12d5: 0x4000, 0x12d6: 0x4000, 0x12d7: 0x4000, + 0x12d8: 0x4000, 0x12d9: 0x4000, 0x12da: 0x4000, 0x12db: 0x4000, 0x12dc: 0x4000, 0x12dd: 0x4000, + 0x12de: 0x4000, 0x12df: 0x4000, 0x12e0: 0x4000, 0x12e1: 0x4000, 0x12e2: 0x4000, + 0x12f2: 0x4000, + // Block 0x4c, offset 0x1300 + 0x1310: 0x4000, 0x1311: 0x4000, + 0x1312: 0x4000, 0x1315: 0x4000, + 0x1324: 0x4000, 0x1325: 0x4000, 0x1326: 0x4000, 0x1327: 0x4000, + 0x1330: 0x4000, 0x1331: 0x4000, 0x1332: 0x4000, 0x1333: 0x4000, 0x1334: 0x4000, 0x1335: 0x4000, + 0x1336: 0x4000, 0x1337: 0x4000, 0x1338: 0x4000, 0x1339: 0x4000, 0x133a: 0x4000, 0x133b: 0x4000, + 0x133c: 0x4000, 0x133d: 0x4000, 0x133e: 0x4000, 0x133f: 0x4000, + // Block 0x4d, offset 0x1340 + 0x1340: 0x4000, 0x1341: 0x4000, 0x1342: 0x4000, 0x1343: 0x4000, 0x1344: 0x4000, 0x1345: 0x4000, + 0x1346: 0x4000, 0x1347: 0x4000, 0x1348: 0x4000, 0x1349: 0x4000, 0x134a: 0x4000, 0x134b: 0x4000, + 0x134c: 0x4000, 0x134d: 0x4000, 0x134e: 0x4000, 0x134f: 0x4000, 0x1350: 0x4000, 0x1351: 0x4000, + 0x1352: 0x4000, 0x1353: 0x4000, 0x1354: 0x4000, 0x1355: 0x4000, 0x1356: 0x4000, 0x1357: 0x4000, + 0x1358: 0x4000, 0x1359: 0x4000, 0x135a: 0x4000, 0x135b: 0x4000, 0x135c: 0x4000, 0x135d: 0x4000, + 0x135e: 0x4000, 0x135f: 0x4000, 0x1360: 0x4000, 0x1361: 0x4000, 0x1362: 0x4000, 0x1363: 0x4000, + 0x1364: 0x4000, 0x1365: 0x4000, 0x1366: 0x4000, 0x1367: 0x4000, 0x1368: 0x4000, 0x1369: 0x4000, + 0x136a: 0x4000, 0x136b: 0x4000, 0x136c: 0x4000, 0x136d: 0x4000, 0x136e: 0x4000, 0x136f: 0x4000, + 0x1370: 0x4000, 0x1371: 0x4000, 0x1372: 0x4000, 0x1373: 0x4000, 0x1374: 0x4000, 0x1375: 0x4000, + 0x1376: 0x4000, 0x1377: 0x4000, 0x1378: 0x4000, 0x1379: 0x4000, 0x137a: 0x4000, 0x137b: 0x4000, + // Block 0x4e, offset 0x1380 + 0x1384: 0x4000, + // Block 0x4f, offset 0x13c0 + 0x13cf: 0x4000, + // Block 0x50, offset 0x1400 + 0x1400: 0x2000, 0x1401: 0x2000, 0x1402: 0x2000, 0x1403: 0x2000, 0x1404: 0x2000, 0x1405: 0x2000, + 0x1406: 0x2000, 0x1407: 0x2000, 0x1408: 0x2000, 0x1409: 0x2000, 0x140a: 0x2000, + 0x1410: 0x2000, 0x1411: 0x2000, + 0x1412: 0x2000, 0x1413: 0x2000, 0x1414: 0x2000, 0x1415: 0x2000, 0x1416: 0x2000, 0x1417: 0x2000, + 0x1418: 0x2000, 0x1419: 0x2000, 0x141a: 0x2000, 0x141b: 0x2000, 0x141c: 0x2000, 0x141d: 0x2000, + 0x141e: 0x2000, 0x141f: 0x2000, 0x1420: 0x2000, 0x1421: 0x2000, 0x1422: 0x2000, 0x1423: 0x2000, + 0x1424: 0x2000, 0x1425: 0x2000, 0x1426: 0x2000, 0x1427: 0x2000, 0x1428: 0x2000, 0x1429: 0x2000, + 0x142a: 0x2000, 0x142b: 0x2000, 0x142c: 0x2000, 0x142d: 0x2000, + 0x1430: 0x2000, 0x1431: 0x2000, 0x1432: 0x2000, 0x1433: 0x2000, 0x1434: 0x2000, 0x1435: 0x2000, + 0x1436: 0x2000, 0x1437: 0x2000, 0x1438: 0x2000, 0x1439: 0x2000, 0x143a: 0x2000, 0x143b: 0x2000, + 0x143c: 0x2000, 0x143d: 0x2000, 0x143e: 0x2000, 0x143f: 0x2000, + // Block 0x51, offset 0x1440 + 0x1440: 0x2000, 0x1441: 0x2000, 0x1442: 0x2000, 0x1443: 0x2000, 0x1444: 0x2000, 0x1445: 0x2000, + 0x1446: 0x2000, 0x1447: 0x2000, 0x1448: 0x2000, 0x1449: 0x2000, 0x144a: 0x2000, 0x144b: 0x2000, + 0x144c: 0x2000, 0x144d: 0x2000, 0x144e: 0x2000, 0x144f: 0x2000, 0x1450: 0x2000, 0x1451: 0x2000, + 0x1452: 0x2000, 0x1453: 0x2000, 0x1454: 0x2000, 0x1455: 0x2000, 0x1456: 0x2000, 0x1457: 0x2000, + 0x1458: 0x2000, 0x1459: 0x2000, 0x145a: 0x2000, 0x145b: 0x2000, 0x145c: 0x2000, 0x145d: 0x2000, + 0x145e: 0x2000, 0x145f: 0x2000, 0x1460: 0x2000, 0x1461: 0x2000, 0x1462: 0x2000, 0x1463: 0x2000, + 0x1464: 0x2000, 0x1465: 0x2000, 0x1466: 0x2000, 0x1467: 0x2000, 0x1468: 0x2000, 0x1469: 0x2000, + 0x1470: 0x2000, 0x1471: 0x2000, 0x1472: 0x2000, 0x1473: 0x2000, 0x1474: 0x2000, 0x1475: 0x2000, + 0x1476: 0x2000, 0x1477: 0x2000, 0x1478: 0x2000, 0x1479: 0x2000, 0x147a: 0x2000, 0x147b: 0x2000, + 0x147c: 0x2000, 0x147d: 0x2000, 0x147e: 0x2000, 0x147f: 0x2000, + // Block 0x52, offset 0x1480 + 0x1480: 0x2000, 0x1481: 0x2000, 0x1482: 0x2000, 0x1483: 0x2000, 0x1484: 0x2000, 0x1485: 0x2000, + 0x1486: 0x2000, 0x1487: 0x2000, 0x1488: 0x2000, 0x1489: 0x2000, 0x148a: 0x2000, 0x148b: 0x2000, + 0x148c: 0x2000, 0x148d: 0x2000, 0x148e: 0x4000, 0x148f: 0x2000, 0x1490: 0x2000, 0x1491: 0x4000, + 0x1492: 0x4000, 0x1493: 0x4000, 0x1494: 0x4000, 0x1495: 0x4000, 0x1496: 0x4000, 0x1497: 0x4000, + 0x1498: 0x4000, 0x1499: 0x4000, 0x149a: 0x4000, 0x149b: 0x2000, 0x149c: 0x2000, 0x149d: 0x2000, + 0x149e: 0x2000, 0x149f: 0x2000, 0x14a0: 0x2000, 0x14a1: 0x2000, 0x14a2: 0x2000, 0x14a3: 0x2000, + 0x14a4: 0x2000, 0x14a5: 0x2000, 0x14a6: 0x2000, 0x14a7: 0x2000, 0x14a8: 0x2000, 0x14a9: 0x2000, + 0x14aa: 0x2000, 0x14ab: 0x2000, 0x14ac: 0x2000, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x4000, 0x14c1: 0x4000, 0x14c2: 0x4000, + 0x14d0: 0x4000, 0x14d1: 0x4000, + 0x14d2: 0x4000, 0x14d3: 0x4000, 0x14d4: 0x4000, 0x14d5: 0x4000, 0x14d6: 0x4000, 0x14d7: 0x4000, + 0x14d8: 0x4000, 0x14d9: 0x4000, 0x14da: 0x4000, 0x14db: 0x4000, 0x14dc: 0x4000, 0x14dd: 0x4000, + 0x14de: 0x4000, 0x14df: 0x4000, 0x14e0: 0x4000, 0x14e1: 0x4000, 0x14e2: 0x4000, 0x14e3: 0x4000, + 0x14e4: 0x4000, 0x14e5: 0x4000, 0x14e6: 0x4000, 0x14e7: 0x4000, 0x14e8: 0x4000, 0x14e9: 0x4000, + 0x14ea: 0x4000, 0x14eb: 0x4000, 0x14ec: 0x4000, 0x14ed: 0x4000, 0x14ee: 0x4000, 0x14ef: 0x4000, + 0x14f0: 0x4000, 0x14f1: 0x4000, 0x14f2: 0x4000, 0x14f3: 0x4000, 0x14f4: 0x4000, 0x14f5: 0x4000, + 0x14f6: 0x4000, 0x14f7: 0x4000, 0x14f8: 0x4000, 0x14f9: 0x4000, 0x14fa: 0x4000, 0x14fb: 0x4000, + // Block 0x54, offset 0x1500 + 0x1500: 0x4000, 0x1501: 0x4000, 0x1502: 0x4000, 0x1503: 0x4000, 0x1504: 0x4000, 0x1505: 0x4000, + 0x1506: 0x4000, 0x1507: 0x4000, 0x1508: 0x4000, + 0x1510: 0x4000, 0x1511: 0x4000, + 0x1520: 0x4000, 0x1521: 0x4000, 0x1522: 0x4000, 0x1523: 0x4000, + 0x1524: 0x4000, 0x1525: 0x4000, + // Block 0x55, offset 0x1540 + 0x1540: 0x4000, 0x1541: 0x4000, 0x1542: 0x4000, 0x1543: 0x4000, 0x1544: 0x4000, 0x1545: 0x4000, + 0x1546: 0x4000, 0x1547: 0x4000, 0x1548: 0x4000, 0x1549: 0x4000, 0x154a: 0x4000, 0x154b: 0x4000, + 0x154c: 0x4000, 0x154d: 0x4000, 0x154e: 0x4000, 0x154f: 0x4000, 0x1550: 0x4000, 0x1551: 0x4000, + 0x1552: 0x4000, 0x1553: 0x4000, 0x1554: 0x4000, 0x1555: 0x4000, 0x1556: 0x4000, 0x1557: 0x4000, + 0x1558: 0x4000, 0x1559: 0x4000, 0x155a: 0x4000, 0x155b: 0x4000, 0x155c: 0x4000, 0x155d: 0x4000, + 0x155e: 0x4000, 0x155f: 0x4000, 0x1560: 0x4000, + 0x156d: 0x4000, 0x156e: 0x4000, 0x156f: 0x4000, + 0x1570: 0x4000, 0x1571: 0x4000, 0x1572: 0x4000, 0x1573: 0x4000, 0x1574: 0x4000, 0x1575: 0x4000, + 0x1577: 0x4000, 0x1578: 0x4000, 0x1579: 0x4000, 0x157a: 0x4000, 0x157b: 0x4000, + 0x157c: 0x4000, 0x157d: 0x4000, 0x157e: 0x4000, 0x157f: 0x4000, + // Block 0x56, offset 0x1580 + 0x1580: 0x4000, 0x1581: 0x4000, 0x1582: 0x4000, 0x1583: 0x4000, 0x1584: 0x4000, 0x1585: 0x4000, + 0x1586: 0x4000, 0x1587: 0x4000, 0x1588: 0x4000, 0x1589: 0x4000, 0x158a: 0x4000, 0x158b: 0x4000, + 0x158c: 0x4000, 0x158d: 0x4000, 0x158e: 0x4000, 0x158f: 0x4000, 0x1590: 0x4000, 0x1591: 0x4000, + 0x1592: 0x4000, 0x1593: 0x4000, 0x1594: 0x4000, 0x1595: 0x4000, 0x1596: 0x4000, 0x1597: 0x4000, + 0x1598: 0x4000, 0x1599: 0x4000, 0x159a: 0x4000, 0x159b: 0x4000, 0x159c: 0x4000, 0x159d: 0x4000, + 0x159e: 0x4000, 0x159f: 0x4000, 0x15a0: 0x4000, 0x15a1: 0x4000, 0x15a2: 0x4000, 0x15a3: 0x4000, + 0x15a4: 0x4000, 0x15a5: 0x4000, 0x15a6: 0x4000, 0x15a7: 0x4000, 0x15a8: 0x4000, 0x15a9: 0x4000, + 0x15aa: 0x4000, 0x15ab: 0x4000, 0x15ac: 0x4000, 0x15ad: 0x4000, 0x15ae: 0x4000, 0x15af: 0x4000, + 0x15b0: 0x4000, 0x15b1: 0x4000, 0x15b2: 0x4000, 0x15b3: 0x4000, 0x15b4: 0x4000, 0x15b5: 0x4000, + 0x15b6: 0x4000, 0x15b7: 0x4000, 0x15b8: 0x4000, 0x15b9: 0x4000, 0x15ba: 0x4000, 0x15bb: 0x4000, + 0x15bc: 0x4000, 0x15be: 0x4000, 0x15bf: 0x4000, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x4000, 0x15c1: 0x4000, 0x15c2: 0x4000, 0x15c3: 0x4000, 0x15c4: 0x4000, 0x15c5: 0x4000, + 0x15c6: 0x4000, 0x15c7: 0x4000, 0x15c8: 0x4000, 0x15c9: 0x4000, 0x15ca: 0x4000, 0x15cb: 0x4000, + 0x15cc: 0x4000, 0x15cd: 0x4000, 0x15ce: 0x4000, 0x15cf: 0x4000, 0x15d0: 0x4000, 0x15d1: 0x4000, + 0x15d2: 0x4000, 0x15d3: 0x4000, + 0x15e0: 0x4000, 0x15e1: 0x4000, 0x15e2: 0x4000, 0x15e3: 0x4000, + 0x15e4: 0x4000, 0x15e5: 0x4000, 0x15e6: 0x4000, 0x15e7: 0x4000, 0x15e8: 0x4000, 0x15e9: 0x4000, + 0x15ea: 0x4000, 0x15eb: 0x4000, 0x15ec: 0x4000, 0x15ed: 0x4000, 0x15ee: 0x4000, 0x15ef: 0x4000, + 0x15f0: 0x4000, 0x15f1: 0x4000, 0x15f2: 0x4000, 0x15f3: 0x4000, 0x15f4: 0x4000, 0x15f5: 0x4000, + 0x15f6: 0x4000, 0x15f7: 0x4000, 0x15f8: 0x4000, 0x15f9: 0x4000, 0x15fa: 0x4000, 0x15fb: 0x4000, + 0x15fc: 0x4000, 0x15fd: 0x4000, 0x15fe: 0x4000, 0x15ff: 0x4000, + // Block 0x58, offset 0x1600 + 0x1600: 0x4000, 0x1601: 0x4000, 0x1602: 0x4000, 0x1603: 0x4000, 0x1604: 0x4000, 0x1605: 0x4000, + 0x1606: 0x4000, 0x1607: 0x4000, 0x1608: 0x4000, 0x1609: 0x4000, 0x160a: 0x4000, + 0x160f: 0x4000, 0x1610: 0x4000, 0x1611: 0x4000, + 0x1612: 0x4000, 0x1613: 0x4000, + 0x1620: 0x4000, 0x1621: 0x4000, 0x1622: 0x4000, 0x1623: 0x4000, + 0x1624: 0x4000, 0x1625: 0x4000, 0x1626: 0x4000, 0x1627: 0x4000, 0x1628: 0x4000, 0x1629: 0x4000, + 0x162a: 0x4000, 0x162b: 0x4000, 0x162c: 0x4000, 0x162d: 0x4000, 0x162e: 0x4000, 0x162f: 0x4000, + 0x1630: 0x4000, 0x1634: 0x4000, + 0x1638: 0x4000, 0x1639: 0x4000, 0x163a: 0x4000, 0x163b: 0x4000, + 0x163c: 0x4000, 0x163d: 0x4000, 0x163e: 0x4000, 0x163f: 0x4000, + // Block 0x59, offset 0x1640 + 0x1640: 0x4000, 0x1641: 0x4000, 0x1642: 0x4000, 0x1643: 0x4000, 0x1644: 0x4000, 0x1645: 0x4000, + 0x1646: 0x4000, 0x1647: 0x4000, 0x1648: 0x4000, 0x1649: 0x4000, 0x164a: 0x4000, 0x164b: 0x4000, + 0x164c: 0x4000, 0x164d: 0x4000, 0x164e: 0x4000, 0x164f: 0x4000, 0x1650: 0x4000, 0x1651: 0x4000, + 0x1652: 0x4000, 0x1653: 0x4000, 0x1654: 0x4000, 0x1655: 0x4000, 0x1656: 0x4000, 0x1657: 0x4000, + 0x1658: 0x4000, 0x1659: 0x4000, 0x165a: 0x4000, 0x165b: 0x4000, 0x165c: 0x4000, 0x165d: 0x4000, + 0x165e: 0x4000, 0x165f: 0x4000, 0x1660: 0x4000, 0x1661: 0x4000, 0x1662: 0x4000, 0x1663: 0x4000, + 0x1664: 0x4000, 0x1665: 0x4000, 0x1666: 0x4000, 0x1667: 0x4000, 0x1668: 0x4000, 0x1669: 0x4000, + 0x166a: 0x4000, 0x166b: 0x4000, 0x166c: 0x4000, 0x166d: 0x4000, 0x166e: 0x4000, 0x166f: 0x4000, + 0x1670: 0x4000, 0x1671: 0x4000, 0x1672: 0x4000, 0x1673: 0x4000, 0x1674: 0x4000, 0x1675: 0x4000, + 0x1676: 0x4000, 0x1677: 0x4000, 0x1678: 0x4000, 0x1679: 0x4000, 0x167a: 0x4000, 0x167b: 0x4000, + 0x167c: 0x4000, 0x167d: 0x4000, 0x167e: 0x4000, + // Block 0x5a, offset 0x1680 + 0x1680: 0x4000, 0x1682: 0x4000, 0x1683: 0x4000, 0x1684: 0x4000, 0x1685: 0x4000, + 0x1686: 0x4000, 0x1687: 0x4000, 0x1688: 0x4000, 0x1689: 0x4000, 0x168a: 0x4000, 0x168b: 0x4000, + 0x168c: 0x4000, 0x168d: 0x4000, 0x168e: 0x4000, 0x168f: 0x4000, 0x1690: 0x4000, 0x1691: 0x4000, + 0x1692: 0x4000, 0x1693: 0x4000, 0x1694: 0x4000, 0x1695: 0x4000, 0x1696: 0x4000, 0x1697: 0x4000, + 0x1698: 0x4000, 0x1699: 0x4000, 0x169a: 0x4000, 0x169b: 0x4000, 0x169c: 0x4000, 0x169d: 0x4000, + 0x169e: 0x4000, 0x169f: 0x4000, 0x16a0: 0x4000, 0x16a1: 0x4000, 0x16a2: 0x4000, 0x16a3: 0x4000, + 0x16a4: 0x4000, 0x16a5: 0x4000, 0x16a6: 0x4000, 0x16a7: 0x4000, 0x16a8: 0x4000, 0x16a9: 0x4000, + 0x16aa: 0x4000, 0x16ab: 0x4000, 0x16ac: 0x4000, 0x16ad: 0x4000, 0x16ae: 0x4000, 0x16af: 0x4000, + 0x16b0: 0x4000, 0x16b1: 0x4000, 0x16b2: 0x4000, 0x16b3: 0x4000, 0x16b4: 0x4000, 0x16b5: 0x4000, + 0x16b6: 0x4000, 0x16b7: 0x4000, 0x16b8: 0x4000, 0x16b9: 0x4000, 0x16ba: 0x4000, 0x16bb: 0x4000, + 0x16bc: 0x4000, 0x16bd: 0x4000, 0x16be: 0x4000, 0x16bf: 0x4000, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x4000, 0x16c1: 0x4000, 0x16c2: 0x4000, 0x16c3: 0x4000, 0x16c4: 0x4000, 0x16c5: 0x4000, + 0x16c6: 0x4000, 0x16c7: 0x4000, 0x16c8: 0x4000, 0x16c9: 0x4000, 0x16ca: 0x4000, 0x16cb: 0x4000, + 0x16cc: 0x4000, 0x16cd: 0x4000, 0x16ce: 0x4000, 0x16cf: 0x4000, 0x16d0: 0x4000, 0x16d1: 0x4000, + 0x16d2: 0x4000, 0x16d3: 0x4000, 0x16d4: 0x4000, 0x16d5: 0x4000, 0x16d6: 0x4000, 0x16d7: 0x4000, + 0x16d8: 0x4000, 0x16d9: 0x4000, 0x16da: 0x4000, 0x16db: 0x4000, 0x16dc: 0x4000, 0x16dd: 0x4000, + 0x16de: 0x4000, 0x16df: 0x4000, 0x16e0: 0x4000, 0x16e1: 0x4000, 0x16e2: 0x4000, 0x16e3: 0x4000, + 0x16e4: 0x4000, 0x16e5: 0x4000, 0x16e6: 0x4000, 0x16e7: 0x4000, 0x16e8: 0x4000, 0x16e9: 0x4000, + 0x16ea: 0x4000, 0x16eb: 0x4000, 0x16ec: 0x4000, 0x16ed: 0x4000, 0x16ee: 0x4000, 0x16ef: 0x4000, + 0x16f0: 0x4000, 0x16f1: 0x4000, 0x16f2: 0x4000, 0x16f3: 0x4000, 0x16f4: 0x4000, 0x16f5: 0x4000, + 0x16f6: 0x4000, 0x16f7: 0x4000, 0x16f8: 0x4000, 0x16f9: 0x4000, 0x16fa: 0x4000, 0x16fb: 0x4000, + 0x16fc: 0x4000, 0x16ff: 0x4000, + // Block 0x5c, offset 0x1700 + 0x1700: 0x4000, 0x1701: 0x4000, 0x1702: 0x4000, 0x1703: 0x4000, 0x1704: 0x4000, 0x1705: 0x4000, + 0x1706: 0x4000, 0x1707: 0x4000, 0x1708: 0x4000, 0x1709: 0x4000, 0x170a: 0x4000, 0x170b: 0x4000, + 0x170c: 0x4000, 0x170d: 0x4000, 0x170e: 0x4000, 0x170f: 0x4000, 0x1710: 0x4000, 0x1711: 0x4000, + 0x1712: 0x4000, 0x1713: 0x4000, 0x1714: 0x4000, 0x1715: 0x4000, 0x1716: 0x4000, 0x1717: 0x4000, + 0x1718: 0x4000, 0x1719: 0x4000, 0x171a: 0x4000, 0x171b: 0x4000, 0x171c: 0x4000, 0x171d: 0x4000, + 0x171e: 0x4000, 0x171f: 0x4000, 0x1720: 0x4000, 0x1721: 0x4000, 0x1722: 0x4000, 0x1723: 0x4000, + 0x1724: 0x4000, 0x1725: 0x4000, 0x1726: 0x4000, 0x1727: 0x4000, 0x1728: 0x4000, 0x1729: 0x4000, + 0x172a: 0x4000, 0x172b: 0x4000, 0x172c: 0x4000, 0x172d: 0x4000, 0x172e: 0x4000, 0x172f: 0x4000, + 0x1730: 0x4000, 0x1731: 0x4000, 0x1732: 0x4000, 0x1733: 0x4000, 0x1734: 0x4000, 0x1735: 0x4000, + 0x1736: 0x4000, 0x1737: 0x4000, 0x1738: 0x4000, 0x1739: 0x4000, 0x173a: 0x4000, 0x173b: 0x4000, + 0x173c: 0x4000, 0x173d: 0x4000, + // Block 0x5d, offset 0x1740 + 0x174b: 0x4000, + 0x174c: 0x4000, 0x174d: 0x4000, 0x174e: 0x4000, 0x1750: 0x4000, 0x1751: 0x4000, + 0x1752: 0x4000, 0x1753: 0x4000, 0x1754: 0x4000, 0x1755: 0x4000, 0x1756: 0x4000, 0x1757: 0x4000, + 0x1758: 0x4000, 0x1759: 0x4000, 0x175a: 0x4000, 0x175b: 0x4000, 0x175c: 0x4000, 0x175d: 0x4000, + 0x175e: 0x4000, 0x175f: 0x4000, 0x1760: 0x4000, 0x1761: 0x4000, 0x1762: 0x4000, 0x1763: 0x4000, + 0x1764: 0x4000, 0x1765: 0x4000, 0x1766: 0x4000, 0x1767: 0x4000, + 0x177a: 0x4000, + // Block 0x5e, offset 0x1780 + 0x1795: 0x4000, 0x1796: 0x4000, + 0x17a4: 0x4000, + // Block 0x5f, offset 0x17c0 + 0x17fb: 0x4000, + 0x17fc: 0x4000, 0x17fd: 0x4000, 0x17fe: 0x4000, 0x17ff: 0x4000, + // Block 0x60, offset 0x1800 + 0x1800: 0x4000, 0x1801: 0x4000, 0x1802: 0x4000, 0x1803: 0x4000, 0x1804: 0x4000, 0x1805: 0x4000, + 0x1806: 0x4000, 0x1807: 0x4000, 0x1808: 0x4000, 0x1809: 0x4000, 0x180a: 0x4000, 0x180b: 0x4000, + 0x180c: 0x4000, 0x180d: 0x4000, 0x180e: 0x4000, 0x180f: 0x4000, + // Block 0x61, offset 0x1840 + 0x1840: 0x4000, 0x1841: 0x4000, 0x1842: 0x4000, 0x1843: 0x4000, 0x1844: 0x4000, 0x1845: 0x4000, + 0x184c: 0x4000, 0x1850: 0x4000, 0x1851: 0x4000, + 0x1852: 0x4000, 0x1855: 0x4000, 0x1856: 0x4000, 0x1857: 0x4000, + 0x185c: 0x4000, 0x185d: 0x4000, + 0x185e: 0x4000, 0x185f: 0x4000, + 0x186b: 0x4000, 0x186c: 0x4000, + 0x1874: 0x4000, 0x1875: 0x4000, + 0x1876: 0x4000, 0x1877: 0x4000, 0x1878: 0x4000, 0x1879: 0x4000, 0x187a: 0x4000, 0x187b: 0x4000, + 0x187c: 0x4000, + // Block 0x62, offset 0x1880 + 0x18a0: 0x4000, 0x18a1: 0x4000, 0x18a2: 0x4000, 0x18a3: 0x4000, + 0x18a4: 0x4000, 0x18a5: 0x4000, 0x18a6: 0x4000, 0x18a7: 0x4000, 0x18a8: 0x4000, 0x18a9: 0x4000, + 0x18aa: 0x4000, 0x18ab: 0x4000, + 0x18b0: 0x4000, + // Block 0x63, offset 0x18c0 + 0x18cc: 0x4000, 0x18cd: 0x4000, 0x18ce: 0x4000, 0x18cf: 0x4000, 0x18d0: 0x4000, 0x18d1: 0x4000, + 0x18d2: 0x4000, 0x18d3: 0x4000, 0x18d4: 0x4000, 0x18d5: 0x4000, 0x18d6: 0x4000, 0x18d7: 0x4000, + 0x18d8: 0x4000, 0x18d9: 0x4000, 0x18da: 0x4000, 0x18db: 0x4000, 0x18dc: 0x4000, 0x18dd: 0x4000, + 0x18de: 0x4000, 0x18df: 0x4000, 0x18e0: 0x4000, 0x18e1: 0x4000, 0x18e2: 0x4000, 0x18e3: 0x4000, + 0x18e4: 0x4000, 0x18e5: 0x4000, 0x18e6: 0x4000, 0x18e7: 0x4000, 0x18e8: 0x4000, 0x18e9: 0x4000, + 0x18ea: 0x4000, 0x18eb: 0x4000, 0x18ec: 0x4000, 0x18ed: 0x4000, 0x18ee: 0x4000, 0x18ef: 0x4000, + 0x18f0: 0x4000, 0x18f1: 0x4000, 0x18f2: 0x4000, 0x18f3: 0x4000, 0x18f4: 0x4000, 0x18f5: 0x4000, + 0x18f6: 0x4000, 0x18f7: 0x4000, 0x18f8: 0x4000, 0x18f9: 0x4000, 0x18fa: 0x4000, + 0x18fc: 0x4000, 0x18fd: 0x4000, 0x18fe: 0x4000, 0x18ff: 0x4000, + // Block 0x64, offset 0x1900 + 0x1900: 0x4000, 0x1901: 0x4000, 0x1902: 0x4000, 0x1903: 0x4000, 0x1904: 0x4000, 0x1905: 0x4000, + 0x1907: 0x4000, 0x1908: 0x4000, 0x1909: 0x4000, 0x190a: 0x4000, 0x190b: 0x4000, + 0x190c: 0x4000, 0x190d: 0x4000, 0x190e: 0x4000, 0x190f: 0x4000, 0x1910: 0x4000, 0x1911: 0x4000, + 0x1912: 0x4000, 0x1913: 0x4000, 0x1914: 0x4000, 0x1915: 0x4000, 0x1916: 0x4000, 0x1917: 0x4000, + 0x1918: 0x4000, 0x1919: 0x4000, 0x191a: 0x4000, 0x191b: 0x4000, 0x191c: 0x4000, 0x191d: 0x4000, + 0x191e: 0x4000, 0x191f: 0x4000, 0x1920: 0x4000, 0x1921: 0x4000, 0x1922: 0x4000, 0x1923: 0x4000, + 0x1924: 0x4000, 0x1925: 0x4000, 0x1926: 0x4000, 0x1927: 0x4000, 0x1928: 0x4000, 0x1929: 0x4000, + 0x192a: 0x4000, 0x192b: 0x4000, 0x192c: 0x4000, 0x192d: 0x4000, 0x192e: 0x4000, 0x192f: 0x4000, + 0x1930: 0x4000, 0x1931: 0x4000, 0x1932: 0x4000, 0x1933: 0x4000, 0x1934: 0x4000, 0x1935: 0x4000, + 0x1936: 0x4000, 0x1937: 0x4000, 0x1938: 0x4000, 0x1939: 0x4000, 0x193a: 0x4000, 0x193b: 0x4000, + 0x193c: 0x4000, 0x193d: 0x4000, 0x193e: 0x4000, 0x193f: 0x4000, + // Block 0x65, offset 0x1940 + 0x1970: 0x4000, 0x1971: 0x4000, 0x1972: 0x4000, 0x1973: 0x4000, 0x1974: 0x4000, 0x1975: 0x4000, + 0x1976: 0x4000, 0x1977: 0x4000, 0x1978: 0x4000, 0x1979: 0x4000, 0x197a: 0x4000, 0x197b: 0x4000, + 0x197c: 0x4000, + // Block 0x66, offset 0x1980 + 0x1980: 0x4000, 0x1981: 0x4000, 0x1982: 0x4000, 0x1983: 0x4000, 0x1984: 0x4000, 0x1985: 0x4000, + 0x1986: 0x4000, 0x1987: 0x4000, 0x1988: 0x4000, + 0x1990: 0x4000, 0x1991: 0x4000, + 0x1992: 0x4000, 0x1993: 0x4000, 0x1994: 0x4000, 0x1995: 0x4000, 0x1996: 0x4000, 0x1997: 0x4000, + 0x1998: 0x4000, 0x1999: 0x4000, 0x199a: 0x4000, 0x199b: 0x4000, 0x199c: 0x4000, 0x199d: 0x4000, + 0x199e: 0x4000, 0x199f: 0x4000, 0x19a0: 0x4000, 0x19a1: 0x4000, 0x19a2: 0x4000, 0x19a3: 0x4000, + 0x19a4: 0x4000, 0x19a5: 0x4000, 0x19a6: 0x4000, 0x19a7: 0x4000, 0x19a8: 0x4000, 0x19a9: 0x4000, + 0x19aa: 0x4000, 0x19ab: 0x4000, 0x19ac: 0x4000, 0x19ad: 0x4000, 0x19ae: 0x4000, 0x19af: 0x4000, + 0x19b0: 0x4000, 0x19b1: 0x4000, 0x19b2: 0x4000, 0x19b3: 0x4000, 0x19b4: 0x4000, 0x19b5: 0x4000, + 0x19b6: 0x4000, 0x19b7: 0x4000, 0x19b8: 0x4000, 0x19b9: 0x4000, 0x19ba: 0x4000, 0x19bb: 0x4000, + 0x19bc: 0x4000, 0x19bd: 0x4000, 0x19bf: 0x4000, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x4000, 0x19c1: 0x4000, 0x19c2: 0x4000, 0x19c3: 0x4000, 0x19c4: 0x4000, 0x19c5: 0x4000, + 0x19ce: 0x4000, 0x19cf: 0x4000, 0x19d0: 0x4000, 0x19d1: 0x4000, + 0x19d2: 0x4000, 0x19d3: 0x4000, 0x19d4: 0x4000, 0x19d5: 0x4000, 0x19d6: 0x4000, 0x19d7: 0x4000, + 0x19d8: 0x4000, 0x19d9: 0x4000, 0x19da: 0x4000, 0x19db: 0x4000, + 0x19e0: 0x4000, 0x19e1: 0x4000, 0x19e2: 0x4000, 0x19e3: 0x4000, + 0x19e4: 0x4000, 0x19e5: 0x4000, 0x19e6: 0x4000, 0x19e7: 0x4000, 0x19e8: 0x4000, + 0x19f0: 0x4000, 0x19f1: 0x4000, 0x19f2: 0x4000, 0x19f3: 0x4000, 0x19f4: 0x4000, 0x19f5: 0x4000, + 0x19f6: 0x4000, 0x19f7: 0x4000, 0x19f8: 0x4000, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x2000, 0x1a01: 0x2000, 0x1a02: 0x2000, 0x1a03: 0x2000, 0x1a04: 0x2000, 0x1a05: 0x2000, + 0x1a06: 0x2000, 0x1a07: 0x2000, 0x1a08: 0x2000, 0x1a09: 0x2000, 0x1a0a: 0x2000, 0x1a0b: 0x2000, + 0x1a0c: 0x2000, 0x1a0d: 0x2000, 0x1a0e: 0x2000, 0x1a0f: 0x2000, 0x1a10: 0x2000, 0x1a11: 0x2000, + 0x1a12: 0x2000, 0x1a13: 0x2000, 0x1a14: 0x2000, 0x1a15: 0x2000, 0x1a16: 0x2000, 0x1a17: 0x2000, + 0x1a18: 0x2000, 0x1a19: 0x2000, 0x1a1a: 0x2000, 0x1a1b: 0x2000, 0x1a1c: 0x2000, 0x1a1d: 0x2000, + 0x1a1e: 0x2000, 0x1a1f: 0x2000, 0x1a20: 0x2000, 0x1a21: 0x2000, 0x1a22: 0x2000, 0x1a23: 0x2000, + 0x1a24: 0x2000, 0x1a25: 0x2000, 0x1a26: 0x2000, 0x1a27: 0x2000, 0x1a28: 0x2000, 0x1a29: 0x2000, + 0x1a2a: 0x2000, 0x1a2b: 0x2000, 0x1a2c: 0x2000, 0x1a2d: 0x2000, 0x1a2e: 0x2000, 0x1a2f: 0x2000, + 0x1a30: 0x2000, 0x1a31: 0x2000, 0x1a32: 0x2000, 0x1a33: 0x2000, 0x1a34: 0x2000, 0x1a35: 0x2000, + 0x1a36: 0x2000, 0x1a37: 0x2000, 0x1a38: 0x2000, 0x1a39: 0x2000, 0x1a3a: 0x2000, 0x1a3b: 0x2000, + 0x1a3c: 0x2000, 0x1a3d: 0x2000, +} + +// widthIndex: 23 blocks, 1472 entries, 1472 bytes +// Block 0 is the zero block. +var widthIndex = [1472]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc7: 0x05, + 0xc9: 0x06, 0xcb: 0x07, 0xcc: 0x08, 0xcd: 0x09, 0xce: 0x0a, 0xcf: 0x0b, + 0xd0: 0x0c, 0xd1: 0x0d, + 0xe1: 0x02, 0xe2: 0x03, 0xe3: 0x04, 0xe4: 0x05, 0xe5: 0x06, 0xe6: 0x06, 0xe7: 0x06, + 0xe8: 0x06, 0xe9: 0x06, 0xea: 0x07, 0xeb: 0x06, 0xec: 0x06, 0xed: 0x08, 0xee: 0x09, 0xef: 0x0a, + 0xf0: 0x10, 0xf3: 0x13, 0xf4: 0x14, + // Block 0x4, offset 0x100 + 0x104: 0x0e, 0x105: 0x0f, + // Block 0x5, offset 0x140 + 0x140: 0x10, 0x141: 0x11, 0x142: 0x12, 0x144: 0x13, 0x145: 0x14, 0x146: 0x15, 0x147: 0x16, + 0x148: 0x17, 0x149: 0x18, 0x14a: 0x19, 0x14c: 0x1a, 0x14f: 0x1b, + 0x151: 0x1c, 0x152: 0x08, 0x153: 0x1d, 0x154: 0x1e, 0x155: 0x1f, 0x156: 0x20, 0x157: 0x21, + 0x158: 0x22, 0x159: 0x23, 0x15a: 0x24, 0x15b: 0x25, 0x15c: 0x26, 0x15d: 0x27, 0x15e: 0x28, 0x15f: 0x29, + 0x166: 0x2a, + 0x16c: 0x2b, 0x16d: 0x2c, + 0x17a: 0x2d, 0x17b: 0x2e, 0x17c: 0x0e, 0x17d: 0x0e, 0x17e: 0x0e, 0x17f: 0x2f, + // Block 0x6, offset 0x180 + 0x180: 0x30, 0x181: 0x31, 0x182: 0x32, 0x183: 0x33, 0x184: 0x34, 0x185: 0x35, 0x186: 0x36, 0x187: 0x37, + 0x188: 0x38, 0x189: 0x39, 0x18a: 0x0e, 0x18b: 0x0e, 0x18c: 0x0e, 0x18d: 0x0e, 0x18e: 0x0e, 0x18f: 0x0e, + 0x190: 0x0e, 0x191: 0x0e, 0x192: 0x0e, 0x193: 0x0e, 0x194: 0x0e, 0x195: 0x0e, 0x196: 0x0e, 0x197: 0x0e, + 0x198: 0x0e, 0x199: 0x0e, 0x19a: 0x0e, 0x19b: 0x0e, 0x19c: 0x0e, 0x19d: 0x0e, 0x19e: 0x0e, 0x19f: 0x0e, + 0x1a0: 0x0e, 0x1a1: 0x0e, 0x1a2: 0x0e, 0x1a3: 0x0e, 0x1a4: 0x0e, 0x1a5: 0x0e, 0x1a6: 0x0e, 0x1a7: 0x0e, + 0x1a8: 0x0e, 0x1a9: 0x0e, 0x1aa: 0x0e, 0x1ab: 0x0e, 0x1ac: 0x0e, 0x1ad: 0x0e, 0x1ae: 0x0e, 0x1af: 0x0e, + 0x1b0: 0x0e, 0x1b1: 0x0e, 0x1b2: 0x0e, 0x1b3: 0x0e, 0x1b4: 0x0e, 0x1b5: 0x0e, 0x1b6: 0x0e, 0x1b7: 0x0e, + 0x1b8: 0x0e, 0x1b9: 0x0e, 0x1ba: 0x0e, 0x1bb: 0x0e, 0x1bc: 0x0e, 0x1bd: 0x0e, 0x1be: 0x0e, 0x1bf: 0x0e, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0e, 0x1c1: 0x0e, 0x1c2: 0x0e, 0x1c3: 0x0e, 0x1c4: 0x0e, 0x1c5: 0x0e, 0x1c6: 0x0e, 0x1c7: 0x0e, + 0x1c8: 0x0e, 0x1c9: 0x0e, 0x1ca: 0x0e, 0x1cb: 0x0e, 0x1cc: 0x0e, 0x1cd: 0x0e, 0x1ce: 0x0e, 0x1cf: 0x0e, + 0x1d0: 0x0e, 0x1d1: 0x0e, 0x1d2: 0x0e, 0x1d3: 0x0e, 0x1d4: 0x0e, 0x1d5: 0x0e, 0x1d6: 0x0e, 0x1d7: 0x0e, + 0x1d8: 0x0e, 0x1d9: 0x0e, 0x1da: 0x0e, 0x1db: 0x0e, 0x1dc: 0x0e, 0x1dd: 0x0e, 0x1de: 0x0e, 0x1df: 0x0e, + 0x1e0: 0x0e, 0x1e1: 0x0e, 0x1e2: 0x0e, 0x1e3: 0x0e, 0x1e4: 0x0e, 0x1e5: 0x0e, 0x1e6: 0x0e, 0x1e7: 0x0e, + 0x1e8: 0x0e, 0x1e9: 0x0e, 0x1ea: 0x0e, 0x1eb: 0x0e, 0x1ec: 0x0e, 0x1ed: 0x0e, 0x1ee: 0x0e, 0x1ef: 0x0e, + 0x1f0: 0x0e, 0x1f1: 0x0e, 0x1f2: 0x0e, 0x1f3: 0x0e, 0x1f4: 0x0e, 0x1f5: 0x0e, 0x1f6: 0x0e, + 0x1f8: 0x0e, 0x1f9: 0x0e, 0x1fa: 0x0e, 0x1fb: 0x0e, 0x1fc: 0x0e, 0x1fd: 0x0e, 0x1fe: 0x0e, 0x1ff: 0x0e, + // Block 0x8, offset 0x200 + 0x200: 0x0e, 0x201: 0x0e, 0x202: 0x0e, 0x203: 0x0e, 0x204: 0x0e, 0x205: 0x0e, 0x206: 0x0e, 0x207: 0x0e, + 0x208: 0x0e, 0x209: 0x0e, 0x20a: 0x0e, 0x20b: 0x0e, 0x20c: 0x0e, 0x20d: 0x0e, 0x20e: 0x0e, 0x20f: 0x0e, + 0x210: 0x0e, 0x211: 0x0e, 0x212: 0x0e, 0x213: 0x0e, 0x214: 0x0e, 0x215: 0x0e, 0x216: 0x0e, 0x217: 0x0e, + 0x218: 0x0e, 0x219: 0x0e, 0x21a: 0x0e, 0x21b: 0x0e, 0x21c: 0x0e, 0x21d: 0x0e, 0x21e: 0x0e, 0x21f: 0x0e, + 0x220: 0x0e, 0x221: 0x0e, 0x222: 0x0e, 0x223: 0x0e, 0x224: 0x0e, 0x225: 0x0e, 0x226: 0x0e, 0x227: 0x0e, + 0x228: 0x0e, 0x229: 0x0e, 0x22a: 0x0e, 0x22b: 0x0e, 0x22c: 0x0e, 0x22d: 0x0e, 0x22e: 0x0e, 0x22f: 0x0e, + 0x230: 0x0e, 0x231: 0x0e, 0x232: 0x0e, 0x233: 0x0e, 0x234: 0x0e, 0x235: 0x0e, 0x236: 0x0e, 0x237: 0x0e, + 0x238: 0x0e, 0x239: 0x0e, 0x23a: 0x0e, 0x23b: 0x0e, 0x23c: 0x0e, 0x23d: 0x0e, 0x23e: 0x0e, 0x23f: 0x0e, + // Block 0x9, offset 0x240 + 0x240: 0x0e, 0x241: 0x0e, 0x242: 0x0e, 0x243: 0x0e, 0x244: 0x0e, 0x245: 0x0e, 0x246: 0x0e, 0x247: 0x0e, + 0x248: 0x0e, 0x249: 0x0e, 0x24a: 0x0e, 0x24b: 0x0e, 0x24c: 0x0e, 0x24d: 0x0e, 0x24e: 0x0e, 0x24f: 0x0e, + 0x250: 0x0e, 0x251: 0x0e, 0x252: 0x3a, 0x253: 0x3b, + 0x265: 0x3c, + 0x270: 0x0e, 0x271: 0x0e, 0x272: 0x0e, 0x273: 0x0e, 0x274: 0x0e, 0x275: 0x0e, 0x276: 0x0e, 0x277: 0x0e, + 0x278: 0x0e, 0x279: 0x0e, 0x27a: 0x0e, 0x27b: 0x0e, 0x27c: 0x0e, 0x27d: 0x0e, 0x27e: 0x0e, 0x27f: 0x0e, + // Block 0xa, offset 0x280 + 0x280: 0x0e, 0x281: 0x0e, 0x282: 0x0e, 0x283: 0x0e, 0x284: 0x0e, 0x285: 0x0e, 0x286: 0x0e, 0x287: 0x0e, + 0x288: 0x0e, 0x289: 0x0e, 0x28a: 0x0e, 0x28b: 0x0e, 0x28c: 0x0e, 0x28d: 0x0e, 0x28e: 0x0e, 0x28f: 0x0e, + 0x290: 0x0e, 0x291: 0x0e, 0x292: 0x0e, 0x293: 0x0e, 0x294: 0x0e, 0x295: 0x0e, 0x296: 0x0e, 0x297: 0x0e, + 0x298: 0x0e, 0x299: 0x0e, 0x29a: 0x0e, 0x29b: 0x0e, 0x29c: 0x0e, 0x29d: 0x0e, 0x29e: 0x3d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x08, 0x2c1: 0x08, 0x2c2: 0x08, 0x2c3: 0x08, 0x2c4: 0x08, 0x2c5: 0x08, 0x2c6: 0x08, 0x2c7: 0x08, + 0x2c8: 0x08, 0x2c9: 0x08, 0x2ca: 0x08, 0x2cb: 0x08, 0x2cc: 0x08, 0x2cd: 0x08, 0x2ce: 0x08, 0x2cf: 0x08, + 0x2d0: 0x08, 0x2d1: 0x08, 0x2d2: 0x08, 0x2d3: 0x08, 0x2d4: 0x08, 0x2d5: 0x08, 0x2d6: 0x08, 0x2d7: 0x08, + 0x2d8: 0x08, 0x2d9: 0x08, 0x2da: 0x08, 0x2db: 0x08, 0x2dc: 0x08, 0x2dd: 0x08, 0x2de: 0x08, 0x2df: 0x08, + 0x2e0: 0x08, 0x2e1: 0x08, 0x2e2: 0x08, 0x2e3: 0x08, 0x2e4: 0x08, 0x2e5: 0x08, 0x2e6: 0x08, 0x2e7: 0x08, + 0x2e8: 0x08, 0x2e9: 0x08, 0x2ea: 0x08, 0x2eb: 0x08, 0x2ec: 0x08, 0x2ed: 0x08, 0x2ee: 0x08, 0x2ef: 0x08, + 0x2f0: 0x08, 0x2f1: 0x08, 0x2f2: 0x08, 0x2f3: 0x08, 0x2f4: 0x08, 0x2f5: 0x08, 0x2f6: 0x08, 0x2f7: 0x08, + 0x2f8: 0x08, 0x2f9: 0x08, 0x2fa: 0x08, 0x2fb: 0x08, 0x2fc: 0x08, 0x2fd: 0x08, 0x2fe: 0x08, 0x2ff: 0x08, + // Block 0xc, offset 0x300 + 0x300: 0x08, 0x301: 0x08, 0x302: 0x08, 0x303: 0x08, 0x304: 0x08, 0x305: 0x08, 0x306: 0x08, 0x307: 0x08, + 0x308: 0x08, 0x309: 0x08, 0x30a: 0x08, 0x30b: 0x08, 0x30c: 0x08, 0x30d: 0x08, 0x30e: 0x08, 0x30f: 0x08, + 0x310: 0x08, 0x311: 0x08, 0x312: 0x08, 0x313: 0x08, 0x314: 0x08, 0x315: 0x08, 0x316: 0x08, 0x317: 0x08, + 0x318: 0x08, 0x319: 0x08, 0x31a: 0x08, 0x31b: 0x08, 0x31c: 0x08, 0x31d: 0x08, 0x31e: 0x08, 0x31f: 0x08, + 0x320: 0x08, 0x321: 0x08, 0x322: 0x08, 0x323: 0x08, 0x324: 0x0e, 0x325: 0x0e, 0x326: 0x0e, 0x327: 0x0e, + 0x328: 0x0e, 0x329: 0x0e, 0x32a: 0x0e, 0x32b: 0x0e, + 0x338: 0x3e, 0x339: 0x3f, 0x33c: 0x40, 0x33d: 0x41, 0x33e: 0x42, 0x33f: 0x43, + // Block 0xd, offset 0x340 + 0x37f: 0x44, + // Block 0xe, offset 0x380 + 0x380: 0x0e, 0x381: 0x0e, 0x382: 0x0e, 0x383: 0x0e, 0x384: 0x0e, 0x385: 0x0e, 0x386: 0x0e, 0x387: 0x0e, + 0x388: 0x0e, 0x389: 0x0e, 0x38a: 0x0e, 0x38b: 0x0e, 0x38c: 0x0e, 0x38d: 0x0e, 0x38e: 0x0e, 0x38f: 0x0e, + 0x390: 0x0e, 0x391: 0x0e, 0x392: 0x0e, 0x393: 0x0e, 0x394: 0x0e, 0x395: 0x0e, 0x396: 0x0e, 0x397: 0x0e, + 0x398: 0x0e, 0x399: 0x0e, 0x39a: 0x0e, 0x39b: 0x0e, 0x39c: 0x0e, 0x39d: 0x0e, 0x39e: 0x0e, 0x39f: 0x45, + 0x3a0: 0x0e, 0x3a1: 0x0e, 0x3a2: 0x0e, 0x3a3: 0x0e, 0x3a4: 0x0e, 0x3a5: 0x0e, 0x3a6: 0x0e, 0x3a7: 0x0e, + 0x3a8: 0x0e, 0x3a9: 0x0e, 0x3aa: 0x0e, 0x3ab: 0x0e, 0x3ac: 0x0e, 0x3ad: 0x0e, 0x3ae: 0x0e, 0x3af: 0x0e, + 0x3b0: 0x0e, 0x3b1: 0x0e, 0x3b2: 0x0e, 0x3b3: 0x46, 0x3b4: 0x47, + // Block 0xf, offset 0x3c0 + 0x3ff: 0x48, + // Block 0x10, offset 0x400 + 0x400: 0x0e, 0x401: 0x0e, 0x402: 0x0e, 0x403: 0x0e, 0x404: 0x49, 0x405: 0x4a, 0x406: 0x0e, 0x407: 0x0e, + 0x408: 0x0e, 0x409: 0x0e, 0x40a: 0x0e, 0x40b: 0x4b, + // Block 0x11, offset 0x440 + 0x440: 0x4c, 0x443: 0x4d, 0x444: 0x4e, 0x445: 0x4f, 0x446: 0x50, + 0x448: 0x51, 0x449: 0x52, 0x44c: 0x53, 0x44d: 0x54, 0x44e: 0x55, 0x44f: 0x56, + 0x450: 0x57, 0x451: 0x58, 0x452: 0x0e, 0x453: 0x59, 0x454: 0x5a, 0x455: 0x5b, 0x456: 0x5c, 0x457: 0x5d, + 0x458: 0x0e, 0x459: 0x5e, 0x45a: 0x0e, 0x45b: 0x5f, 0x45f: 0x60, + 0x464: 0x61, 0x465: 0x62, 0x466: 0x0e, 0x467: 0x0e, + 0x469: 0x63, 0x46a: 0x64, 0x46b: 0x65, + // Block 0x12, offset 0x480 + 0x496: 0x0b, 0x497: 0x06, + 0x498: 0x0c, 0x49a: 0x0d, 0x49b: 0x0e, 0x49f: 0x0f, + 0x4a0: 0x06, 0x4a1: 0x06, 0x4a2: 0x06, 0x4a3: 0x06, 0x4a4: 0x06, 0x4a5: 0x06, 0x4a6: 0x06, 0x4a7: 0x06, + 0x4a8: 0x06, 0x4a9: 0x06, 0x4aa: 0x06, 0x4ab: 0x06, 0x4ac: 0x06, 0x4ad: 0x06, 0x4ae: 0x06, 0x4af: 0x06, + 0x4b0: 0x06, 0x4b1: 0x06, 0x4b2: 0x06, 0x4b3: 0x06, 0x4b4: 0x06, 0x4b5: 0x06, 0x4b6: 0x06, 0x4b7: 0x06, + 0x4b8: 0x06, 0x4b9: 0x06, 0x4ba: 0x06, 0x4bb: 0x06, 0x4bc: 0x06, 0x4bd: 0x06, 0x4be: 0x06, 0x4bf: 0x06, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x08, 0x4c5: 0x08, 0x4c6: 0x08, 0x4c7: 0x09, + // Block 0x14, offset 0x500 + 0x500: 0x08, 0x501: 0x08, 0x502: 0x08, 0x503: 0x08, 0x504: 0x08, 0x505: 0x08, 0x506: 0x08, 0x507: 0x08, + 0x508: 0x08, 0x509: 0x08, 0x50a: 0x08, 0x50b: 0x08, 0x50c: 0x08, 0x50d: 0x08, 0x50e: 0x08, 0x50f: 0x08, + 0x510: 0x08, 0x511: 0x08, 0x512: 0x08, 0x513: 0x08, 0x514: 0x08, 0x515: 0x08, 0x516: 0x08, 0x517: 0x08, + 0x518: 0x08, 0x519: 0x08, 0x51a: 0x08, 0x51b: 0x08, 0x51c: 0x08, 0x51d: 0x08, 0x51e: 0x08, 0x51f: 0x08, + 0x520: 0x08, 0x521: 0x08, 0x522: 0x08, 0x523: 0x08, 0x524: 0x08, 0x525: 0x08, 0x526: 0x08, 0x527: 0x08, + 0x528: 0x08, 0x529: 0x08, 0x52a: 0x08, 0x52b: 0x08, 0x52c: 0x08, 0x52d: 0x08, 0x52e: 0x08, 0x52f: 0x08, + 0x530: 0x08, 0x531: 0x08, 0x532: 0x08, 0x533: 0x08, 0x534: 0x08, 0x535: 0x08, 0x536: 0x08, 0x537: 0x08, + 0x538: 0x08, 0x539: 0x08, 0x53a: 0x08, 0x53b: 0x08, 0x53c: 0x08, 0x53d: 0x08, 0x53e: 0x08, 0x53f: 0x66, + // Block 0x15, offset 0x540 + 0x560: 0x11, + 0x570: 0x09, 0x571: 0x09, 0x572: 0x09, 0x573: 0x09, 0x574: 0x09, 0x575: 0x09, 0x576: 0x09, 0x577: 0x09, + 0x578: 0x09, 0x579: 0x09, 0x57a: 0x09, 0x57b: 0x09, 0x57c: 0x09, 0x57d: 0x09, 0x57e: 0x09, 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x580: 0x09, 0x581: 0x09, 0x582: 0x09, 0x583: 0x09, 0x584: 0x09, 0x585: 0x09, 0x586: 0x09, 0x587: 0x09, + 0x588: 0x09, 0x589: 0x09, 0x58a: 0x09, 0x58b: 0x09, 0x58c: 0x09, 0x58d: 0x09, 0x58e: 0x09, 0x58f: 0x12, +} + +// inverseData contains 4-byte entries of the following format: +// +// <0 padding> +// +// The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the +// UTF-8 encoding of the original rune. Mappings often have the following +// pattern: +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// +// By xor-ing the last byte the same entry can be shared by many mappings. This +// reduces the total number of distinct entries by about two thirds. +// The resulting entry for the aforementioned mappings is +// +// { 0x01, 0xE0, 0x00, 0x00 } +// +// Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get +// +// E0 ^ A1 = 41. +// +// Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get +// +// E0 ^ A2 = 42. +// +// Note that because of the xor-ing, the byte sequence stored in the entry is +// not valid UTF-8. +var inverseData = [150][4]byte{ + {0x00, 0x00, 0x00, 0x00}, + {0x03, 0xe3, 0x80, 0xa0}, + {0x03, 0xef, 0xbc, 0xa0}, + {0x03, 0xef, 0xbc, 0xe0}, + {0x03, 0xef, 0xbd, 0xe0}, + {0x03, 0xef, 0xbf, 0x02}, + {0x03, 0xef, 0xbf, 0x00}, + {0x03, 0xef, 0xbf, 0x0e}, + {0x03, 0xef, 0xbf, 0x0c}, + {0x03, 0xef, 0xbf, 0x0f}, + {0x03, 0xef, 0xbf, 0x39}, + {0x03, 0xef, 0xbf, 0x3b}, + {0x03, 0xef, 0xbf, 0x3f}, + {0x03, 0xef, 0xbf, 0x2a}, + {0x03, 0xef, 0xbf, 0x0d}, + {0x03, 0xef, 0xbf, 0x25}, + {0x03, 0xef, 0xbd, 0x1a}, + {0x03, 0xef, 0xbd, 0x26}, + {0x01, 0xa0, 0x00, 0x00}, + {0x03, 0xef, 0xbd, 0x25}, + {0x03, 0xef, 0xbd, 0x23}, + {0x03, 0xef, 0xbd, 0x2e}, + {0x03, 0xef, 0xbe, 0x07}, + {0x03, 0xef, 0xbe, 0x05}, + {0x03, 0xef, 0xbd, 0x06}, + {0x03, 0xef, 0xbd, 0x13}, + {0x03, 0xef, 0xbd, 0x0b}, + {0x03, 0xef, 0xbd, 0x16}, + {0x03, 0xef, 0xbd, 0x0c}, + {0x03, 0xef, 0xbd, 0x15}, + {0x03, 0xef, 0xbd, 0x0d}, + {0x03, 0xef, 0xbd, 0x1c}, + {0x03, 0xef, 0xbd, 0x02}, + {0x03, 0xef, 0xbd, 0x1f}, + {0x03, 0xef, 0xbd, 0x1d}, + {0x03, 0xef, 0xbd, 0x17}, + {0x03, 0xef, 0xbd, 0x08}, + {0x03, 0xef, 0xbd, 0x09}, + {0x03, 0xef, 0xbd, 0x0e}, + {0x03, 0xef, 0xbd, 0x04}, + {0x03, 0xef, 0xbd, 0x05}, + {0x03, 0xef, 0xbe, 0x3f}, + {0x03, 0xef, 0xbe, 0x00}, + {0x03, 0xef, 0xbd, 0x2c}, + {0x03, 0xef, 0xbe, 0x06}, + {0x03, 0xef, 0xbe, 0x0c}, + {0x03, 0xef, 0xbe, 0x0f}, + {0x03, 0xef, 0xbe, 0x0d}, + {0x03, 0xef, 0xbe, 0x0b}, + {0x03, 0xef, 0xbe, 0x19}, + {0x03, 0xef, 0xbe, 0x15}, + {0x03, 0xef, 0xbe, 0x11}, + {0x03, 0xef, 0xbe, 0x31}, + {0x03, 0xef, 0xbe, 0x33}, + {0x03, 0xef, 0xbd, 0x0f}, + {0x03, 0xef, 0xbe, 0x30}, + {0x03, 0xef, 0xbe, 0x3e}, + {0x03, 0xef, 0xbe, 0x32}, + {0x03, 0xef, 0xbe, 0x36}, + {0x03, 0xef, 0xbd, 0x14}, + {0x03, 0xef, 0xbe, 0x2e}, + {0x03, 0xef, 0xbd, 0x1e}, + {0x03, 0xef, 0xbe, 0x10}, + {0x03, 0xef, 0xbf, 0x13}, + {0x03, 0xef, 0xbf, 0x15}, + {0x03, 0xef, 0xbf, 0x17}, + {0x03, 0xef, 0xbf, 0x1f}, + {0x03, 0xef, 0xbf, 0x1d}, + {0x03, 0xef, 0xbf, 0x1b}, + {0x03, 0xef, 0xbf, 0x09}, + {0x03, 0xef, 0xbf, 0x0b}, + {0x03, 0xef, 0xbf, 0x37}, + {0x03, 0xef, 0xbe, 0x04}, + {0x01, 0xe0, 0x00, 0x00}, + {0x03, 0xe2, 0xa6, 0x1a}, + {0x03, 0xe2, 0xa6, 0x26}, + {0x03, 0xe3, 0x80, 0x23}, + {0x03, 0xe3, 0x80, 0x2e}, + {0x03, 0xe3, 0x80, 0x25}, + {0x03, 0xe3, 0x83, 0x1e}, + {0x03, 0xe3, 0x83, 0x14}, + {0x03, 0xe3, 0x82, 0x06}, + {0x03, 0xe3, 0x82, 0x0b}, + {0x03, 0xe3, 0x82, 0x0c}, + {0x03, 0xe3, 0x82, 0x0d}, + {0x03, 0xe3, 0x82, 0x02}, + {0x03, 0xe3, 0x83, 0x0f}, + {0x03, 0xe3, 0x83, 0x08}, + {0x03, 0xe3, 0x83, 0x09}, + {0x03, 0xe3, 0x83, 0x2c}, + {0x03, 0xe3, 0x83, 0x0c}, + {0x03, 0xe3, 0x82, 0x13}, + {0x03, 0xe3, 0x82, 0x16}, + {0x03, 0xe3, 0x82, 0x15}, + {0x03, 0xe3, 0x82, 0x1c}, + {0x03, 0xe3, 0x82, 0x1f}, + {0x03, 0xe3, 0x82, 0x1d}, + {0x03, 0xe3, 0x82, 0x1a}, + {0x03, 0xe3, 0x82, 0x17}, + {0x03, 0xe3, 0x82, 0x08}, + {0x03, 0xe3, 0x82, 0x09}, + {0x03, 0xe3, 0x82, 0x0e}, + {0x03, 0xe3, 0x82, 0x04}, + {0x03, 0xe3, 0x82, 0x05}, + {0x03, 0xe3, 0x82, 0x3f}, + {0x03, 0xe3, 0x83, 0x00}, + {0x03, 0xe3, 0x83, 0x06}, + {0x03, 0xe3, 0x83, 0x05}, + {0x03, 0xe3, 0x83, 0x0d}, + {0x03, 0xe3, 0x83, 0x0b}, + {0x03, 0xe3, 0x83, 0x07}, + {0x03, 0xe3, 0x83, 0x19}, + {0x03, 0xe3, 0x83, 0x15}, + {0x03, 0xe3, 0x83, 0x11}, + {0x03, 0xe3, 0x83, 0x31}, + {0x03, 0xe3, 0x83, 0x33}, + {0x03, 0xe3, 0x83, 0x30}, + {0x03, 0xe3, 0x83, 0x3e}, + {0x03, 0xe3, 0x83, 0x32}, + {0x03, 0xe3, 0x83, 0x36}, + {0x03, 0xe3, 0x83, 0x2e}, + {0x03, 0xe3, 0x82, 0x07}, + {0x03, 0xe3, 0x85, 0x04}, + {0x03, 0xe3, 0x84, 0x10}, + {0x03, 0xe3, 0x85, 0x30}, + {0x03, 0xe3, 0x85, 0x0d}, + {0x03, 0xe3, 0x85, 0x13}, + {0x03, 0xe3, 0x85, 0x15}, + {0x03, 0xe3, 0x85, 0x17}, + {0x03, 0xe3, 0x85, 0x1f}, + {0x03, 0xe3, 0x85, 0x1d}, + {0x03, 0xe3, 0x85, 0x1b}, + {0x03, 0xe3, 0x85, 0x09}, + {0x03, 0xe3, 0x85, 0x0f}, + {0x03, 0xe3, 0x85, 0x0b}, + {0x03, 0xe3, 0x85, 0x37}, + {0x03, 0xe3, 0x85, 0x3b}, + {0x03, 0xe3, 0x85, 0x39}, + {0x03, 0xe3, 0x85, 0x3f}, + {0x02, 0xc2, 0x02, 0x00}, + {0x02, 0xc2, 0x0e, 0x00}, + {0x02, 0xc2, 0x0c, 0x00}, + {0x02, 0xc2, 0x00, 0x00}, + {0x03, 0xe2, 0x82, 0x0f}, + {0x03, 0xe2, 0x94, 0x2a}, + {0x03, 0xe2, 0x86, 0x39}, + {0x03, 0xe2, 0x86, 0x3b}, + {0x03, 0xe2, 0x86, 0x3f}, + {0x03, 0xe2, 0x96, 0x0d}, + {0x03, 0xe2, 0x97, 0x25}, +} + +// Total table size 15512 bytes (15KiB) diff --git a/vendor/modules.txt b/vendor/modules.txt index 484153a0a..8a739df28 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -140,8 +140,8 @@ github.com/aws/smithy-go/waiter # github.com/bmatcuk/doublestar/v4 v4.6.1 ## explicit; go 1.16 github.com/bmatcuk/doublestar/v4 -# github.com/containerd/containerd v1.6.18 -## explicit; go 1.17 +# github.com/containerd/containerd v1.6.26 +## explicit; go 1.19 github.com/containerd/containerd/pkg/userns # github.com/davecgh/go-spew v1.1.1 ## explicit @@ -178,7 +178,7 @@ github.com/docker/go-units # github.com/fatih/color v1.16.0 ## explicit; go 1.17 github.com/fatih/color -# github.com/fsouza/go-dockerclient v1.10.0 +# github.com/fsouza/go-dockerclient v1.10.1 ## explicit; go 1.20 github.com/fsouza/go-dockerclient # github.com/gogo/protobuf v1.3.2 @@ -227,11 +227,13 @@ github.com/jackc/puddle # github.com/jmespath/go-jmespath v0.4.0 ## explicit; go 1.14 github.com/jmespath/go-jmespath -# github.com/klauspost/compress v1.11.13 -## explicit; go 1.13 +# github.com/klauspost/compress v1.15.9 +## explicit; go 1.16 +github.com/klauspost/compress github.com/klauspost/compress/fse github.com/klauspost/compress/huff0 -github.com/klauspost/compress/snappy +github.com/klauspost/compress/internal/cpuinfo +github.com/klauspost/compress/internal/snapref github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash # github.com/kr/text v0.2.0 @@ -260,7 +262,7 @@ github.com/morikuni/aec # github.com/opencontainers/go-digest v1.0.0 ## explicit; go 1.13 github.com/opencontainers/go-digest -# github.com/opencontainers/image-spec v1.1.0-rc2 +# github.com/opencontainers/image-spec v1.1.0-rc2.0.20221005185240-3a7f492d3f1b ## explicit; go 1.17 github.com/opencontainers/image-spec/specs-go github.com/opencontainers/image-spec/specs-go/v1 @@ -301,7 +303,7 @@ github.com/simplesurance/baur/v2/internal/deepcopy github.com/simplesurance/baur/v2/pkg/cfg github.com/simplesurance/baur/v2/pkg/storage github.com/simplesurance/baur/v2/pkg/storage/postgres -# github.com/sirupsen/logrus v1.9.0 +# github.com/sirupsen/logrus v1.9.3 ## explicit; go 1.13 github.com/sirupsen/logrus # github.com/spf13/cobra v1.8.0 @@ -314,7 +316,7 @@ github.com/spf13/pflag ## explicit; go 1.20 github.com/stretchr/testify/assert github.com/stretchr/testify/require -# golang.org/x/crypto v0.6.0 +# golang.org/x/crypto v0.14.0 ## explicit; go 1.17 golang.org/x/crypto/pbkdf2 # golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc @@ -323,11 +325,11 @@ golang.org/x/exp/maps # golang.org/x/mod v0.14.0 ## explicit; go 1.18 golang.org/x/mod/semver -# golang.org/x/sys v0.14.0 +# golang.org/x/sys v0.15.0 ## explicit; go 1.18 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.7.0 +# golang.org/x/text v0.13.0 ## explicit; go 1.17 golang.org/x/text/cases golang.org/x/text/internal